Mesencephalic astrocyte-derived neurotrophic factor homolog

Overview
NameMesencephalic astrocyte-derived neurotrophic factor homolog
Smed IDSMED30001979
Length (bp)700
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mesencephalic astrocyte-derived neurotrophic factor homolog (SMED30001979) t-SNE clustered cells

Violin plots show distribution of expression levels for Mesencephalic astrocyte-derived neurotrophic factor homolog (SMED30001979) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mesencephalic astrocyte-derived neurotrophic factor homolog (SMED30001979) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mesencephalic astrocyte-derived neurotrophic factor homolog (SMED30001979) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001979

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30001979h1SMcG0016892 dd_Smed_v4_1797_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001979h1SMcG0016892 dd_Smed_v4_1797_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001979h1SMcG0016892 dd_Smed_v4_1797_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001979h1SMcG0016892 dd_Smed_v4_1797_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Human
Match: MANF (mesencephalic astrocyte derived neurotrophic factor [Source:HGNC Symbol;Acc:HGNC:15461])

HSP 1 Score: 167.933 bits (424), Expect = 5.400e-52
Identity = 82/158 (51.90%), Postives = 110/158 (69.62%), Query Frame = 1
Query:  145 SAAVNENNCEVCVKFVRRLKDSL-NGDESANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIYDPKAASQR 615
            S A+   +CEVC+ ++ R    L + D + +   IE +    C+ ++GKE  LCYY+G    +AT I+  +S+PL+  +P EK+CEKLK  DSQICELKYDK IDL+ ++L K RVK+LKKIL++WGE CKGC EK+D+IR INE MP Y PKAAS R
Sbjct:   25 SRALRPGDCEVCISYLGRFYQDLKDRDVTFSPATIENELIKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICEKLKKKDSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASAR 182          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Human
Match: MANF (mesencephalic astrocyte derived neurotrophic factor [Source:HGNC Symbol;Acc:HGNC:15461])

HSP 1 Score: 167.548 bits (423), Expect = 6.601e-52
Identity = 82/158 (51.90%), Postives = 110/158 (69.62%), Query Frame = 1
Query:  145 SAAVNENNCEVCVKFVRRLKDSL-NGDESANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIYDPKAASQR 615
            S A+   +CEVC+ ++ R    L + D + +   IE +    C+ ++GKE  LCYY+G    +AT I+  +S+PL+  +P EK+CEKLK  DSQICELKYDK IDL+ ++L K RVK+LKKIL++WGE CKGC EK+D+IR INE MP Y PKAAS R
Sbjct:   22 SRALRPGDCEVCISYLGRFYQDLKDRDVTFSPATIENELIKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICEKLKKKDSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASAR 179          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Human
Match: CDNF (cerebral dopamine neurotrophic factor [Source:HGNC Symbol;Acc:HGNC:24913])

HSP 1 Score: 143.28 bits (360), Expect = 3.118e-42
Identity = 70/144 (48.61%), Postives = 97/144 (67.36%), Query Frame = 1
Query:  166 NCEVCVKFVRRLKDSLNGDESAN--IEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIY 591
            +CEVC +F+ R   SL  D   N  ++ IE++    C  +KGKE  LCYY+G    +AT I+  +++P+S  MPA K+CEKLK +DSQICELKY+K +DL  ++L K RV +LK+IL +WGEEC+ C EK D++ LI E  P Y
Sbjct:   36 DCEVCKEFLNRFYKSLI-DRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKY 178          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Human
Match: CDNF (cerebral dopamine neurotrophic factor [Source:HGNC Symbol;Acc:HGNC:24913])

HSP 1 Score: 100.523 bits (249), Expect = 5.727e-27
Identity = 44/76 (57.89%), Postives = 57/76 (75.00%), Query Frame = 1
Query:  364 LSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIY 591
            +S  MPA K+CEKLK +DSQICELKY+K +DL  ++L K RV +LK+IL +WGEEC+ C EK D++ LI E  P Y
Sbjct:    1 MSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKY 76          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Celegans
Match: manf-1 (Mesencephalic astrocyte-derived neurotrophic factor homolog [Source:UniProtKB/Swiss-Prot;Acc:Q9N3B0])

HSP 1 Score: 145.976 bits (367), Expect = 5.806e-44
Identity = 74/161 (45.96%), Postives = 104/161 (64.60%), Query Frame = 1
Query:  112 IIFLINVYYVVSAAVNENNCEVCVKFVRRLKDSLNGDESANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVC-EKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIY 591
            ++ LI++  VV++A     CEVC K +  +   +   + +  + I +  ++ C+T++ KE   C+Y+G L  SAT I+  +++PLSW MP EKVC EKLK  D+QICELKYDKP+D   I+L K RVK+LK IL  WGE CKGCTEK + I+ I E  P Y
Sbjct:    4 LVLLISLVIVVASAAA-PQCEVCKKVLDDVMAKVPAGDKSKPDAIGKVIREHCETTRNKENKFCFYIGALPESATSIMNEVTKPLSWSMPTEKVCLEKLKGKDAQICELKYDKPLDWKTIDLKKMRVKELKNILGEWGEVCKGCTEKAELIKRIEELKPKY 163          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Fly
Match: Manf (gene:FBgn0027095 transcript:FBtr0083283)

HSP 1 Score: 174.096 bits (440), Expect = 8.466e-55
Identity = 84/163 (51.53%), Postives = 108/163 (66.26%), Query Frame = 1
Query:  103 ILSIIFLINVYYVVSAAVNENNCEVCVKFVRRLKDSLNGDESANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIY 591
            ++ +I  +      S A+ E +CEVCVK VRR  DSL+     + ++IE  FK  CK  K KE   CYY+GGL  SAT I+  LS+PLSW MPAEK+CEKLK  D+QIC+L+Y+K IDL  ++L K +V+DLKKIL +W E C GC EK DFI+ I E  P Y
Sbjct:    6 MVVVIGFLATLAQTSLALKEEDCEVCVKTVRRFADSLDDSTKKDYKQIETAFKKFCKAQKNKEHRFCYYLGGLEESATGILNELSKPLSWSMPAEKICEKLKKKDAQICDLRYEKQIDLNSVDLKKLKVRDLKKILNDWDESCDGCLEKGDFIKRIEELKPKY 168          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Zebrafish
Match: manf (mesencephalic astrocyte-derived neurotrophic factor [Source:ZFIN;Acc:ZDB-GENE-060929-640])

HSP 1 Score: 152.14 bits (383), Expect = 4.215e-46
Identity = 85/174 (48.85%), Postives = 115/174 (66.09%), Query Frame = 1
Query:   97 MNILSIIFLINVYYVVSAAVNENNCEVCVKFVRRLKDSLNGDE-SANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIYDPKAASQR 615
            ++ LS+   + +    S A+ +  CEVCV F++RL  ++  +    + + IE+     CK +KGKE   CYY+G    +AT I   +S+P+S+ +P EK+CEKLK  DSQICELKYDK +DL+ ++L K +VKDLKKILE WGE CKGC EK+DFIR INE MP Y P AA  R
Sbjct:    4 LSGLSVALALALVPSCSDALKDGECEVCVGFLQRLYQTIQENNVKFDSDSIEKALLKSCKDAKGKENRFCYYIGATSDAATKITNEVSKPMSYHVPVEKICEKLKKKDSQICELKYDKQVDLSSVDLKKLKVKDLKKILEEWGESCKGCVEKSDFIRKINELMPKYAPSAAKAR 177          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Zebrafish
Match: manf (mesencephalic astrocyte-derived neurotrophic factor [Source:ZFIN;Acc:ZDB-GENE-060929-640])

HSP 1 Score: 152.14 bits (383), Expect = 4.215e-46
Identity = 85/174 (48.85%), Postives = 115/174 (66.09%), Query Frame = 1
Query:   97 MNILSIIFLINVYYVVSAAVNENNCEVCVKFVRRLKDSLNGDE-SANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIYDPKAASQR 615
            ++ LS+   + +    S A+ +  CEVCV F++RL  ++  +    + + IE+     CK +KGKE   CYY+G    +AT I   +S+P+S+ +P EK+CEKLK  DSQICELKYDK +DL+ ++L K +VKDLKKILE WGE CKGC EK+DFIR INE MP Y P AA  R
Sbjct:    4 LSGLSVALALALVPSCSDALKDGECEVCVGFLQRLYQTIQENNVKFDSDSIEKALLKSCKDAKGKENRFCYYIGATSDAATKITNEVSKPMSYHVPVEKICEKLKKKDSQICELKYDKQVDLSSVDLKKLKVKDLKKILEEWGESCKGCVEKSDFIRKINELMPKYAPSAAKAR 177          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Zebrafish
Match: cdnf (cerebral dopamine neurotrophic factor [Source:ZFIN;Acc:ZDB-GENE-070410-37])

HSP 1 Score: 118.627 bits (296), Expect = 5.564e-33
Identity = 60/145 (41.38%), Postives = 89/145 (61.38%), Query Frame = 1
Query:  157 NENNCEVCVKFVRRLKDSLNGDESA-NIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPI-DLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMP 585
            +   CEVCV F+ RL +SL    +  + E +EE     C  + GKE  LCYY+G    SA  +   + +PLS  +P  K+C++L+  D QICEL+Y++ + D +   L+K RV +LK++L +WGEEC+ C EK++FI LI E  P
Sbjct:   24 DAEECEVCVGFLGRLYNSLVIRHTELSPELVEEGLIRACAETTGKENRLCYYLGASSDSAAKVTGEVIRPLSAHVPVHKICQRLQRRDGQICELRYERLVLDWSTDALSKMRVLELKRVLASWGEECRACLEKSEFIALIQEVAP 168          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Zebrafish
Match: cdnf (cerebral dopamine neurotrophic factor [Source:ZFIN;Acc:ZDB-GENE-070410-37])

HSP 1 Score: 117.472 bits (293), Expect = 1.811e-32
Identity = 59/146 (40.41%), Postives = 88/146 (60.27%), Query Frame = 1
Query:  154 VNENNCEVCVKFVRRLKDSLNGDES-ANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPI-DLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMP 585
             +   CEVCV F+ RL +SL    +  + E +EE     C  + GKE  LCYY+G    SA  +   + +PLS  +P  K+C++L+  D QICEL+Y++ + D +   L+K R  +LK++L +WGEEC+ C EK++FI LI E  P
Sbjct:   23 TDAEECEVCVGFLGRLYNSLVIRHTELSPELVEEGLIRACAETTGKENRLCYYLGASSDSAAKVTGEVIRPLSAHVPVHKICQRLQRRDGQICELRYERLVLDWSTDALSKMRALELKRVLASWGEECRACLEKSEFIALIQEVAP 168          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Zebrafish
Match: cdnf (cerebral dopamine neurotrophic factor [Source:ZFIN;Acc:ZDB-GENE-070410-37])

HSP 1 Score: 117.472 bits (293), Expect = 1.811e-32
Identity = 59/146 (40.41%), Postives = 88/146 (60.27%), Query Frame = 1
Query:  154 VNENNCEVCVKFVRRLKDSLNGDES-ANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPI-DLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMP 585
             +   CEVCV F+ RL +SL    +  + E +EE     C  + GKE  LCYY+G    SA  +   + +PLS  +P  K+C++L+  D QICEL+Y++ + D +   L+K R  +LK++L +WGEEC+ C EK++FI LI E  P
Sbjct:   23 TDAEECEVCVGFLGRLYNSLVIRHTELSPELVEEGLIRACAETTGKENRLCYYLGASSDSAAKVTGEVIRPLSAHVPVHKICQRLQRRDGQICELRYERLVLDWSTDALSKMRALELKRVLASWGEECRACLEKSEFIALIQEVAP 168          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Xenopus
Match: manf (mesencephalic astrocyte-derived neurotrophic factor [Source:NCBI gene;Acc:549179])

HSP 1 Score: 143.665 bits (361), Expect = 1.256e-42
Identity = 81/174 (46.55%), Postives = 116/174 (66.67%), Query Frame = 1
Query:   97 MNILSIIFLINVYYVVSAAVNENNCEVCVKFVRRLKDSLNGDE-SANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIYDPKAASQR 615
            + ++++  ++ +    +AA+   +CEVC+ F+ RL  SL   +     + +E++    C  ++GKE  LCYY+G    +AT I   +S+PLS  +P EK+CEKLK  D QICELKYDK IDL+ ++L K +VK+LKKIL++WGE CKGC EK+DFIR INE MP Y P AA+ R
Sbjct:    4 LALITVTGMLALLPSDAAALKAGDCEVCISFMTRLYQSLKERKVEFKPDVVEKELLKTCNDARGKENRLCYYIGATSDAATKITNEVSRPLSNHIPPEKICEKLKKKDGQICELKYDKQIDLSTVDLKKLKVKELKKILDDWGESCKGCAEKSDFIRKINELMPKYAPNAANAR 177          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Xenopus
Match: CDNF (cerebral dopamine neurotrophic factor [Source:NCBI gene;Acc:100492278])

HSP 1 Score: 141.354 bits (355), Expect = 7.497e-42
Identity = 71/169 (42.01%), Postives = 108/169 (63.91%), Query Frame = 1
Query:   97 MNILSIIFLINVYYVVSAAV-NENNCEVCVKFVRRLKDSL---NGDESANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIY 591
            MN L+ + ++ + +  + +V +E  CEVC  ++ R   SL   N D +     IE++  ++C+ S GKE  LCYY+G    +AT I+  +++P+S  +P  K+CEKL+ +D QICELKY+K +DL  ++++K +V DLKKIL NWGE C+ C EK DF+ LI E  P Y
Sbjct:    1 MNFLAFVPVLGLCWGFACSVAHEAECEVCTDYLDRFYHSLLEKNADFTPA--AIEKELTEVCRKSTGKENRLCYYLGATSDAATKILGEVTRPMSAHVPTYKICEKLRKIDMQICELKYEKKLDLETMDISKMKVADLKKILNNWGETCRACIEKTDFVELIKELAPKY 167          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Xenopus
Match: manf (mesencephalic astrocyte-derived neurotrophic factor [Source:NCBI gene;Acc:549179])

HSP 1 Score: 133.265 bits (334), Expect = 2.758e-38
Identity = 77/148 (52.03%), Postives = 101/148 (68.24%), Query Frame = 1
Query:  175 VCVKFVRRLKDSLNGDE-SANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIYDPKAASQR 615
            VC+ F+ RL  SL   +     + +E++    C  ++GKE  LCYY+G    +AT I   +S+PLS  +P EK+CEKLK  D QICELKYDK IDL+ ++L K +VK+LKKIL++WGE CKGC EK+DFIR INE MP Y P AA+ R
Sbjct:   53 VCISFMTRLYQSLKERKVEFKPDVVEKELLKTCNDARGKENRLCYYIGATSDAATKITNEVSRPLSNHIPPEKICEKLKKKDGQICELKYDKQIDLSTVDLKKLKVKELKKILDDWGESCKGCAEKSDFIRKINELMPKYAPNAANAR 200          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Mouse
Match: Manf (mesencephalic astrocyte-derived neurotrophic factor [Source:MGI Symbol;Acc:MGI:1922090])

HSP 1 Score: 169.474 bits (428), Expect = 8.090e-53
Identity = 83/158 (52.53%), Postives = 111/158 (70.25%), Query Frame = 1
Query:  145 SAAVNENNCEVCVKFVRRLKDSL-NGDESANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIYDPKAASQR 615
            S A+   +CEVC+ ++ R    L + D + +   IEE+    C+ ++GKE  LCYY+G    +AT I+  +S+PL+  +P EK+CEKLK  DSQICELKYDK IDL+ ++L K RVK+LKKIL++WGE CKGC EK+D+IR INE MP Y PKAAS R
Sbjct:   19 SRALRPGDCEVCISYLGRFYQDLKDRDVTFSPATIEEELIKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICEKLKKKDSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGEMCKGCAEKSDYIRKINELMPKYAPKAASAR 176          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Mouse
Match: Manf (mesencephalic astrocyte-derived neurotrophic factor [Source:MGI Symbol;Acc:MGI:1922090])

HSP 1 Score: 160.999 bits (406), Expect = 1.241e-49
Identity = 79/148 (53.38%), Postives = 105/148 (70.95%), Query Frame = 1
Query:  175 VCVKFVRRLKDSL-NGDESANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIYDPKAASQR 615
            VC+ ++ R    L + D + +   IEE+    C+ ++GKE  LCYY+G    +AT I+  +S+PL+  +P EK+CEKLK  DSQICELKYDK IDL+ ++L K RVK+LKKIL++WGE CKGC EK+D+IR INE MP Y PKAAS R
Sbjct:   15 VCISYLGRFYQDLKDRDVTFSPATIEEELIKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICEKLKKKDSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGEMCKGCAEKSDYIRKINELMPKYAPKAASAR 162          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Mouse
Match: Cdnf (cerebral dopamine neurotrophic factor [Source:MGI Symbol;Acc:MGI:3606576])

HSP 1 Score: 140.584 bits (353), Expect = 1.880e-41
Identity = 71/145 (48.97%), Postives = 99/145 (68.28%), Query Frame = 1
Query:  166 NCEVCVKFVRRLKDSLNG---DESANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIY 591
            +CEVC +F+ R  +SL     D SA+   IE++  + C  +KGKE  LCYY+G    +AT I+  +++P+S  +PA K+CEKLK MDSQICELKY K +DL  ++L K RV +LK+IL+ WGEEC+ C EK+D++ LI E  P Y
Sbjct:   36 DCEVCKEFLDRFYNSLLSRGIDFSADT--IEKELLNFCSDAKGKENRLCYYLGATTDAATKILGEVTRPMSVHIPAVKICEKLKKMDSQICELKYGKKLDLASVDLWKMRVAELKQILQRWGEECRACAEKSDYVNLIRELAPKY 178          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Mouse
Match: Manf (mesencephalic astrocyte-derived neurotrophic factor [Source:MGI Symbol;Acc:MGI:1922090])

HSP 1 Score: 93.9745 bits (232), Expect = 4.989e-24
Identity = 45/103 (43.69%), Postives = 65/103 (63.11%), Query Frame = 1
Query:  145 SAAVNENNCEVCVKFVRRLKDSL-NGDESANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKP 450
            S A+   +CEVC+ ++ R    L + D + +   IEE+    C+ ++GKE  LCYY+G    +AT I+  +S+PL+  +P EK+CEKLK  DSQICELKY  P
Sbjct:   10 SRALRPGDCEVCISYLGRFYQDLKDRDVTFSPATIEEELIKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICEKLKKKDSQICELKYASP 112          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Mouse
Match: Manf (mesencephalic astrocyte-derived neurotrophic factor [Source:MGI Symbol;Acc:MGI:1922090])

HSP 1 Score: 91.6633 bits (226), Expect = 3.189e-23
Identity = 44/100 (44.00%), Postives = 64/100 (64.00%), Query Frame = 1
Query:  145 SAAVNENNCEVCVKFVRRLKDSL-NGDESANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKY 441
            S A+   +CEVC+ ++ R    L + D + +   IEE+    C+ ++GKE  LCYY+G    +AT I+  +S+PL+  +P EK+CEKLK  DSQICELKY
Sbjct:   11 SRALRPGDCEVCISYLGRFYQDLKDRDVTFSPATIEEELIKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICEKLKKKDSQICELKY 110          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. UniProt/SwissProt
Match: sp|B4JT39|ARMET_DROGR (Mesencephalic astrocyte-derived neurotrophic factor homolog OS=Drosophila grimshawi OX=7222 GN=Manf PE=3 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 9.584e-56
Identity = 89/168 (52.98%), Postives = 115/168 (68.45%), Query Frame = 1
Query:   97 MNILSIIFLINVYYVVSA---AVNENNCEVCVKFVRRLKDSLNGDESANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIY 591
            MN   I+ +  +   V+    A+ E++CEVCVK VRR  D+L+     + + IE  FK  CKT K KE+  CYY+GGL  SAT I+  LS+PLSW MPAEKVCEKLK MD+QIC+L+YDK IDL  ++L K +V+DLKKIL +W E C+GC EK+DFI+ I E  P Y
Sbjct:    1 MNTSQIVLMFCLVVGVAQTALALKEDDCEVCVKTVRRFADTLDDATKKDYKLIEADFKKFCKTQKNKEQRFCYYLGGLEESATGILNELSKPLSWSMPAEKVCEKLKKMDAQICDLRYDKQIDLNNVDLKKLKVRDLKKILNDWDENCEGCLEKSDFIKRIEELKPKY 168          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. UniProt/SwissProt
Match: sp|B4IBX2|ARMET_DROSE (Mesencephalic astrocyte-derived neurotrophic factor homolog OS=Drosophila sechellia OX=7238 GN=Manf PE=3 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.159e-54
Identity = 85/166 (51.20%), Postives = 111/166 (66.87%), Query Frame = 1
Query:   94 SMNILSIIFLINVYYVVSAAVNENNCEVCVKFVRRLKDSLNGDESANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIY 591
            + +++ +I  +      S A+ E +CEVCVK VRR  DSL+     + ++IE  FK  CKT K KE   CYY+GGL  SAT I+  LS+PLSW MPAEK+CEKLK  D+QIC+L+Y+K IDL  ++L K +V+DLKKIL +W E C GC EK DFI+ I E  P Y
Sbjct:    3 TWHMVVVIGFLATLAQTSLALKEEDCEVCVKTVRRFADSLDDSTKKDYKQIETVFKKFCKTQKNKEHRFCYYLGGLEESATGILNELSKPLSWSMPAEKICEKLKKKDAQICDLRYEKQIDLNSVDLKKLKVRDLKKILNDWDESCDGCLEKGDFIKRIEELKPKY 168          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. UniProt/SwissProt
Match: sp|B3P113|ARMET_DROER (Mesencephalic astrocyte-derived neurotrophic factor homolog OS=Drosophila erecta OX=7220 GN=Manf PE=3 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 1.932e-54
Identity = 85/163 (52.15%), Postives = 109/163 (66.87%), Query Frame = 1
Query:  103 ILSIIFLINVYYVVSAAVNENNCEVCVKFVRRLKDSLNGDESANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIY 591
            ++ +I  +      S A+ E +CEVCVK VRR  DSL+     + ++IE  FK  CKT K KE   CYY+GGL  SAT I+  LS+PLSW MPAEKVCEKLK  D+Q+C+L+Y+K IDL  ++L K +V+DLKKIL +W E C GC EK DFI+ I E  P Y
Sbjct:    6 MVVVIGFLATLAQTSLALKEEDCEVCVKTVRRFADSLDESTKKDYKQIETAFKKFCKTQKNKEHRFCYYLGGLEESATGILNELSKPLSWSMPAEKVCEKLKKKDAQVCDLRYEKQIDLNSVDLKKLKVRDLKKILNDWDESCDGCLEKGDFIKRIEELKPKY 168          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. UniProt/SwissProt
Match: sp|B4QX46|ARMET_DROSI (Mesencephalic astrocyte-derived neurotrophic factor homolog OS=Drosophila simulans OX=7240 GN=Manf PE=3 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 3.258e-54
Identity = 84/166 (50.60%), Postives = 110/166 (66.27%), Query Frame = 1
Query:   94 SMNILSIIFLINVYYVVSAAVNENNCEVCVKFVRRLKDSLNGDESANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIY 591
            + +++ +I  +      S A+ E +CEVCVK VRR  DSL+     + ++IE  FK  CK  K KE   CYY+GGL  SAT I+  LS+PLSW MPAEK+CEKLK  D+QIC+L+Y+K IDL  ++L K +V+DLKKIL +W E C GC EK DFI+ I E  P Y
Sbjct:    3 TWHMVVVIGFLATLAQTSLALKEEDCEVCVKTVRRFADSLDDSTKKDYKQIETAFKKFCKAQKNKEHRFCYYLGGLEESATGILNELSKPLSWSMPAEKICEKLKKKDAQICDLRYEKQIDLNSVDLKKLKVRDLKKILNDWDESCDGCLEKGDFIKRIEELKPKY 168          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. UniProt/SwissProt
Match: sp|B4PR07|ARMET_DROYA (Mesencephalic astrocyte-derived neurotrophic factor homolog OS=Drosophila yakuba OX=7245 GN=Manf PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 7.779e-54
Identity = 84/163 (51.53%), Postives = 109/163 (66.87%), Query Frame = 1
Query:  103 ILSIIFLINVYYVVSAAVNENNCEVCVKFVRRLKDSLNGDESANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIY 591
            ++ +I  +      S A+ E +CEVCVK VRR  +SL+     + ++IE  FK  CKT K KE   CYY+GGL  SAT I+  LS+PLSW MPAEK+CEKLK  D+QIC+L+Y+K IDL  ++L K +V+DLKKIL +W E C GC EK DFI+ I E  P Y
Sbjct:    6 MVVVIGFLATLVQTSLALKEEDCEVCVKTVRRFAESLDDSTKKDYKQIETAFKKFCKTQKNKEHRFCYYLGGLEESATGILNELSKPLSWSMPAEKICEKLKKKDAQICDLRYEKQIDLNSVDLKKLKVRDLKKILNDWDESCDGCLEKGDFIKRIEELKPKY 168          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. TrEMBL
Match: A0A267E5M7 (Saposin B-type domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027409g2 PE=4 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 8.832e-71
Identity = 101/174 (58.05%), Postives = 131/174 (75.29%), Query Frame = 1
Query:   97 MNILSIIFLINVYYVVSAAVNENNCEVCVKFVRRLKDSLNGDESANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIYDPKAASQRK 618
            M +  + F +   Y   A VN+  CEVCVKFVRR ++SL      N++KI + FK  C T+KGK+E  CYYVGGL TSATYIV  L++P+SWGMPAEKVCEKLKA DSQIC+LKY+K +D + +  +K +VK+LKKILENWGE C+GCTEK++FIRL+ E +P Y+P+AA +RK
Sbjct:    1 MRLFLVTFFLCFTYTFGAKVNDETCEVCVKFVRRFENSLEDAAKGNMDKISDAFKKFCLTAKGKDERFCYYVGGLKTSATYIVNELAKPVSWGMPAEKVCEKLKAKDSQICDLKYEKSVDFSTVKFDKLKVKELKKILENWGEVCRGCTEKSEFIRLVKELLPKYEPEAAKKRK 174          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. TrEMBL
Match: A0A1I8HMC0 (Saposin B-type domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027409g1 PE=4 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 9.430e-71
Identity = 101/174 (58.05%), Postives = 132/174 (75.86%), Query Frame = 1
Query:   97 MNILSIIFLINVYYVVSAAVNENNCEVCVKFVRRLKDSLNGDESANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIYDPKAASQRK 618
            M ++ + F +   Y   A VN+  CEVCVKFVRR ++SL      N++KI + FK  C T+KGK+E  CYYVGGL TSATYIV  L++P+SWGMPAEKVCEKLKA DSQIC+LKY+K +D + +  +K +VK+LKKILENWGE C+GCTEK++FIRL+ E +P Y+P+AA +RK
Sbjct:    1 MRLILVTFFLCFTYTFGAKVNDETCEVCVKFVRRFENSLEDAAKGNMDKISDAFKKFCLTAKGKDERFCYYVGGLKTSATYIVNELAKPVSWGMPAEKVCEKLKAKDSQICDLKYEKSVDFSTVKFDKLKVKELKKILENWGEVCRGCTEKSEFIRLVKELLPKYEPEAAKKRK 174          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. TrEMBL
Match: A0A0M3QXH5 (Manf OS=Drosophila busckii OX=30019 GN=Dbus_chr3Rg629 PE=4 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 4.185e-53
Identity = 89/170 (52.35%), Postives = 115/170 (67.65%), Query Frame = 1
Query:   91 FSMNILSIIFLINVYYVVSA---AVNENNCEVCVKFVRRLKDSLNGDESANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIY 591
            F MN L  +F+I     V+    A+ E++CEVCVK V+R  D+L+     + + IE  FK  CKT K KE   CYY+GGL  SAT I+  LS+PLSW MPAEKVCEKLK  D+QIC+L+Y+K IDL  ++L K +V+DLKKIL +W E C+GC EK+DFI+ I E  P Y
Sbjct:    3 FEMNTLHFVFIICFILSVTHTTIALKEDDCEVCVKTVKRFSDTLDDATKKDYKLIETAFKHYCKTQKNKEHRFCYYLGGLEESATGILNELSKPLSWSMPAEKVCEKLKKKDAQICDLRYEKQIDLNKVDLKKLKVRDLKKILNDWDEGCEGCLEKSDFIKRIEELKPKY 172          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. TrEMBL
Match: R7TSG7 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_227190 PE=4 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 5.667e-53
Identity = 83/156 (53.21%), Postives = 111/156 (71.15%), Query Frame = 1
Query:  148 AAVNENNCEVCVKFVRRLKDSLNGDESANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIYDPKAASQR 615
            + V  +NCEVC+ F+ +  D L+ D  +   KIE +F+ +CK++K  +   CYYVGGL  SAT I+  +S+P+SWG+PAEKVC KL   D QICELKYDK +DL  ++L K RVK+LK IL  W E+CKGCTEK+D++RLI E MP Y P+A +QR
Sbjct:   29 STVTSDNCEVCLSFMTKFIDGLDSDVKSTPAKIEAEFRKICKSTKKDDNRFCYYVGGLDESATGILGEMSKPVSWGVPAEKVCLKLYRKDEQICELKYDKQLDLKNVDLKKLRVKELKAILTEWDEKCKGCTEKDDYVRLIEELMPRYAPEAHAQR 184          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. TrEMBL
Match: W8BRN2 (Mesencephalic astrocyte-derived neurotrophic factor OS=Ceratitis capitata OX=7213 GN=ARMET PE=2 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 1.237e-52
Identity = 85/167 (50.90%), Postives = 115/167 (68.86%), Query Frame = 1
Query:   91 FSMNILSIIFLINVYYVVSAAVNENNCEVCVKFVRRLKDSLNGDESANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIY 591
              +++L + F+I V    + A+ E +CEVC+K V+R  D+L+ D   + +KIE++FK  CK  K KE   CYY+GGL  SAT I+  LS+PLSW MPA+K+CEKLK  D+QICEL+Y+K IDL  ++L K +V+DLKKIL +W E C GC EK DFI+ I E  P Y
Sbjct:    1 MRVHLLIVAFII-VLVQSTKALKEEDCEVCIKTVKRFADTLDQDTKKDHKKIEDEFKSFCKKQKNKEHRFCYYLGGLEESATGILNELSKPLSWSMPADKICEKLKKKDAQICELRYEKQIDLNNVDLKKLKVRDLKKILNDWDESCDGCIEKTDFIKRIEELKPKY 166          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Cavefish
Match: manf (mesencephalic astrocyte derived neurotrophic factor [Source:NCBI gene;Acc:103032583])

HSP 1 Score: 151.369 bits (381), Expect = 9.577e-46
Identity = 86/171 (50.29%), Postives = 110/171 (64.33%), Query Frame = 1
Query:  106 LSIIFLINVYYVVSAAVNENNCEVCVKFVRRLKDSL-NGDESANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIYDPKAASQR 615
            LS+   + +    S  + E  CEVCV F+ +   SL + D     + IE+     CK +KGKE   CYY+G    +AT I+  +S+PLS+ +P EKVCEKLK  DSQICELKYDK +DL+ ++L K +VKDLKKIL+ WGE CKGC EK+DFIR I E MP Y P AA  R
Sbjct:    7 LSVALALALVPGSSEGLKEGECEVCVSFLGKFYQSLKDNDVKFTSDDIEKALMKTCKEAKGKENRFCYYIGATSDAATKIINEVSKPLSYHVPVEKVCEKLKKKDSQICELKYDKQVDLSSVDLKKLKVKDLKKILDEWGESCKGCVEKSDFIRKITELMPKYAPHAAKAR 177          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Cavefish
Match: cdnf (cerebral dopamine neurotrophic factor [Source:NCBI gene;Acc:103038267])

HSP 1 Score: 126.716 bits (317), Expect = 3.794e-36
Identity = 63/179 (35.20%), Postives = 105/179 (58.66%), Query Frame = 1
Query:   97 MNILSIIFLINVYYVVSAAVNENNCEVCVKFVRRLKDSLNGDESA-NIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPI-DLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIYDPKAASQRKKVD 627
            M++ + + ++ + +      +   CEVCV+F+ RL  SL       +   +EE+ +  C  + GKE  LCYY+G    +A  +   +S+PLS  +P +K+C++L+  D QICEL+Y++ + D +   L+K RV +LK++L +WGEEC+ C EK+D I LI E  P ++   A  R  +D
Sbjct:    1 MSLTNTVAVLLLSWGFCTVTDAEECEVCVRFLERLYKSLVATHRELSSAFVEEELRKACAEATGKENRLCYYLGASSDAAAKVTGEVSRPLSAHVPVQKICQRLQHRDQQICELRYEQQVLDWSREALSKMRVLELKRVLASWGEECRACLEKSDLIDLIQEVAPKHN--TAQPRTHLD 177          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Sea Lamprey
Match: manf (mesencephalic astrocyte-derived neurotrophic factor [Source:ZFIN;Acc:ZDB-GENE-060929-640])

HSP 1 Score: 136.346 bits (342), Expect = 1.553e-40
Identity = 81/176 (46.02%), Postives = 116/176 (65.91%), Query Frame = 1
Query:   97 MNILSIIFL-INVYYVVS--AAVNENNCEVCVKFVRRLKDSL---NGDESANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIYDPKAA 606
            + +LS + +   + Y+VS  A + + +  VC+ F+ +  +SL   N D +  ++ +E++    C  +KGKE  LCYY+G    +AT I   +S+PLS+ +P  K+CEKLK  DSQICELKY+K IDL  ++L K +VKDLK+IL++WGE CKGC EK+DFIR INE MP Y P  A
Sbjct:    8 LTLLSAVAVSTRIKYLVSPNALLTQGDWTVCITFLEKFYNSLKERNADFT--VDNVEKELIKTCSDAKGKENRLCYYLGATSDAATKITNEVSKPLSFHVPVAKICEKLKKQDSQICELKYEKQIDLGTVDLKKLKVKDLKRILDDWGEGCKGCAEKSDFIRKINELMPKYAPNIA 181          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Nematostella
Match: EDO48212 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKA3])

HSP 1 Score: 51.6026 bits (122), Expect = 2.211e-9
Identity = 25/47 (53.19%), Postives = 32/47 (68.09%), Query Frame = 1
Query:  442 DKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKM 582
            ++ IDL   NL K RVK LKKIL ++ E+C GC EK DFI+ I + M
Sbjct:   10 EQKIDLKNTNLKKLRVKQLKKILNDFDEQCHGCVEKADFIKKIEDVM 56          
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Medaka
Match: manf (mesencephalic astrocyte derived neurotrophic factor [Source:NCBI gene;Acc:101162997])

HSP 1 Score: 150.599 bits (379), Expect = 1.567e-45
Identity = 89/159 (55.97%), Postives = 109/159 (68.55%), Query Frame = 1
Query:  151 AVNENNCEVCV----KFVRRLKDSLNGDESANIEKIEEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVCEKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTEKNDFIRLINEKMPIYDPKAASQR 615
            A+ E  CEVCV    KF + LKDS +  +SA+IEK   K    C  +KGKE   CYY+G    +AT I+  +S+PLS+  P EK+CEKLK  DSQICELKYDK +DL+ ++L K +VKDLKKILE WGE CKGC EK+DFIR I E MP Y P AA+ R
Sbjct:   22 ALKEGECEVCVSFLDKFYQSLKDSDSSFKSADIEKALTK---SCNEAKGKENRFCYYIGATSDAATKIINEVSKPLSYHAPVEKICEKLKKKDSQICELKYDKQLDLSTVDLKKLKVKDLKKILEEWGESCKGCAEKSDFIRKITELMPQYAPAAANAR 177          
The following BLAST results are available for this feature:
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
MANF5.400e-5251.90mesencephalic astrocyte derived neurotrophic facto... [more]
MANF6.601e-5251.90mesencephalic astrocyte derived neurotrophic facto... [more]
CDNF3.118e-4248.61cerebral dopamine neurotrophic factor [Source:HGNC... [more]
CDNF5.727e-2757.89cerebral dopamine neurotrophic factor [Source:HGNC... [more]
back to top
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
manf-15.806e-4445.96Mesencephalic astrocyte-derived neurotrophic facto... [more]
back to top
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Manf8.466e-5551.53gene:FBgn0027095 transcript:FBtr0083283[more]
back to top
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
manf4.215e-4648.85mesencephalic astrocyte-derived neurotrophic facto... [more]
manf4.215e-4648.85mesencephalic astrocyte-derived neurotrophic facto... [more]
cdnf5.564e-3341.38cerebral dopamine neurotrophic factor [Source:ZFIN... [more]
cdnf1.811e-3240.41cerebral dopamine neurotrophic factor [Source:ZFIN... [more]
cdnf1.811e-3240.41cerebral dopamine neurotrophic factor [Source:ZFIN... [more]
back to top
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
manf1.256e-4246.55mesencephalic astrocyte-derived neurotrophic facto... [more]
CDNF7.497e-4242.01cerebral dopamine neurotrophic factor [Source:NCBI... [more]
manf2.758e-3852.03mesencephalic astrocyte-derived neurotrophic facto... [more]
back to top
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Manf8.090e-5352.53mesencephalic astrocyte-derived neurotrophic facto... [more]
Manf1.241e-4953.38mesencephalic astrocyte-derived neurotrophic facto... [more]
Cdnf1.880e-4148.97cerebral dopamine neurotrophic factor [Source:MGI ... [more]
Manf4.989e-2443.69mesencephalic astrocyte-derived neurotrophic facto... [more]
Manf3.189e-2344.00mesencephalic astrocyte-derived neurotrophic facto... [more]
back to top
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B4JT39|ARMET_DROGR9.584e-5652.98Mesencephalic astrocyte-derived neurotrophic facto... [more]
sp|B4IBX2|ARMET_DROSE1.159e-5451.20Mesencephalic astrocyte-derived neurotrophic facto... [more]
sp|B3P113|ARMET_DROER1.932e-5452.15Mesencephalic astrocyte-derived neurotrophic facto... [more]
sp|B4QX46|ARMET_DROSI3.258e-5450.60Mesencephalic astrocyte-derived neurotrophic facto... [more]
sp|B4PR07|ARMET_DROYA7.779e-5451.53Mesencephalic astrocyte-derived neurotrophic facto... [more]
back to top
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267E5M78.832e-7158.05Saposin B-type domain-containing protein OS=Macros... [more]
A0A1I8HMC09.430e-7158.05Saposin B-type domain-containing protein OS=Macros... [more]
A0A0M3QXH54.185e-5352.35Manf OS=Drosophila busckii OX=30019 GN=Dbus_chr3Rg... [more]
R7TSG75.667e-5353.21Uncharacterized protein OS=Capitella teleta OX=283... [more]
W8BRN21.237e-5250.90Mesencephalic astrocyte-derived neurotrophic facto... [more]
back to top
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
manf9.577e-4650.29mesencephalic astrocyte derived neurotrophic facto... [more]
cdnf3.794e-3635.20cerebral dopamine neurotrophic factor [Source:NCBI... [more]
back to top
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
manf1.553e-4046.02mesencephalic astrocyte-derived neurotrophic facto... [more]
back to top
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO482122.211e-953.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
manf1.567e-4555.97mesencephalic astrocyte derived neurotrophic facto... [more]
back to top
BLAST of Mesencephalic astrocyte-derived neurotrophic factor homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001979 ID=SMED30001979|Name=Mesencephalic astrocyte-derived neurotrophic factor homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=700bp
CGTCAATTTAAAGTATTTTAAACTTGTTTAACCAATTATTTTTTAACAAC
TCATCATTTTTTTTAATTATCTATTATTAATTAGTGATATTTTTCGATGA
ATATTTTATCAATAATTTTTCTAATAAATGTATACTATGTTGTGTCGGCT
GCAGTTAATGAAAATAATTGCGAAGTTTGTGTTAAGTTTGTGAGACGCTT
GAAAGATAGTCTAAATGGAGATGAAAGTGCAAATATTGAAAAAATTGAAG
AAAAATTCAAAGATATGTGCAAAACAAGTAAAGGAAAAGAAGAAAGTCTA
TGTTATTATGTTGGTGGATTGATAACTTCTGCTACATATATTGTAAAACA
TTTGTCTCAACCTTTAAGCTGGGGTATGCCCGCTGAAAAAGTCTGTGAAA
AATTAAAAGCAATGGATTCACAAATTTGTGAATTGAAATATGATAAACCA
ATTGATCTTACTGGTATTAATCTTAACAAAGCTCGTGTTAAAGATCTCAA
AAAAATATTGGAAAATTGGGGTGAAGAATGCAAAGGTTGTACAGAAAAAA
ATGATTTTATCAGATTAATAAATGAAAAAATGCCTATCTATGATCCTAAA
GCAGCCAGTCAAAGAAAGAAAGTCGATTTGTAGTTAGGGGAATATTGAGT
TTTTATTCAGGATGTTGTAATTAAATAAAATATTAAAATTCAAAAAAAAA
back to top

protein sequence of SMED30001979-orf-1

>SMED30001979-orf-1 ID=SMED30001979-orf-1|Name=SMED30001979-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=179bp
MNILSIIFLINVYYVVSAAVNENNCEVCVKFVRRLKDSLNGDESANIEKI
EEKFKDMCKTSKGKEESLCYYVGGLITSATYIVKHLSQPLSWGMPAEKVC
EKLKAMDSQICELKYDKPIDLTGINLNKARVKDLKKILENWGEECKGCTE
KNDFIRLINEKMPIYDPKAASQRKKVDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0002032epidermal cell
Vocabulary: cellular component
TermDefinition
GO:0045202synapse
GO:0005576extracellular region
GO:0005783endoplasmic reticulum
GO:0012505endomembrane system
Vocabulary: INTERPRO
TermDefinition
IPR011001Saposin-like
IPR019345Armet_prot
Vocabulary: biological process
TermDefinition
GO:0001963synaptic transmission, dopaminergic
GO:0007275multicellular organism development
GO:0031175neuron projection development
GO:0042417dopamine metabolic process
GO:0070050neuron cellular homeostasis