SZ12-1

Overview
NameSZ12-1 (AFD29606.1)
Smed IDSMED30001977
Length (bp)2227
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SZ12-1 (SMED30001977) t-SNE clustered cells

Violin plots show distribution of expression levels for SZ12-1 (SMED30001977) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SZ12-1 (SMED30001977) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SZ12-1 (SMED30001977) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001977

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30001977SMESG000035646.1 SmedASXL_011791SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30001977SMESG000035646.1 SmedASXL_011791SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30001977SMESG000035646.1 SmedASXL_011790SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30001977SMESG000035646.1 SmedASXL_011790SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30001977SMESG000035646.1 dd_Smed_v4_9993_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001977SMESG000035646.1 dd_Smed_v4_9993_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001977SMESG000035646.1 dd_Smed_v4_9993_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail stripeSMED30001977SMESG000035646.1 isotig19342be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30001977SMESG000035646.1 isotig19342be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
tail stripeSMED30001977SMESG000035646.1 isotig23175be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30001977SMESG000035646.1 isotig23175be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30001977SMESG000035646.1 SMED_28607_V2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30001977SMESG000035646.1 SMED_28607_V2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SZ12-1 vs. Ensembl Human
Match: SUZ12 (SUZ12 polycomb repressive complex 2 subunit [Source:HGNC Symbol;Acc:HGNC:17101])

HSP 1 Score: 118.242 bits (295), Expect = 9.751e-27
Identity = 108/353 (30.59%), Postives = 177/353 (50.14%), Query Frame = 2
Query: 1187 QTRNKSLPPIIKISPNKTRDGYSAGGYGENDFTQDLRLSSIRLKE---------KEKIEVN-------IAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQV-------NPNDF--DFGYVLSENYPVRRMPLTELIYYRYQKSAV----------------KTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLEN----FVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDKI 2107
            +T +KS  PI K  P  TR+  S   + EN         +I +KE         KEK   N       I Y+F+ N    Q T+ +  L CPWC LN      LY+    LL HL   HSR +F      N +   K  +I  DV++N+        NP D     G+  S N PV+R P+T ++  R +++                  +T+   HNRLY H+ + + L+  E ++DSE E++ +WL ++   ++EEFSD+N  EK+V+++WN  ++ +G +++D+Q+ +    FV+N+ Q+II+        K++   FMLHLV++ DF ++S  ++ + +  L E   K+
Sbjct:  364 ETNDKSTAPIAK--PLATRNSESL--HQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRK---LYS----LLKHLKLCHSRFIF------NYVYHPKGARI--DVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHG-FIADNQMNHACMLFVENYGQKIIK--------KNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKL 688          
BLAST of SZ12-1 vs. Ensembl Human
Match: SUZ12 (SUZ12 polycomb repressive complex 2 subunit [Source:HGNC Symbol;Acc:HGNC:17101])

HSP 1 Score: 117.857 bits (294), Expect = 1.019e-26
Identity = 108/353 (30.59%), Postives = 177/353 (50.14%), Query Frame = 2
Query: 1187 QTRNKSLPPIIKISPNKTRDGYSAGGYGENDFTQDLRLSSIRLKE---------KEKIEVN-------IAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQV-------NPNDF--DFGYVLSENYPVRRMPLTELIYYRYQKSAV----------------KTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLEN----FVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDKI 2107
            +T +KS  PI K  P  TR+  S   + EN         +I +KE         KEK   N       I Y+F+ N    Q T+ +  L CPWC LN      LY+    LL HL   HSR +F      N +   K  +I  DV++N+        NP D     G+  S N PV+R P+T ++  R +++                  +T+   HNRLY H+ + + L+  E ++DSE E++ +WL ++   ++EEFSD+N  EK+V+++WN  ++ +G +++D+Q+ +    FV+N+ Q+II+        K++   FMLHLV++ DF ++S  ++ + +  L E   K+
Sbjct:  341 ETNDKSTAPIAK--PLATRNSESL--HQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRK---LYS----LLKHLKLCHSRFIF------NYVYHPKGARI--DVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHG-FIADNQMNHACMLFVENYGQKIIK--------KNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKL 665          
BLAST of SZ12-1 vs. Ensembl Fly
Match: Su(z)12 (gene:FBgn0020887 transcript:FBtr0074916)

HSP 1 Score: 89.7373 bits (221), Expect = 4.097e-18
Identity = 81/280 (28.93%), Postives = 134/280 (47.86%), Query Frame = 2
Query: 1337 VNIAYKFVVNEKIVQWTQ-TKHLICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNL-----NQVNPNDFDFGYVLSENYPVRRMPLTELIY--YRYQKSAVKTF-----------RKY---HNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLENFVKNFIQRIIEDDNQLKEV--KSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDK 2104
            + I Y F+ +    Q T+ T+ L CPWC      G D    +  LL HL   H+R  FT +   +   ++ T     D +      +   P+   F        PVRR  +T L+    R QK+ +  F           R Y   HNRLY HT + + +   E DIDSE E +  WL  +  + ++EFSD+N  EK+++++WN  ++ +G +V D QL    + F+      D +  E+  K++   F+LH+ +L D+G+++A  + + ++ L   L K
Sbjct:  389 IQIVYNFMYSNNTRQQTEYTQELNCPWC------GLDCLRLYA-LLKHLKLCHARFNFTYQPAGSGARIDVTINDAYDGSYAGSPYDLAGPSGSSFARTCG---PVRRTSVTSLMVCRPRRQKTCLDEFLELDEDEISNQRSYITGHNRLYHHTETCLPVHPKELDIDSEGESDPLWLRQKTIQMIDEFSDVNEGEKELMKLWNLHVMRHG-FVGDCQLPIACEMFL------DAKGTEIVRKNLYRNFILHMCSLFDYGLIAAETVYKTVQKLQGLLSK 651          
BLAST of SZ12-1 vs. Ensembl Fly
Match: Su(z)12 (gene:FBgn0020887 transcript:FBtr0074917)

HSP 1 Score: 88.9669 bits (219), Expect = 7.067e-18
Identity = 81/280 (28.93%), Postives = 134/280 (47.86%), Query Frame = 2
Query: 1337 VNIAYKFVVNEKIVQWTQ-TKHLICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNL-----NQVNPNDFDFGYVLSENYPVRRMPLTELIY--YRYQKSAVKTF-----------RKY---HNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLENFVKNFIQRIIEDDNQLKEV--KSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDK 2104
            + I Y F+ +    Q T+ T+ L CPWC      G D    +  LL HL   H+R  FT +   +   ++ T     D +      +   P+   F        PVRR  +T L+    R QK+ +  F           R Y   HNRLY HT + + +   E DIDSE E +  WL  +  + ++EFSD+N  EK+++++WN  ++ +G +V D QL    + F+      D +  E+  K++   F+LH+ +L D+G+++A  + + ++ L   L K
Sbjct:  389 IQIVYNFMYSNNTRQQTEYTQELNCPWC------GLDCLRLYA-LLKHLKLCHARFNFTYQPAGSGARIDVTINDAYDGSYAGSPYDLAGPSGSSFARTCG---PVRRTSVTSLMVCRPRRQKTCLDEFLELDEDEISNQRSYITGHNRLYHHTETCLPVHPKELDIDSEGESDPLWLRQKTIQMIDEFSDVNEGEKELMKLWNLHVMRHG-FVGDCQLPIACEMFL------DAKGTEIVRKNLYRNFILHMCSLFDYGLIAAETVYKTVQKLQGLLSK 651          
BLAST of SZ12-1 vs. Ensembl Zebrafish
Match: suz12a (SUZ12 polycomb repressive complex 2 subunit a [Source:NCBI gene;Acc:794171])

HSP 1 Score: 110.923 bits (276), Expect = 9.526e-25
Identity = 96/334 (28.74%), Postives = 164/334 (49.10%), Query Frame = 2
Query: 1178 KPMQTRNKSLPPIIKISPNKTRDGYSAGGYGEND-FTQDLRLSSIRLKEKEKIE----VNIAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQV-------NPNDF--DFGYVLSENYPVRRMPLTELIYYRYQKSAV----------------KTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLENFVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWL 2086
            KP+ TRN        +  +KT +         ND    DL +     +E+  IE    +++ Y+F+ N    Q T+ +  L CPWC LN      LY+    LL HL   HSR +F      N +   K  +I  DV++N+        NP D     G+  S N PV+R P+T+++  R ++S                  +T+   HNRLY H+ S   L+  E ++DSE E +  WL ++   ++EEF+D+N  EK+++++WN  ++ +G +++D+Q+     +F    +E    +   K++    +LHL+N+ DFG+++ A + + M  L
Sbjct:  340 KPLATRNSE---SSTVDSSKTSNVKPPQAVAVNDSLGTDLPVR----REQTHIEPCQKLHVYYQFLYNNNTRQQTEARDDLHCPWCTLNCRK---LYS----LLKHLKLSHSRFIF------NYVPHPKGARI--DVSINECYDGSYVGNPQDILCQPGFAFSRNGPVKRTPVTQILVCRPKRSKPSLSEFLEPEDGEQEQQRTYISGHNRLYFHSDSCTPLRPQEMEVDSEDERDPDWLREKTAMQIEEFTDVNEGEKEIMKLWNLLVMKHG-FIADNQMNQACMSF----VEQHGTIMVEKNLCRNALLHLINMHDFGLITTATIDKAMTHL 646          
BLAST of SZ12-1 vs. Ensembl Zebrafish
Match: suz12b (SUZ12 polycomb repressive complex 2 subunit b [Source:NCBI gene;Acc:561871])

HSP 1 Score: 106.301 bits (264), Expect = 2.851e-23
Identity = 85/279 (30.47%), Postives = 145/279 (51.97%), Query Frame = 2
Query: 1334 EVNIAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQV-------NPNDF--DFGYVLSENYPVRRMPLTELIYYRYQKSAV----------------KTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLENFVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDE 2092
            ++ I Y+F+ N    Q T+ +  L CPWC LN      LY+    LL HL   HSR +F      N +   K  +I  DV++N+        NP D     G+  S N PV+R  +T ++  R +++                  +T+   HNRLY H+ S M L+  E ++DSE E + +WL ++   ++EEF+D+N  EK+V+++WN  ++  G +++D+Q+      F++  I   + ++  +++   F+LHLVNL DF +++ A + + M  L E
Sbjct:  385 KLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRK---LYS----LLKHLKLSHSRFIF------NYVPHPKGARI--DVSINECYDGSYVGNPQDIHSQPGFAFSRNGPVKRTAVTHILVCRPKRTKPSLSEFLESEDGEPEQQRTYVSGHNRLYFHSDSCMPLRPQEMEVDSEDERDPEWLQEKTTTQIEEFTDVNEGEKEVMKLWNLHVMKNG-FIADNQMSQASMLFVE--ICGPHIIR--RNLCRNFLLHLVNLHDFNLVTIATIDQAMARLKE 643          
BLAST of SZ12-1 vs. Ensembl Zebrafish
Match: suz12b (SUZ12 polycomb repressive complex 2 subunit b [Source:NCBI gene;Acc:561871])

HSP 1 Score: 99.3673 bits (246), Expect = 4.858e-21
Identity = 85/279 (30.47%), Postives = 135/279 (48.39%), Query Frame = 2
Query: 1334 EVNIAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQV-------NPNDF--DFGYVLSENYPVRRMPLTELIYYRYQKSAV----------------KTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLENFVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDE 2092
            ++ I Y+F+ N    Q T+ +  L CPWC LN      LY+    LL HL   HSR +F      N +   K  +I  DV++N+        NP D     G+  S N PV+R  +T ++  R +++                  +T+   HNRLY H+ S M L+  E ++DSE E + +WL ++   ++EEF+D+N  EK+V+++WN    S  +         FV+     II         +++   F+LHLVNL DF +++ A + + M  L E
Sbjct:  385 KLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRK---LYS----LLKHLKLSHSRFIF------NYVPHPKGARI--DVSINECYDGSYVGNPQDIHSQPGFAFSRNGPVKRTAVTHILVCRPKRTKPSLSEFLESEDGEPEQQRTYVSGHNRLYFHSDSCMPLRPQEMEVDSEDERDPEWLQEKTTTQIEEFTDVNEGEKEVMKLWNLHNFSILVITMIQASMLFVEICGPHIIR--------RNLCRNFLLHLVNLHDFNLVTIATIDQAMARLKE 640          
BLAST of SZ12-1 vs. Ensembl Zebrafish
Match: suz12b (SUZ12 polycomb repressive complex 2 subunit b [Source:NCBI gene;Acc:561871])

HSP 1 Score: 98.9821 bits (245), Expect = 6.548e-21
Identity = 89/283 (31.45%), Postives = 140/283 (49.47%), Query Frame = 2
Query: 1334 EVNIAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQV-------NPNDF--DFGYVLSENYPVRRMPLTELIYYRYQKSAV----------------KTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYV----SDSQLENFVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDE 2092
            ++ I Y+F+ N    Q T+ +  L CPWC LN      LY+    LL HL   HSR +F      N +   K  +I  DV++N+        NP D     G+  S N PV+R  +T ++  R +++                  +T+   HNRLY H+ S M L+  E ++DSE E + +WL ++   ++EEF+D+N  EK+V+++WN  L ++ I V      S L  FV+     II         +++   F+LHLVNL DF +++ A + + M  L E
Sbjct:  386 KLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRK---LYS----LLKHLKLSHSRFIF------NYVPHPKGARI--DVSINECYDGSYVGNPQDIHSQPGFAFSRNGPVKRTAVTHILVCRPKRTKPSLSEFLESEDGEPEQQRTYVSGHNRLYFHSDSCMPLRPQEMEVDSEDERDPEWLQEKTTTQIEEFTDVNEGEKEVMKLWN--LHNFSILVITIIQASML--FVEICGPHIIR--------RNLCRNFLLHLVNLHDFNLVTIATIDQAMARLKE 641          
BLAST of SZ12-1 vs. Ensembl Xenopus
Match: suz12 (SUZ12, polycomb repressive complex 2 subunit [Source:NCBI gene;Acc:779745])

HSP 1 Score: 121.324 bits (303), Expect = 7.398e-28
Identity = 104/342 (30.41%), Postives = 174/342 (50.88%), Query Frame = 2
Query: 1178 KPMQTRN-KSLPPIIKISPNKTRDGYSAGGYGENDFTQDLRLSSIR-LKEKEKIEVNIAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQV-------NPNDF--DFGYVLSENYPVRRMPLTELIYYRYQKSAV----------------KTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLEN----FVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDKI 2107
            KP+ TRN +SLP   K S  K     +     +   + DL+    R +  + + ++ I Y+F+ N    Q T+ +  L CPWC LN      LY+    LL HL   HSR +F      N +   K  +I  DV++N+        NP D     G+  S N PV+R P+T ++  R +++                  +T+   HNRLY H+ + + L+  E D+DSE E++ +WL ++   ++EEFSD+N  EK+V++MWN  ++ +G +++D+Q+ +    FV N+  +II+        K++   FMLHLV++ DF ++S   + + +  L E   K+
Sbjct:  329 KPLATRNSESLPQEHKPSSVKPAQTVAV----KESLSSDLQARKERDVSSEPRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRK---LYS----LLKHLKLCHSRFIF------NYVYHPKGARI--DVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMDVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKMWNLHVMKHG-FIADNQMNHGCMLFVDNYGPQIIQ--------KNLCRNFMLHLVSMHDFNLISITTIDKAVSRLREIQQKV 642          
BLAST of SZ12-1 vs. Ensembl Xenopus
Match: suz12 (SUZ12, polycomb repressive complex 2 subunit [Source:NCBI gene;Acc:779745])

HSP 1 Score: 120.939 bits (302), Expect = 7.551e-28
Identity = 104/342 (30.41%), Postives = 174/342 (50.88%), Query Frame = 2
Query: 1178 KPMQTRN-KSLPPIIKISPNKTRDGYSAGGYGENDFTQDLRLSSIR-LKEKEKIEVNIAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQV-------NPNDF--DFGYVLSENYPVRRMPLTELIYYRYQKSAV----------------KTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLEN----FVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDKI 2107
            KP+ TRN +SLP   K S  K     +     +   + DL+    R +  + + ++ I Y+F+ N    Q T+ +  L CPWC LN      LY+    LL HL   HSR +F      N +   K  +I  DV++N+        NP D     G+  S N PV+R P+T ++  R +++                  +T+   HNRLY H+ + + L+  E D+DSE E++ +WL ++   ++EEFSD+N  EK+V++MWN  ++ +G +++D+Q+ +    FV N+  +II+        K++   FMLHLV++ DF ++S   + + +  L E   K+
Sbjct:  290 KPLATRNSESLPQEHKPSSVKPAQTVAV----KESLSSDLQARKERDVSSEPRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRK---LYS----LLKHLKLCHSRFIF------NYVYHPKGARI--DVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMDVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKMWNLHVMKHG-FIADNQMNHGCMLFVDNYGPQIIQ--------KNLCRNFMLHLVSMHDFNLISITTIDKAVSRLREIQQKV 603          
BLAST of SZ12-1 vs. Ensembl Xenopus
Match: suz12 (SUZ12, polycomb repressive complex 2 subunit [Source:NCBI gene;Acc:779745])

HSP 1 Score: 121.324 bits (303), Expect = 8.367e-28
Identity = 104/342 (30.41%), Postives = 174/342 (50.88%), Query Frame = 2
Query: 1178 KPMQTRN-KSLPPIIKISPNKTRDGYSAGGYGENDFTQDLRLSSIR-LKEKEKIEVNIAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQV-------NPNDF--DFGYVLSENYPVRRMPLTELIYYRYQKSAV----------------KTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLEN----FVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDKI 2107
            KP+ TRN +SLP   K S  K     +     +   + DL+    R +  + + ++ I Y+F+ N    Q T+ +  L CPWC LN      LY+    LL HL   HSR +F      N +   K  +I  DV++N+        NP D     G+  S N PV+R P+T ++  R +++                  +T+   HNRLY H+ + + L+  E D+DSE E++ +WL ++   ++EEFSD+N  EK+V++MWN  ++ +G +++D+Q+ +    FV N+  +II+        K++   FMLHLV++ DF ++S   + + +  L E   K+
Sbjct:  373 KPLATRNSESLPQEHKPSSVKPAQTVAV----KESLSSDLQARKERDVSSEPRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRK---LYS----LLKHLKLCHSRFIF------NYVYHPKGARI--DVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMDVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKMWNLHVMKHG-FIADNQMNHGCMLFVDNYGPQIIQ--------KNLCRNFMLHLVSMHDFNLISITTIDKAVSRLREIQQKV 686          
BLAST of SZ12-1 vs. Ensembl Xenopus
Match: suz12 (SUZ12, polycomb repressive complex 2 subunit [Source:NCBI gene;Acc:779745])

HSP 1 Score: 120.553 bits (301), Expect = 1.016e-27
Identity = 104/342 (30.41%), Postives = 174/342 (50.88%), Query Frame = 2
Query: 1178 KPMQTRN-KSLPPIIKISPNKTRDGYSAGGYGENDFTQDLRLSSIR-LKEKEKIEVNIAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQV-------NPNDF--DFGYVLSENYPVRRMPLTELIYYRYQKSAV----------------KTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLEN----FVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDKI 2107
            KP+ TRN +SLP   K S  K     +     +   + DL+    R +  + + ++ I Y+F+ N    Q T+ +  L CPWC LN      LY+    LL HL   HSR +F      N +   K  +I  DV++N+        NP D     G+  S N PV+R P+T ++  R +++                  +T+   HNRLY H+ + + L+  E D+DSE E++ +WL ++   ++EEFSD+N  EK+V++MWN  ++ +G +++D+Q+ +    FV N+  +II+        K++   FMLHLV++ DF ++S   + + +  L E   K+
Sbjct:  295 KPLATRNSESLPQEHKPSSVKPAQTVAV----KESLSSDLQARKERDVSSEPRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRK---LYS----LLKHLKLCHSRFIF------NYVYHPKGARI--DVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMDVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKMWNLHVMKHG-FIADNQMNHGCMLFVDNYGPQIIQ--------KNLCRNFMLHLVSMHDFNLISITTIDKAVSRLREIQQKV 608          
BLAST of SZ12-1 vs. Ensembl Xenopus
Match: suz12 (SUZ12, polycomb repressive complex 2 subunit [Source:NCBI gene;Acc:779745])

HSP 1 Score: 120.553 bits (301), Expect = 1.326e-27
Identity = 104/342 (30.41%), Postives = 174/342 (50.88%), Query Frame = 2
Query: 1178 KPMQTRN-KSLPPIIKISPNKTRDGYSAGGYGENDFTQDLRLSSIR-LKEKEKIEVNIAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQV-------NPNDF--DFGYVLSENYPVRRMPLTELIYYRYQKSAV----------------KTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLEN----FVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDKI 2107
            KP+ TRN +SLP   K S  K     +     +   + DL+    R +  + + ++ I Y+F+ N    Q T+ +  L CPWC LN      LY+    LL HL   HSR +F      N +   K  +I  DV++N+        NP D     G+  S N PV+R P+T ++  R +++                  +T+   HNRLY H+ + + L+  E D+DSE E++ +WL ++   ++EEFSD+N  EK+V++MWN  ++ +G +++D+Q+ +    FV N+  +II+        K++   FMLHLV++ DF ++S   + + +  L E   K+
Sbjct:  300 KPLATRNSESLPQEHKPSSVKPAQTVAV----KESLSSDLQARKERDVSSEPRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRK---LYS----LLKHLKLCHSRFIF------NYVYHPKGARI--DVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMDVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKMWNLHVMKHG-FIADNQMNHGCMLFVDNYGPQIIQ--------KNLCRNFMLHLVSMHDFNLISITTIDKAVSRLREIQQKV 613          
BLAST of SZ12-1 vs. Ensembl Mouse
Match: Suz12 (SUZ12 polycomb repressive complex 2 subunit [Source:MGI Symbol;Acc:MGI:1261758])

HSP 1 Score: 117.472 bits (293), Expect = 1.018e-26
Identity = 107/353 (30.31%), Postives = 177/353 (50.14%), Query Frame = 2
Query: 1187 QTRNKSLPPIIKISPNKTRDGYSAGGYGENDFTQDLRLSSIRLKE---------KEKIEVN-------IAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQV-------NPNDF--DFGYVLSENYPVRRMPLTELIYYRYQKSAV----------------KTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLEN----FVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDKI 2107
            +T +KS  P+ K  P  TR+  S   + EN         +I +KE         KEK   N       I Y+F+ N    Q T+ +  L CPWC LN      LY+    LL HL   HSR +F      N +   K  +I  DV++N+        NP D     G+  S N PV+R P+T ++  R +++                  +T+   HNRLY H+ + + L+  E ++DSE E++ +WL ++   ++EEFSD+N  EK+V+++WN  ++ +G +++D+Q+ +    FV+N+ Q+II+        K++   FMLHLV++ DF ++S  ++ + +  L E   K+
Sbjct:  343 ETNDKSTAPVAK--PLATRNSESL--HQENKPGSVKPAQTIAVKETLTTELQTRKEKDNSNESRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRK---LYS----LLKHLKLCHSRFIF------NYVYHPKGARI--DVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHG-FIADNQMNHACMLFVENYGQKIIK--------KNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKL 667          
BLAST of SZ12-1 vs. Ensembl Mouse
Match: Suz12 (SUZ12 polycomb repressive complex 2 subunit [Source:MGI Symbol;Acc:MGI:1261758])

HSP 1 Score: 117.472 bits (293), Expect = 1.109e-26
Identity = 107/353 (30.31%), Postives = 177/353 (50.14%), Query Frame = 2
Query: 1187 QTRNKSLPPIIKISPNKTRDGYSAGGYGENDFTQDLRLSSIRLKE---------KEKIEVN-------IAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQV-------NPNDF--DFGYVLSENYPVRRMPLTELIYYRYQKSAV----------------KTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLEN----FVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDKI 2107
            +T +KS  P+ K  P  TR+  S   + EN         +I +KE         KEK   N       I Y+F+ N    Q T+ +  L CPWC LN      LY+    LL HL   HSR +F      N +   K  +I  DV++N+        NP D     G+  S N PV+R P+T ++  R +++                  +T+   HNRLY H+ + + L+  E ++DSE E++ +WL ++   ++EEFSD+N  EK+V+++WN  ++ +G +++D+Q+ +    FV+N+ Q+II+        K++   FMLHLV++ DF ++S  ++ + +  L E   K+
Sbjct:  366 ETNDKSTAPVAK--PLATRNSESL--HQENKPGSVKPAQTIAVKETLTTELQTRKEKDNSNESRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRK---LYS----LLKHLKLCHSRFIF------NYVYHPKGARI--DVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHG-FIADNQMNHACMLFVENYGQKIIK--------KNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKL 690          
BLAST of SZ12-1 vs. UniProt/SwissProt
Match: sp|Q0VA03|SUZ12_XENTR (Polycomb protein suz12 OS=Xenopus tropicalis OX=8364 GN=suz12 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 5.158e-27
Identity = 104/342 (30.41%), Postives = 174/342 (50.88%), Query Frame = 2
Query: 1178 KPMQTRN-KSLPPIIKISPNKTRDGYSAGGYGENDFTQDLRLSSIR-LKEKEKIEVNIAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQV-------NPNDF--DFGYVLSENYPVRRMPLTELIYYRYQKSAV----------------KTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLEN----FVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDKI 2107
            KP+ TRN +SLP   K S  K     +     +   + DL+    R +  + + ++ I Y+F+ N    Q T+ +  L CPWC LN      LY+    LL HL   HSR +F      N +   K  +I  DV++N+        NP D     G+  S N PV+R P+T ++  R +++                  +T+   HNRLY H+ + + L+  E D+DSE E++ +WL ++   ++EEFSD+N  EK+V++MWN  ++ +G +++D+Q+ +    FV N+  +II+        K++   FMLHLV++ DF ++S   + + +  L E   K+
Sbjct:  332 KPLATRNSESLPQEHKPSSVKPAQTVAV----KESLSSDLQARKERDVSSEPRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRK---LYS----LLKHLKLCHSRFIF------NYVYHPKGARI--DVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMDVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKMWNLHVMKHG-FIADNQMNHGCMLFVDNYGPQIIQ--------KNLCRNFMLHLVSMHDFNLISITTIDKAVSRLREIQQKV 645          
BLAST of SZ12-1 vs. UniProt/SwissProt
Match: sp|Q15022|SUZ12_HUMAN (Polycomb protein SUZ12 OS=Homo sapiens OX=9606 GN=SUZ12 PE=1 SV=3)

HSP 1 Score: 118.242 bits (295), Expect = 4.683e-26
Identity = 108/353 (30.59%), Postives = 177/353 (50.14%), Query Frame = 2
Query: 1187 QTRNKSLPPIIKISPNKTRDGYSAGGYGENDFTQDLRLSSIRLKE---------KEKIEVN-------IAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQV-------NPNDF--DFGYVLSENYPVRRMPLTELIYYRYQKSAV----------------KTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLEN----FVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDKI 2107
            +T +KS  PI K  P  TR+  S   + EN         +I +KE         KEK   N       I Y+F+ N    Q T+ +  L CPWC LN      LY+    LL HL   HSR +F      N +   K  +I  DV++N+        NP D     G+  S N PV+R P+T ++  R +++                  +T+   HNRLY H+ + + L+  E ++DSE E++ +WL ++   ++EEFSD+N  EK+V+++WN  ++ +G +++D+Q+ +    FV+N+ Q+II+        K++   FMLHLV++ DF ++S  ++ + +  L E   K+
Sbjct:  364 ETNDKSTAPIAK--PLATRNSESL--HQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRK---LYS----LLKHLKLCHSRFIF------NYVYHPKGARI--DVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHG-FIADNQMNHACMLFVENYGQKIIK--------KNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKL 688          
BLAST of SZ12-1 vs. UniProt/SwissProt
Match: sp|Q80U70|SUZ12_MOUSE (Polycomb protein Suz12 OS=Mus musculus OX=10090 GN=Suz12 PE=1 SV=2)

HSP 1 Score: 117.472 bits (293), Expect = 7.759e-26
Identity = 107/353 (30.31%), Postives = 177/353 (50.14%), Query Frame = 2
Query: 1187 QTRNKSLPPIIKISPNKTRDGYSAGGYGENDFTQDLRLSSIRLKE---------KEKIEVN-------IAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQV-------NPNDF--DFGYVLSENYPVRRMPLTELIYYRYQKSAV----------------KTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLEN----FVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDKI 2107
            +T +KS  P+ K  P  TR+  S   + EN         +I +KE         KEK   N       I Y+F+ N    Q T+ +  L CPWC LN      LY+    LL HL   HSR +F      N +   K  +I  DV++N+        NP D     G+  S N PV+R P+T ++  R +++                  +T+   HNRLY H+ + + L+  E ++DSE E++ +WL ++   ++EEFSD+N  EK+V+++WN  ++ +G +++D+Q+ +    FV+N+ Q+II+        K++   FMLHLV++ DF ++S  ++ + +  L E   K+
Sbjct:  366 ETNDKSTAPVAK--PLATRNSESL--HQENKPGSVKPAQTIAVKETLTTELQTRKEKDNSNESRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRK---LYS----LLKHLKLCHSRFIF------NYVYHPKGARI--DVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHG-FIADNQMNHACMLFVENYGQKIIK--------KNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKL 690          
BLAST of SZ12-1 vs. UniProt/SwissProt
Match: sp|Q6DC03|SZ12A_DANRE (Polycomb protein suz12-A OS=Danio rerio OX=7955 GN=suz12a PE=2 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 8.961e-24
Identity = 96/334 (28.74%), Postives = 164/334 (49.10%), Query Frame = 2
Query: 1178 KPMQTRNKSLPPIIKISPNKTRDGYSAGGYGEND-FTQDLRLSSIRLKEKEKIE----VNIAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQV-------NPNDF--DFGYVLSENYPVRRMPLTELIYYRYQKSAV----------------KTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLENFVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWL 2086
            KP+ TRN        +  +KT +         ND    DL +     +E+  IE    +++ Y+F+ N    Q T+ +  L CPWC LN      LY+    LL HL   HSR +F      N +   K  +I  DV++N+        NP D     G+  S N PV+R P+T+++  R ++S                  +T+   HNRLY H+ S   L+  E ++DSE E +  WL ++   ++EEF+D+N  EK+++++WN  ++ +G +++D+Q+     +F    +E    +   K++    +LHL+N+ DFG+++ A + + M  L
Sbjct:  340 KPLATRNSE---SSTVDSSKTSNIKPPQAVAVNDSLGTDLPVR----REQTHIEPCQKLHVYYQFLYNNNTRQQTEARDDLHCPWCTLNCRK---LYS----LLKHLKLSHSRFIF------NYVPHPKGARI--DVSINECYDGSYVGNPQDILCQPGFAFSRNGPVKRTPVTQILVCRPKRSKPSLSEFLEPEDGEQEQQRTYISGHNRLYFHSDSCTPLRPQEMEVDSEDERDPDWLREKTAMQIEEFTDVNEGEKEIMKLWNLLVMKHG-FIADNQMNQACMSF----VEQHGTIMVEKNLCRNALLHLINMHDFGLITTATIDKAMTHL 646          
BLAST of SZ12-1 vs. UniProt/SwissProt
Match: sp|B0R1D5|SZ12B_DANRE (Polycomb protein suz12-B OS=Danio rerio OX=7955 GN=suz12b PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.153e-22
Identity = 85/279 (30.47%), Postives = 145/279 (51.97%), Query Frame = 2
Query: 1334 EVNIAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQV-------NPNDF--DFGYVLSENYPVRRMPLTELIYYRYQKSAV----------------KTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLENFVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDE 2092
            ++ I Y+F+ N    Q T+ +  L CPWC LN      LY+    LL HL   HSR +F      N +   K  +I  DV++N+        NP D     G+  S N PV+R  +T ++  R +++                  +T+   HNRLY H+ S M L+  E ++DSE E + +WL ++   ++EEF+D+N  EK+V+++WN  ++  G +++D+Q+      F++  I   + ++  +++   F+LHLVNL DF +++ A + + M  L E
Sbjct:  385 KLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRK---LYS----LLKHLKLSHSRFIF------NYVPHPKGARI--DVSINECYDGSYVGNPQDIHSQPGFAFSRNGPVKRTAVTHILVCRPKRTKPSLSEFLESEDGEPEQQRTYVSGHNRLYFHSDSCMPLRPQEMEVDSEDERDPEWLQEKTTTQIEEFTDVNEGEKEVMKLWNLHVMKNG-FIADNQMSQASMLFVE--ICGPHIIR--RNLCRNFLLHLVNLHDFNLVTIATIDQAMARLKE 643          
BLAST of SZ12-1 vs. TrEMBL
Match: H9CXT5 (SZ12-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1285.01 bits (3324), Expect = 0.000e+0
Identity = 672/673 (99.85%), Postives = 672/673 (99.85%), Query Frame = 2
Query:   89 MLTKNSLCFHKTEKYVKRRYSQALEIDNVNEPXXXXXXXXXXXADNDSETQSLSEDVLKSHSVEFQDFLKHFMIPSNIYKNLALRHKTNPIILKRNLSYLNHSKTDIQKSNLRTIADHLSTVRFHDENLALMKGKLPIXXXXXXXXXXVIFKFDQFVDSKTEKDWKTIEGIVYMDIVHFYRDNRKNKESFTVKRVISGQKIKCNEDMKSEQKSHSINIADIMKSANFYRVYKSVFHFKVLAKEKKLNGKEDKTGDIYPVTYEAMMPLFSNTCSRNLRSSNYFVQSGKYQIYMDVTDMEKCDNSVYNGTTRIVYNNNQDLESESSNKADCQWCRIDDPQHXXXXXXXXXXXFEICNHEVEKVKNKPMQTRNKSLPPIIKISPNKTRDGYSAGGYGENDFTQDLRLSSIRLKEKEKIEVNIAYKFVVNEKIVQWTQTKHLICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQVNPNDFDFGYVLSENYPVRRMPLTELIYYRYQKSAVKTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLENFVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDKI 2107
            MLTKNSLCFHKTEKYVKRRYSQALEIDNVNEPIKKIRKIKKNKADNDSETQSLSEDVLKSHSVEFQDFLKHFMIPSNIYKNLALRHKTNPIILKRNLSYLNHSKTDIQKSNLRTIADHLSTVRFHDENLALMKGKLPIKPNYPNYPNKVIFKFDQFVDSKTEKDWKTIEGIVYMDIVHFYRDNRKNKESFTVKRVISGQKIKCNEDMKSEQKSHSINIADIMKSANFYRVYKSVFHFKVLAKEKKLNGKEDKTGDIYPVTYEAMMPLFSNTCSRNLRSSNYFVQSGKYQIYMDVTDMEKCDNSVYNGTTRIVYNNNQDLESESSNK DCQWCRIDDPQHKIINKNKAKIIFEICNHEVEKVKNKPMQTRNKSLPPIIKISPNKTRDGYSAGGYGENDFTQDLRLSSIRLKEKEKIEVNIAYKFVVNEKIVQWTQTKHLICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQVNPNDFDFGYVLSENYPVRRMPLTELIYYRYQKSAVKTFRKYHNRLYSHTWSAMSLKDDEFDIDSESEENKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLENFVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDKI
Sbjct:    1 MLTKNSLCFHKTEKYVKRRYSQALEIDNVNEPIKKIRKIKKNKADNDSETQSLSEDVLKSHSVEFQDFLKHFMIPSNIYKNLALRHKTNPIILKRNLSYLNHSKTDIQKSNLRTIADHLSTVRFHDENLALMKGKLPIKPNYPNYPNKVIFKFDQFVDSKTEKDWKTIEGIVYMDIVHFYRDNRKNKESFTVKRVISGQKIKCNEDMKSEQKSHSINIADIMKSANFYRVYKSVFHFKVLAKEKKLNGKEDKTGDIYPVTYEAMMPLFSNTCSRNLRSSNYFVQSGKYQIYMDVTDMEKCDNSVYNGTTRIVYNNNQDLESESSNKXDCQWCRIDDPQHKIINKNKAKIIFEICNHEVEKVKNKPMQTRNKSLPPIIKISPNKTRDGYSAGGYGENDFTQDLRLSSIRLKEKEKIEVNIAYKFVVNEKIVQWTQTKHLICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQVNPNDFDFGYVLSENYPVRRMPLTELIYYRYQKSAVKTFRKYHNRLYSHTWSAMSLKDDEFDIDSESEENKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLENFVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDKI 673          
BLAST of SZ12-1 vs. TrEMBL
Match: A0A481NVF5 (Polycomb protein SUZ12-1 OS=Dugesia japonica OX=6161 GN=suz12-1 PE=2 SV=1)

HSP 1 Score: 936.021 bits (2418), Expect = 0.000e+0
Identity = 510/686 (74.34%), Postives = 589/686 (85.86%), Query Frame = 2
Query:   89 MLTKNSLCFHKTEKYVKRRYSQALEIDNVNEPXXXXXXXXXXXADNDSETQSLSEDVLKSHSVEFQDFLKHFMIPSNIYKNLALRHKTNPIILKRNLSYLNHSKTDIQKSNLRTIADHLSTVRFHDENLALMKGKLPIXXXXXXXXXXVIFKFDQFVDSKTEKDWKTIEGIVYMDIVHFYRDNRKNKESFTVKRVISGQKIKCNEDMKSEQKSHSINIADIMKSANFYRVYKSVFHFKVLAKEKKLNGKE--DKTGDIYPVTYEAMMPLFSNTCSRNLRSSNYFVQSGKYQIYMDVTDMEKCDNSVYNGTTRIVYNNNQDLES-----ESSNKADCQWCRIDDPQHXXXXXXXXXXXFEICNHEVEKVKNKPMQTRNKSLPPIIKISPNKTRDGY--SAGGYGENDFTQDLRLSSIRLKEKEKIEVNIAYKFVVNEKIVQWTQTKHLICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKT---NKITVDVNLNQVNPNDFDFGYVLSENYPVRRMPLTELIYYRYQKSAVKTFR-KYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLENFVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDKI 2107
            ML KNS   +KT+KYVKRRYSQALE DN+NEP +KIR+IKKNK DND ET S +E+V  SHS EFQDFLK+FMIPSN+YK LALRHKTNPIILKRNL+YL  +K+D QKSNLRTIADHLSTVRFHDENLALMKGKLP KP +PNYPNKV+FKFDQFVDSK+EKDWKTIE I+Y+DI+HFYRDNRKNK+SF V RVIS QKIKC+ED K++ K H I+IA +M+SA+ YRVYKSVFHFK+LAKEKKL+ KE  DK  DIYPVTYEAMMPLF+NTC+RNLRS N+FVQSGKYQIYMDVT+MEKCD+S +NGTT+IVYNNN +  S     +S+N+ DCQW RIDDPQHKI+NKNK KI+FEI N E  K KNKPMQTRNKSLPPIIK+SP K   G+  S+    +ND  +DLRLSSI+LKEKEKI+VNIAYKFVV EKIVQWTQTKHL CPWC LNF+   DL++TFQ+LLSHLNNWHS+L+FTCKKLK+R + N+    N IT+DV LN+V+PND DFG++LS ++P+RRMPLTELI+ +YQK  VK  + K HNR YSHTWSA++LK  EFDIDSESEENKQWLFDQYYRKVEEFSDLNHIEKKVIQMWN ELLSYG+YVSD Q+E+ VKNFI+RIIE +NQLKEVKSMRNTFMLHL+NL+DFGVLS+A ML+CMK LDEA DKI
Sbjct:    1 MLNKNSNYNNKTDKYVKRRYSQALENDNLNEPTRKIRRIKKNKLDNDLETLSFTEEV-NSHSAEFQDFLKYFMIPSNMYKTLALRHKTNPIILKRNLTYLAKNKSDNQKSNLRTIADHLSTVRFHDENLALMKGKLPFKPTFPNYPNKVVFKFDQFVDSKSEKDWKTIEAIIYLDIIHFYRDNRKNKDSFIVNRVISNQKIKCSEDNKADHKFHIIDIASVMQSASCYRVYKSVFHFKILAKEKKLSCKEKDDKRSDIYPVTYEAMMPLFNNTCNRNLRSLNFFVQSGKYQIYMDVTNMEKCDDSFFNGTTKIVYNNNNNNNSNENGLDSNNQLDCQWYRIDDPQHKIVNKNKVKILFEIDNEETLKAKNKPMQTRNKSLPPIIKMSPYKIGGGWNMSSSDVVDNDCVKDLRLSSIKLKEKEKIDVNIAYKFVVKEKIVQWTQTKHLTCPWCQLNFHLFTDLFDTFQKLLSHLNNWHSKLIFTCKKLKSRASFNQALEGNFITIDVKLNEVSPNDLDFGHMLSNDFPIRRMPLTELIFSKYQKPVVKKIQHKNHNRKYSHTWSAINLKPVEFDIDSESEENKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNKELLSYGVYVSDIQIEHLVKNFIERIIEKENQLKEVKSMRNTFMLHLMNLIDFGVLSSATMLQCMKRLDEAFDKI 685          
BLAST of SZ12-1 vs. TrEMBL
Match: A0A4V3SF31 (VEFS-Box domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005151 PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 7.957e-27
Identity = 114/394 (28.93%), Postives = 171/394 (43.40%), Query Frame = 2
Query: 1157 EVEKVKNK-------PMQTRNKS---LPPIIKISPNKTRDGYSAGGYGENDFTQDLRLSSIRLKEKEKIEVNIAYKFVVNEKIVQWTQTKHLICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNR------MTLNKTNKITVDVNLNQ--------------VNPNDFDFG------------------------YVLSENYPVRRMPLTELIYYRYQKS----------AVKTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYG---IYVSDSQLENFVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDKI*CCCSNFDIQ 2137
            +V K  NK       P++ R++S   LPP +  SP +TR   S   +     T  LR               + Y+F+   ++ QW++ K L+CPWC L+     +     + LL HL   H R  F      +R      ++LN+    + D  L +              V P     G                        Y    + PVRR+  T LI++R  +           +V+     HNR+Y HT S   L+  EFD DSE+E+  +WL   Y RKVEEF+D+N  EK+++Q+WN  LLS G   + V DSQL N    F+QR     ++    + +RN  +LH  NLVD+G+LS       ++ L    DK+ C  +   +Q
Sbjct:  711 QVPKFSNKTPVTQEAPVEQRSQSRLLLPPPLSQSPARTRRLASTRPHLPTPATLPLR--------------PVTYRFLYMNRLQQWSEAKDLVCPWCRLDCWRARE--RGPEALLVHLRTCHPRFRFKASWSPSRAHLSLEVSLNEAYDGSNDCGLRRWGFPSSDGAASRRLVAPGQLIGGWTGLGSLPAQLEQQQPTASLSLSTYASRVSRPVRRLSYTHLIFWRGAERVTDQPLDPTLSVRPVALGHNRVYYHTRSVQPLRACEFDHDSEAEDAPEWLRQHYQRKVEEFTDVNQGEKQLMQLWNALLLSIGPSELVVCDSQLANLAACFVQRYASAIHR----RHLRNNLILHFANLVDYGLLSPGQ----LRQLVTMYDKLVCSSTPGRVQ 1080          
BLAST of SZ12-1 vs. TrEMBL
Match: A0A481NWA7 (Polycomb protein SUZ12-2 OS=Dugesia japonica OX=6161 GN=suz12-2 PE=2 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 5.561e-26
Identity = 155/643 (24.11%), Postives = 282/643 (43.86%), Query Frame = 2
Query:  278 EFQDFLKHFMIPSNIYKNLALRHKTNPIILKRNLSYLNHSKTDIQKS--NLRTIADHLSTVRFHDENLALMKGKLPIXXXXXXXXXXVIFK-------FDQFVDSKTEKDWKTIEGIVYMDIVHFYRDNRKNKESFTVKRVISGQKIKCN----EDMKSEQKSHSINIADIMKSANFYRVYKSVFHFKVLAKEKKL--------NGKEDKTGDIYPVTYEAMMPLFSNTCSRNLRSSNYFVQSGKYQIYMDVTDMEKCDNSVYNGTTRIVYNNNQDLESESSNKADCQWCRIDDPQHXXXXXXXXXXXFEICNHEVEKVKNKPMQTRNKSLPPIIKISPNKTRDGYSAGGYGENDFTQDLRLSSIRLKEKEKIEVNIAYKFVVNEKIVQWTQTKHLICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTN--KITVDVNLNQVNPNDFDFGY-----VLSENYPVRRMPLTELIYYRYQKSA----------VKTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLENFVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDE 2092
            E+++ +K     +++Y  L +  K +  +L RNLSY+   +  +++   NL  I + L  VR            +P   +  +     + K       F  F DS  E  W+TI     + ++H ++++RK +      + +S   I CN    ED K  QK H  + + +    +  R+  S   FK+   E++         N + ++   +Y V YE   P +    + N     +++  G+Y++ ++V+ +++   S+ +      + NN+ +    S+  +  W R   P   +                 E  K   +  R +S   + K+  N          Y  N     +     +   K K+EVNI YKF  N  ++QW++++ + CPWC       N    +F  L+ HL  +H+R  F          +++TN   + ++V LN+      + G        S   P R++P T ++Y                 ++     HNR Y ++ + +     + D+DSE+E+N  WL   Y++++EEF+D+N  EK+++Q+WN  LL +  Y  D  +    K+F   II+   ++KE     N  +LHLVNLV+FGVLS   ++E +  LD+
Sbjct:   20 EYEEIIKRLGYITSLYGYLKINFKRSHFLLFRNLSYIQGDRNSVKRKFKNLDKICERLIKVR------------IPRVRSLCDSSQFSVLKEVNWNLIFVGFFDSSHESQWETIHAYADIYVIHHWKNSRKFQSGKKTTKFLSNLLINCNGRPLEDGKF-QKIHEFSQSQLFHDTSHLRIVYSYLLFKLRVLERRTVDYSKIESNLQINQNNGLYAVHYELKFPFYKFRSNDN--DLKFYLLPGEYEMRLEVS-LDQPTESLAD------FTNNEMVIENFSDSPERIWVREVSPSSSVAK---------------EYDKWPRILFRLESSNSLTKLDTNSV----DIKPYISNGVIDKVS----KKARKAKLEVNIVYKFYHNNHMLQWSRSQSVKCPWCNFICEKSNAKL-SFSCLVKHLQTFHARFTF------KHWVISETNISSMIIEVRLNECYDGSIEIGLRSSMESRSLEKPERKLPFTHIVYCSQMCKINPMVNNPSIDLRPLVWGHNRKYFYSTTGIVKCIGDLDVDSEAEDNLDWLQQMYFKRIEEFTDVNPGEKRIMQLWNSHLLDHK-YNGDFMVPILTKSF---IIQKGAEIKEHNLRNNL-LLHLVNLVEFGVLSQKQLIEVIGILDQ 605          
BLAST of SZ12-1 vs. TrEMBL
Match: C6GGW6 (Suppressor of zeste 12 OS=Xenopus laevis OX=8355 GN=suz12 PE=2 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 2.258e-25
Identity = 103/342 (30.12%), Postives = 177/342 (51.75%), Query Frame = 2
Query: 1178 KPMQTRN-KSLPPIIKISPNKTRDGYSAGGYGENDFTQDLRLSSIR-LKEKEKIEVNIAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQV-------NPNDF--DFGYVLSENYPVRRMPLTELIYYRYQKSAV----------------KTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLEN----FVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDKI 2107
            KP+ TRN +SLP   K S  K     +     +  F+ DL+    R +  +++ ++ I Y+F+ N    Q T+ +  L CPWC LN      LY+    L+ HL   HSR +F      N +   K  +I  DV++N+        NP D     G+  S N PV+R P+T ++  R +++                  +T+   HNRLY H+ + + L+  E ++DSE E++ +WL ++   ++EEFSD+N  EK+V++MWN  ++ +G +++D+Q+ +    FV+N+   I++        K++   FMLHLV++ DF ++S A + + +  L E   K+
Sbjct:  332 KPLATRNSESLPQEHKPSSVKPAQTIAV----KESFSSDLQARKERDVSTEQRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRK---LYS----LIKHLKLCHSRFIF------NYVYHPKGARI--DVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKMWNLHVMKHG-FIADNQMNHGCMQFVENYGPEIVQ--------KNLCRNFMLHLVSMHDFNLISIATIDKAVTRLREIQQKL 645          
BLAST of SZ12-1 vs. Ensembl Cavefish
Match: suz12a (polycomb protein suz12-A-like [Source:NCBI gene;Acc:103046942])

HSP 1 Score: 110.538 bits (275), Expect = 1.176e-24
Identity = 96/334 (28.74%), Postives = 160/334 (47.90%), Query Frame = 2
Query: 1178 KPMQTRNKSLPPIIKISPNKTRDGYSAGGYGENDFTQDLRLSSIRLKEKEKIEVNIAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVN-----LNQVNPNDF--DFGYVLSENYPVRRMPLTELIYYR--YQKSAVKTF-----------RKY---HNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLENFVKNFIQR----IIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEA 2095
            +P+ TRN          P+  +   +            +R   + ++ ++K+ V   Y+F+ N    Q T+ +  L CPWC LN      LY+    LL HL   HSR +F      N +   K  +I V VN         NP D     G+  S N PV+R  ++ ++  R  + K ++  F           R Y   HNRLY H+ S M L+  E ++DSE E +  WL ++   ++EEF+D+N  EK+V++MWN  ++ +G +++D+Q+      F+++    IIE        K++   F+LHLV++ DFG++S   + + M  L + 
Sbjct:  336 RPLATRNSDTSGGDSHRPSAPKPPQAVAVKDPVSADMPVRREQVHIEPRQKLRV--YYQFLYNNNTRQQTEARDDLHCPWCTLNCRR---LYS----LLKHLKLSHSRFIF------NYVPHPKGARIDVSVNDCYDGSYVGNPQDIHCQPGFAFSRNGPVKRTSVSHVLVCRPKHPKPSLSEFLESEEGQLEQQRTYVSGHNRLYFHSDSCMPLRPQEMEVDSEDERDPDWLREKTTMQIEEFTDVNEGEKEVMKMWNLHVMKHG-FIADNQMNQACMLFVEKCGSTIIE--------KNLCRNFLLHLVSMHDFGLVSTMTIDKAMALLRQG 645          
BLAST of SZ12-1 vs. Ensembl Cavefish
Match: suz12a (polycomb protein suz12-A-like [Source:NCBI gene;Acc:103046942])

HSP 1 Score: 110.153 bits (274), Expect = 1.403e-24
Identity = 96/323 (29.72%), Postives = 156/323 (48.30%), Query Frame = 2
Query: 1178 KPMQTRNKSLPPIIKISPNKTRDGYSAGGYGENDFTQDLRLSSIRLKEKEKIEVNIAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVN-----LNQVNPNDF--DFGYVLSENYPVRRMPLTELIYYR--YQKSAVKTF-----------RKY---HNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLENFVKNFIQR----IIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAA 2062
            +P+ TRN          P+  +   +            +R   + ++ ++K+ V   Y+F+ N    Q T+ +  L CPWC LN      LY+    LL HL   HSR +F      N +   K  +I V VN         NP D     G+  S N PV+R  ++ ++  R  + K ++  F           R Y   HNRLY H+ S M L+  E ++DSE E +  WL ++   ++EEF+D+N  EK+V++MWN  ++ +G +++D+Q+      F+++    IIE        K++   F+LHLV++ DFG+ S AA
Sbjct:  336 RPLATRNSDTSGGDSHRPSAPKPPQAVAVKDPVSADMPVRREQVHIEPRQKLRV--YYQFLYNNNTRQQTEARDDLHCPWCTLNCRR---LYS----LLKHLKLSHSRFIF------NYVPHPKGARIDVSVNDCYDGSYVGNPQDIHCQPGFAFSRNGPVKRTSVSHVLVCRPKHPKPSLSEFLESEEGQLEQQRTYVSGHNRLYFHSDSCMPLRPQEMEVDSEDERDPDWLREKTTMQIEEFTDVNEGEKEVMKMWNLHVMKHG-FIADNQMNQACMLFVEKCGSTIIE--------KNLCRNFLLHLVSMHDFGLASRAA 634          
BLAST of SZ12-1 vs. Ensembl Cavefish
Match: suz12b (SUZ12 polycomb repressive complex 2 subunit [Source:NCBI gene;Acc:103037652])

HSP 1 Score: 105.531 bits (262), Expect = 4.578e-23
Identity = 84/279 (30.11%), Postives = 141/279 (50.54%), Query Frame = 2
Query: 1334 EVNIAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQV-------NPNDF--DFGYVLSENYPVRRMPLTELIYYRYQKSAV----------------KTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLENFVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDE 2092
            ++ I Y+F+ N    Q T+ +  L CPWC LN      LY+    LL HL   HSR +F      N +   K  +I  DV++N+        NP D     G+  S N PV+R  +T ++  R +++                  +T+   HNRLY H+ S M L+  E ++DSE E + +WL ++   ++EEF+D+N  EK+V+++WN  ++  G +++D+Q+   +  F++        +      RN F+LHLV++ DF +++ A +   M  L E
Sbjct:  405 KLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRK---LYS----LLKHLKLSHSRFIF------NYVPHPKGARI--DVSINECYDGSYVGNPQDIHSQPGFAFSRNGPVKRTAVTHILVCRPKRTKPSLSEFLESEDGEPEQQRTYVSGHNRLYFHSDSCMPLRPQEMEMDSEDERDPEWLREKTTTQIEEFTDVNEGEKEVMKLWNLHVMKNG-FIADNQMNQAIMLFVENC---GPHIARRNLCRN-FLLHLVSMHDFNLVTTATIDRAMTRLRE 663          
BLAST of SZ12-1 vs. Ensembl Cavefish
Match: suz12b (SUZ12 polycomb repressive complex 2 subunit [Source:NCBI gene;Acc:103037652])

HSP 1 Score: 104.76 bits (260), Expect = 7.311e-23
Identity = 83/279 (29.75%), Postives = 142/279 (50.90%), Query Frame = 2
Query: 1334 EVNIAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQV-------NPNDF--DFGYVLSENYPVRRMPLTELIYYRYQKSAV----------------KTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLENFVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDE 2092
            ++ I Y+F+ N    Q T+ +  L CPWC LN      LY+    LL HL   HSR +F      N +   K  +I  DV++N+        NP D     G+  S N PV+R  +T ++  R +++                  +T+   HNRLY H+ S M L+  E ++DSE E + +WL ++   ++EEF+D+N  EK+V+++WN  ++  G +++D+Q+   +  F    +E+       +++   F+LHLV++ DF +++ A +   M  L E
Sbjct:  378 KLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRK---LYS----LLKHLKLSHSRFIF------NYVPHPKGARI--DVSINECYDGSYVGNPQDIHSQPGFAFSRNGPVKRTAVTHILVCRPKRTKPSLSEFLESEDGEPEQQRTYVSGHNRLYFHSDSCMPLRPQEMEMDSEDERDPEWLREKTTTQIEEFTDVNEGEKEVMKLWNLHVMKNG-FIADNQMNQAIMLF----VENCGPHIARRNLCRNFLLHLVSMHDFNLVTTATIDRAMTRLRE 636          
BLAST of SZ12-1 vs. Ensembl Sea Lamprey
Match: suz12a (SUZ12 polycomb repressive complex 2 subunit a [Source:NCBI gene;Acc:794171])

HSP 1 Score: 98.5969 bits (244), Expect = 1.157e-21
Identity = 94/340 (27.65%), Postives = 158/340 (46.47%), Query Frame = 2
Query: 1175 NKPMQTRNKSLPPIIKISPNKTRDGYSAGGYGENDFT-----QDLRLSSIRLK-EKEKIE----VNIAYKFVVNEKIVQWTQTKHLI-CPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLN-----QVNPNDF--DFGYVLSENYPVRRMPLTELIYYRYQKS-------------AVKTFRKY---HNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLENF-----VKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECM 2077
            +K      K L P   + P+ + DG +A        T     +D   SS+++K E  ++E    + I Y+F+ N  + Q T+ +  + CPWC LN      LY+    LL HL   H R +F      N + L K  +I V VN         NP D     G+  S N PV+R P+T ++  R ++               V+  R Y   H+RLY H  + + L+  E D DSE E + +WL ++   +++EF D+N  EK++++MWN  ++ +G+ +      +F     V+ +  R++E          +    +LHL++L DF ++  A++   M
Sbjct:  293 DKAFTPSAKPLTPRNIVDPSASADGRNAATQKPAAPTGTSGVKDQLSSSVQVKKEPGQMEPQKKLRIYYQFLYNNNLRQQTEARDDVHCPWCTLNCGK---LYS----LLKHLKLCHGRFIF------NYVPLTKGARIDVSVNECYDGSYAGNPQDIHSQPGFAFSRNGPVKRTPVTYILVCRPKRPKPSLSEFLESDELEVEQQRPYVSGHDRLYFHKDTCLPLRPQEMDEDSEDENDPEWLREKTVLQIDEFMDVNEGEKELMKMWNLHVMKHGVTMLAKGEGHFCYFINVEQWGPRLLE--------MGLFQNLLLHLISLHDFNLIGQASVQAAM 611          
BLAST of SZ12-1 vs. Ensembl Nematostella
Match: EDO42650 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0W2])

HSP 1 Score: 94.3597 bits (233), Expect = 4.482e-20
Identity = 83/282 (29.43%), Postives = 135/282 (47.87%), Query Frame = 2
Query: 1316 KEKEKIEVNIAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQVNPNDFDFGYVLSENYPVRRMPLTELIYYRYQ--KSAVKTF---------RKYHN---RLYSH--TWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLENFVKNFIQRIIEDDNQLKEVKS--MRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDK 2104
            KEK      + Y+F+ N    Q T+ +H   CPWC +N +    LYN    LL HL   HSR  FT         ++       D  +  VN      GY  S   P RR+P   ++ +R Q  K ++  F         R YH+   R Y H  T   +S  +     DSE EEN  W+  +  + +++F+D+N  EK+++++WN  L+  G YV+D+Q+ +    FI      D   K++ S  ++  F++HLV+L DF +L+   + + M+ L +  ++
Sbjct:  347 KEKTNKAQILYYQFIYNSHTRQQTEARHDFCCPWCHVNCSK---LYN----LLKHLKLCHSRFTFTYAPHSKGARIDVCVNEHYDGKMEGVNDA---LGYAFSREGPCRRVPFNHVLAWRPQRRKESLSEFLEPDDADENRPYHSGYTRTYFHSSTCVPISQSELGSLSDSEGEENPLWMRMRTIQMIDDFTDVNDGEKELMKLWNLHLMEKG-YVADAQVYSACLTFI------DVNAKKIMSQNLKRNFLIHLVSLHDFNLLNGGQIFQLMQKLKDVANE 611          
BLAST of SZ12-1 vs. Ensembl Medaka
Match: suz12b (SUZ12 polycomb repressive complex 2 subunit [Source:NCBI gene;Acc:101158330])

HSP 1 Score: 114.005 bits (284), Expect = 1.035e-25
Identity = 95/342 (27.78%), Postives = 169/342 (49.42%), Query Frame = 2
Query: 1178 KPMQTRNKSLPPIIKISPNKTRDGYSAGGYG--ENDFTQDLRLSSIRLKEKEKIEVNIAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQV-------NPNDF--DFGYVLSENYPVRRMPLTELIYYRYQKSAV----------------KTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLEN----FVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDKI 2107
            KP+ TRN         SP +TR  +        +   + D+++    +  + + ++ I Y+F+ N    Q T+ +  L CPWC LN +    LY+    L+ HL   HSR +F      N +   K  +I  DV++N+        NP D     G+  S N PV+R  +T ++  R +++                  +T+   HNRLY H+ S M L+  E ++DSE E + +WL ++   +++EF+D+N  EK+V+++WN  ++ +G +++D+Q+      FV+N    II         +++   F+LHLV++ DF ++S A +   M  L +  D++
Sbjct:  341 KPLATRNSG-----STSPMETRTSHHRAALMALKESVSADIQMKKELVPCEPRQKIRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCSK---LYS----LIKHLKLSHSRFIF------NYVPHPKGARI--DVSINECYDGSYVGNPQDIHSQPGFAFSRNGPVKRTAVTHILVSRPKRTKPSLSEFLESEDGELEQQRTYVSGHNRLYFHSDSCMPLRPQEMEVDSEDERDPEWLREKTSMQLDEFTDVNEGEKEVMKLWNLHVMKHG-FIADNQMNQAIMLFVENRGAHIIR--------RNLCRNFLLHLVSMHDFNLVSTATIDRAMARLQQIQDEL 653          
BLAST of SZ12-1 vs. Ensembl Medaka
Match: suz12a (polycomb protein suz12-A [Source:NCBI gene;Acc:101158611])

HSP 1 Score: 103.605 bits (257), Expect = 2.135e-22
Identity = 100/354 (28.25%), Postives = 163/354 (46.05%), Query Frame = 2
Query: 1196 NKSLPPIIKISPNKTRDGYSAGGYGENDFTQDLRLSSIR------LKEKEKIEVN---------------IAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLN-----QVNPNDF--DFGYVLSENYPVRRMPLTELIYYRYQ--KSAVKTF------------RKY---HNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLEN----FVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDKI 2107
             +S  P+ K  P  TR+         +D  QD R S++R      +KE    +V+               I Y+F  N    Q T+ +  L CPWC LN      LY+    LL HL   HSR VF      N +   K  K+ V +N         NP D     G+  S N PV+R P+T ++  R +  K ++  F            R Y   HNRLY H+ S + L+  E D DSE E +  WL ++  +++EEF+D+N  EK+++++WN  ++ +G +++D+Q+      F +     ++E        + +   F+LHL+++ DF ++  A        +D+A+ K+
Sbjct:  334 GRSTAPVAK--PLATRN---------SDTNQDSRPSTLRAAHAPAVKESPSADVHAKREQVSAEPRQKLRIFYQFQYNNNTRQQTEARDDLHCPWCTLNCRK---LYS----LLKHLKLSHSRFVF------NYVPHPKGAKVEVSINECYDGSYAGNPQDVHNQPGFAFSRNGPVKRTPVTHVLVCRPKRVKPSLSEFLESEDGDREQHQRTYISGHNRLYFHSDSCVPLRPQEMDEDSEDERDPDWLKEKTMKQIEEFTDVNEGEKEIMKLWNLHVMKHG-FIADNQMNKACLLFAEQHAALVVE--------RGLGRNFLLHLISMHDFNLIGTAT-------IDQAVAKL 647          
BLAST of SZ12-1 vs. Ensembl Medaka
Match: suz12b (SUZ12 polycomb repressive complex 2 subunit [Source:NCBI gene;Acc:101158330])

HSP 1 Score: 92.8189 bits (229), Expect = 3.746e-19
Identity = 91/343 (26.53%), Postives = 157/343 (45.77%), Query Frame = 2
Query: 1178 KPMQTRNKSLPPIIKISPNKTRDGYSAGGYG--ENDFTQDLRLSSIRLKEKEKIEVNIAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQV-------NPNDF--DFGYVLSENYPVRRMPLTELIYYRYQKSAV----------------KTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYR-KVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLEN----FVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDKI 2107
            KP+ TRN         SP +TR  +        +   + D+++    +  + + ++ I Y+F+ N    Q T+ +  L CPWC LN +    LY+    L+ HL   HSR +F      N +   K  +I  DV++N+        NP D     G+  S N PV+R  +T ++  R +++                  +T+   HNRLY H+ S M L+  E ++DSE E + +WL ++    +  E  D  +  KK+    N   +   I+++D+Q+      FV+N    II         +++   F+LHLV++ DF ++S A +   M  L +  D++
Sbjct:  334 KPLATRNSG-----STSPMETRTSHHRAALMALKESVSADIQMKKELVPCEPRQKIRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCS---KLYS----LIKHLKLSHSRFIF------NYVPHPKGARI--DVSINECYDGSYVGNPQDIHSQPGFAFSRNGPVKRTAVTHILVSRPKRTKPSLSEFLESEDGELEQQRTYVSGHNRLYFHSDSCMPLRPQEMEVDSEDERDPEWLREKTSMVRTGEICDSGNWRKKIWGFLNEHTVKKNIFIADNQMNQAIMLFVENRGAHIIR--------RNLCRNFLLHLVSMHDFNLVSTATIDRAMARLQQIQDEL 648          
BLAST of SZ12-1 vs. Ensembl Medaka
Match: suz12a (polycomb protein suz12-A [Source:NCBI gene;Acc:101158611])

HSP 1 Score: 67.3958 bits (163), Expect = 4.126e-11
Identity = 88/342 (25.73%), Postives = 142/342 (41.52%), Query Frame = 2
Query: 1196 NKSLPPIIKISPNKTRDGYSAGGYGENDFTQDLRLSS-----IRLKEKEKIE----VNIAYKFVVNEKIVQWTQTKH-LICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLN-----QVNPNDF--DFGYVLSENYPVRRMPLTELIYYRYQKSAV-----------------KTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLEN----FVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDKI 2107
             +S  P+ K  P  TR+         +D  QD R S+       L+E+   E    + I Y+F  N    Q T+ +  L CPWC LN      LY+    LL HL   HSR VF      N +   K  K+ V +N         NP D     G+  S N PV+R P+T ++  R ++                    +T+   HNRLY H+ S + L+  E D DSE E +  WL                 ++K +++     L+   +++D+Q+      F +     ++E        + +   F+LHL+++ DF ++  A        +D+A+ K+
Sbjct:  314 GRSTAPVAK--PLATRN---------SDTNQDSRPSTSCPKKTVLREQVSAEPRQKLRIFYQFQYNNNTRQQTEARDDLHCPWCTLNCRK---LYS----LLKHLKLSHSRFVF------NYVPHPKGAKVEVSINECYDGSYAGNPQDVHNQPGFAFSRNGPVKRTPVTHVLVCRPKRVKPSLSEFLESEDGDREQHQRTYISGHNRLYFHSDSCVPLRPQEMDEDSEDERDPDWL-----------------KEKTMKVRGG--LAGRGFIADNQMNKACLLFAEQHAALVVE--------RGLGRNFLLHLISMHDFNLIGTAT-------IDQAVAKL 597          
BLAST of SZ12-1 vs. Planmine SMEST
Match: SMESG000035646.1 (SMESG000035646.1)

HSP 1 Score: 1281.93 bits (3316), Expect = 0.000e+0
Identity = 670/673 (99.55%), Postives = 671/673 (99.70%), Query Frame = 2
Query:   89 MLTKNSLCFHKTEKYVKRRYSQALEIDNVNEPXXXXXXXXXXXADNDSETQSLSEDVLKSHSVEFQDFLKHFMIPSNIYKNLALRHKTNPIILKRNLSYLNHSKTDIQKSNLRTIADHLSTVRFHDENLALMKGKLPIXXXXXXXXXXVIFKFDQFVDSKTEKDWKTIEGIVYMDIVHFYRDNRKNKESFTVKRVISGQKIKCNEDMKSEQKSHSINIADIMKSANFYRVYKSVFHFKVLAKEKKLNGKEDKTGDIYPVTYEAMMPLFSNTCSRNLRSSNYFVQSGKYQIYMDVTDMEKCDNSVYNGTTRIVYNNNQDLESESSNKADCQWCRIDDPQHXXXXXXXXXXXFEICNHEVEKVKNKPMQTRNKSLPPIIKISPNKTRDGYSAGGYGENDFTQDLRLSSIRLKEKEKIEVNIAYKFVVNEKIVQWTQTKHLICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQVNPNDFDFGYVLSENYPVRRMPLTELIYYRYQKSAVKTFRKYHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLENFVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDKI 2107
            MLTKNSLCFHKTEKYVKRRYSQALEIDNVNEPIKKIRKIKKNKADNDSETQS SEDVLKSHSVEFQDFLKHFMIPSNIYKNLALRHKTNPIILKRNLSYLNHSKTDIQKSNLRTIADHLSTVRFHDENLALMKGKLPIKPNYPNYPNKVIFKFDQFVDSKTEKDWKTIEGIVYMDIVHFYRDNRKNKESFTVKRVISGQKIKCNEDMKSEQKSHSINIADIMKSANFYRVYKSVFHFKVLAKEKKLNGKEDKTGDIYPVTYEAMMPLFSNTCSRNLRSSNYFVQSGKYQIYMDVTDMEKCDNSVYNGTTRIVYNNNQDLESESSNK+DCQWCRIDDPQHKIINKNKAKIIFEICNHEVEKVKNKPMQTRNKSLPPIIKISPNKTRDGYSAGGYGENDFTQDLRLSSIRLKEKEKIEVNIAYKFVV EKIVQWTQTKHLICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQVNPNDFDFGYVLSENYPVRRMPLTELIYYRYQKSAVKTFRKYHNRLYSHTWSAMSLKDDEFDIDSESEENKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLENFVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDKI
Sbjct:    1 MLTKNSLCFHKTEKYVKRRYSQALEIDNVNEPIKKIRKIKKNKADNDSETQSFSEDVLKSHSVEFQDFLKHFMIPSNIYKNLALRHKTNPIILKRNLSYLNHSKTDIQKSNLRTIADHLSTVRFHDENLALMKGKLPIKPNYPNYPNKVIFKFDQFVDSKTEKDWKTIEGIVYMDIVHFYRDNRKNKESFTVKRVISGQKIKCNEDMKSEQKSHSINIADIMKSANFYRVYKSVFHFKVLAKEKKLNGKEDKTGDIYPVTYEAMMPLFSNTCSRNLRSSNYFVQSGKYQIYMDVTDMEKCDNSVYNGTTRIVYNNNQDLESESSNKSDCQWCRIDDPQHKIINKNKAKIIFEICNHEVEKVKNKPMQTRNKSLPPIIKISPNKTRDGYSAGGYGENDFTQDLRLSSIRLKEKEKIEVNIAYKFVVKEKIVQWTQTKHLICPWCLLNFNSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQVNPNDFDFGYVLSENYPVRRMPLTELIYYRYQKSAVKTFRKYHNRLYSHTWSAMSLKDDEFDIDSESEENKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLENFVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDEALDKI 673          
BLAST of SZ12-1 vs. Planmine SMEST
Match: SMESG000054377.1 (SMESG000054377.1)

HSP 1 Score: 94.7449 bits (234), Expect = 5.843e-20
Identity = 88/271 (32.47%), Postives = 145/271 (53.51%), Query Frame = 2
Query: 1331 IEVNIAYKFVVNEKIVQWTQTKHLICPWCLLNF-NSGNDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQVNPNDFDFGYVLS-ENY----PVRRMPLTELIYYRYQKSAVKTFRK-----------YHNRLYSHTWSAMSLKXXXXXXXXXXXXNKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHELLSYGIYVSDSQLENFVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVDFGVLSAAAMLECMKWLDE 2092
            ++VN+ YKF  N  ++QWT+++ + CPWC  NF    N    +F  L+ HL  +H+R  F   K     ++N  + I ++V LN+      + G   S EN     P R++P T +IY  +Q   +    K            HNR Y ++ + +     + D+DSE+E+N  WL   Y++++EEF+D+N  EK+++Q+WN  LL +  Y  D  +    K+F   I++   ++KE     N  +LHLVNLV+FG+LS   ++E +  LD+
Sbjct:  348 LDVNVVYKFFHNNHLLQWTRSQSVKCPWC--NFICEKNTTKLSFNCLMKHLQTFHARFTF---KYFGIPSVN-ISSIIIEVRLNECYDGSIEIGLRSSIENRLLEKPERKLPFTHIIYC-FQMCKINPMVKNPSIDLRPIVWGHNRKYYYSTTGIMKSIGDLDMDSETEDNLDWLQHMYFKRIEEFTDVNPGEKQIMQLWNSHLLDHK-YNGDFMVPILTKSF---ILQKGTEIKEHNLRNNL-LLHLVNLVEFGLLSQKQLIEVIGLLDQ 606          

HSP 2 Score: 55.4546 bits (132), Expect = 1.123e-7
Identity = 62/286 (21.68%), Postives = 118/286 (41.26%), Query Frame = 2
Query:  278 EFQDFLKHFMIPSNIYKNLALRHKTNPIILKRNLSYLNHSK-----------------TDIQKSNLRTIAD--HLSTVRFHDENLALMKGKLPIXXXXXXXXXXVIFKFDQFVDSKTEKDWKTIEGIVYMDIVHFYRDNRKNKESFTVKRVISGQKIKCNE----DMKSEQKSHSINIADIMKSANFYRVYKSVFHFKVLAKEKK--------LNGKEDKTGDIYPVTYEAMMPLFSNTCSRNLRSSNYFVQSGKYQIYMDVTDMEKCDNSVYNGTTRIVYNNNQD 1042
            E+++ +K     S++Y  L +  K +  +L RNLSY+  ++                   I+   +R+  D  H ST++  D N  L+                    F  F DS  E  W+TI     + ++H ++++RK +      + +S   IKCN     D +  QK H    + + +  N  RV  S   FK+   E++         N + +     Y V YE   P +    + N     +++  G+Y++ ++V+  +  ++   + T+  V++N  D
Sbjct:   20 EYEEIIKRLGHISSLYGYLKINFKRSHFLLFRNLSYIQGNQNSFKKKLKKIDKICERLVKIRIPRVRSSVDTNHFSTIK--DINWNLI--------------------FIGFFDSFHESQWETINACADIYVIHHWKNSRKFQSGKMTAKFLSNLPIKCNGRPTIDDERFQKKHEFVQSQLFQDTNHLRVVYSYLLFKLRVFERRTADGSKIDANAQVNHNNGHYAVHYELKFPFYKFRSNDN--DLKFYLLPGEYEMRLEVSLDQPTESLSGSTTSESVFDNVTD 281          
The following BLAST results are available for this feature:
BLAST of SZ12-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SUZ129.751e-2730.59SUZ12 polycomb repressive complex 2 subunit [Sourc... [more]
SUZ121.019e-2630.59SUZ12 polycomb repressive complex 2 subunit [Sourc... [more]
back to top
BLAST of SZ12-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SZ12-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Su(z)124.097e-1828.93gene:FBgn0020887 transcript:FBtr0074916[more]
Su(z)127.067e-1828.93gene:FBgn0020887 transcript:FBtr0074917[more]
back to top
BLAST of SZ12-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
suz12a9.526e-2528.74SUZ12 polycomb repressive complex 2 subunit a [Sou... [more]
suz12b2.851e-2330.47SUZ12 polycomb repressive complex 2 subunit b [Sou... [more]
suz12b4.858e-2130.47SUZ12 polycomb repressive complex 2 subunit b [Sou... [more]
suz12b6.548e-2131.45SUZ12 polycomb repressive complex 2 subunit b [Sou... [more]
back to top
BLAST of SZ12-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
suz127.398e-2830.41SUZ12, polycomb repressive complex 2 subunit [Sour... [more]
suz127.551e-2830.41SUZ12, polycomb repressive complex 2 subunit [Sour... [more]
suz128.367e-2830.41SUZ12, polycomb repressive complex 2 subunit [Sour... [more]
suz121.016e-2730.41SUZ12, polycomb repressive complex 2 subunit [Sour... [more]
suz121.326e-2730.41SUZ12, polycomb repressive complex 2 subunit [Sour... [more]
back to top
BLAST of SZ12-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Suz121.018e-2630.31SUZ12 polycomb repressive complex 2 subunit [Sourc... [more]
Suz121.109e-2630.31SUZ12 polycomb repressive complex 2 subunit [Sourc... [more]
back to top
BLAST of SZ12-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0VA03|SUZ12_XENTR5.158e-2730.41Polycomb protein suz12 OS=Xenopus tropicalis OX=83... [more]
sp|Q15022|SUZ12_HUMAN4.683e-2630.59Polycomb protein SUZ12 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q80U70|SUZ12_MOUSE7.759e-2630.31Polycomb protein Suz12 OS=Mus musculus OX=10090 GN... [more]
sp|Q6DC03|SZ12A_DANRE8.961e-2428.74Polycomb protein suz12-A OS=Danio rerio OX=7955 GN... [more]
sp|B0R1D5|SZ12B_DANRE2.153e-2230.47Polycomb protein suz12-B OS=Danio rerio OX=7955 GN... [more]
back to top
BLAST of SZ12-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9CXT50.000e+099.85SZ12-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=... [more]
A0A481NVF50.000e+074.34Polycomb protein SUZ12-1 OS=Dugesia japonica OX=61... [more]
A0A4V3SF317.957e-2728.93VEFS-Box domain-containing protein OS=Opisthorchis... [more]
A0A481NWA75.561e-2624.11Polycomb protein SUZ12-2 OS=Dugesia japonica OX=61... [more]
C6GGW62.258e-2530.12Suppressor of zeste 12 OS=Xenopus laevis OX=8355 G... [more]
back to top
BLAST of SZ12-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
suz12a1.176e-2428.74polycomb protein suz12-A-like [Source:NCBI gene;Ac... [more]
suz12a1.403e-2429.72polycomb protein suz12-A-like [Source:NCBI gene;Ac... [more]
suz12b4.578e-2330.11SUZ12 polycomb repressive complex 2 subunit [Sourc... [more]
suz12b7.311e-2329.75SUZ12 polycomb repressive complex 2 subunit [Sourc... [more]
back to top
BLAST of SZ12-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
suz12a1.157e-2127.65SUZ12 polycomb repressive complex 2 subunit a [Sou... [more]
back to top
BLAST of SZ12-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SZ12-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO426504.482e-2029.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SZ12-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
suz12b1.035e-2527.78SUZ12 polycomb repressive complex 2 subunit [Sourc... [more]
suz12a2.135e-2228.25polycomb protein suz12-A [Source:NCBI gene;Acc:101... [more]
suz12b3.746e-1926.53SUZ12 polycomb repressive complex 2 subunit [Sourc... [more]
suz12a4.126e-1125.73polycomb protein suz12-A [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of SZ12-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000035646.10.000e+099.55SMESG000035646.1[more]
SMESG000054377.15.843e-2032.47SMESG000054377.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30001977
GenBankAFD29606.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001977 ID=SMED30001977|Name=SZ12-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2227bp
CATCTCACGGAAATTCTCGATTTTAATAGGTCATATTCTTTTTGAAATTC
ATTGTTATTTTAGTTCACTGTTTTATTGTTGAGATTTTATGTTGACTAAA
AATTCTTTGTGTTTTCATAAAACGGAAAAATATGTTAAAAGAAGATATTC
TCAAGCTTTAGAAATTGATAATGTAAATGAACCGATCAAGAAAATAAGAA
AAATAAAAAAAAATAAAGCTGATAATGATTCGGAGACGCAGTCTCTTTCT
GAAGACGTACTTAAGTCACATAGCGTAGAATTTCAAGATTTTCTTAAACA
TTTTATGATTCCATCAAATATATATAAGAATCTAGCTTTGCGGCACAAGA
CAAATCCTATTATTTTAAAACGAAATTTATCTTACCTTAATCACAGTAAA
ACAGATATCCAAAAATCTAATTTACGCACTATTGCCGATCATTTATCTAC
TGTAAGATTCCATGACGAGAATTTAGCACTTATGAAAGGTAAATTACCAA
TTAAACCCAATTACCCAAACTATCCGAATAAAGTAATATTTAAATTCGAC
CAATTTGTTGATAGTAAAACAGAAAAAGATTGGAAAACTATAGAAGGGAT
TGTTTACATGGATATAGTCCATTTTTATCGGGATAATCGCAAAAACAAAG
AATCCTTCACTGTAAAACGAGTGATATCCGGTCAGAAAATCAAATGCAAC
GAAGACATGAAATCAGAACAGAAATCTCACTCTATTAACATTGCCGACAT
AATGAAAAGCGCTAATTTTTATCGTGTCTACAAATCTGTCTTTCATTTTA
AAGTACTAGCCAAAGAGAAAAAGTTAAACGGAAAGGAAGACAAAACCGGT
GACATCTATCCAGTCACATATGAAGCTATGATGCCTCTGTTTAGTAACAC
TTGCAGTCGAAATTTACGATCATCGAATTACTTTGTGCAATCTGGTAAAT
ATCAAATCTACATGGACGTGACAGACATGGAAAAATGTGACAATTCCGTT
TATAATGGCACAACTCGGATCGTTTACAACAACAATCAGGATTTGGAATC
TGAATCCAGCAATAAAGCCGATTGCCAATGGTGTCGAATAGATGATCCTC
AACATAAAATCATCAACAAGAACAAAGCGAAAATCATTTTTGAAATTTGC
AATCATGAGGTGGAAAAAGTGAAAAACAAACCGATGCAAACCCGAAACAA
ATCGCTTCCACCGATAATCAAAATCTCTCCAAATAAAACCAGAGATGGAT
ACTCAGCCGGCGGTTACGGAGAGAACGATTTTACTCAAGATTTACGATTG
TCATCGATAAGATTAAAAGAGAAAGAGAAAATTGAAGTGAATATTGCATA
TAAATTCGTTGTAAATGAGAAAATCGTCCAGTGGACCCAAACGAAACATT
TGATTTGCCCATGGTGCCTACTAAATTTCAACTCAGGCAATGATCTCTAT
AATACTTTCCAACAGCTGTTATCGCATTTGAACAATTGGCATTCCAGATT
GGTTTTTACTTGTAAAAAATTGAAAAATCGCATGACTTTGAATAAGACAA
ATAAAATCACTGTCGATGTCAATCTTAATCAGGTAAATCCAAATGATTTT
GATTTTGGGTACGTTTTATCAGAAAACTATCCAGTGAGGCGCATGCCCTT
GACGGAACTGATTTATTACAGATATCAGAAATCAGCAGTGAAAACCTTTA
GGAAATACCATAATCGGTTGTACAGTCATACCTGGTCGGCCATGTCACTG
AAAGACGATGAATTTGACATTGATTCGGAATCAGAAGAAAACAAACAATG
GTTATTTGATCAATATTACCGGAAAGTTGAGGAGTTCAGCGATCTGAATC
ATATTGAAAAGAAAGTCATTCAAATGTGGAATCACGAGTTGCTGAGTTAT
GGGATTTACGTCAGCGATAGTCAATTGGAGAATTTCGTCAAAAATTTCAT
TCAGCGAATAATTGAAGATGACAACCAATTGAAAGAGGTGAAATCAATGC
GAAACACATTTATGTTACATTTAGTGAACTTGGTCGATTTCGGAGTTTTA
TCAGCAGCTGCAATGCTCGAATGCATGAAATGGCTCGATGAGGCCTTGGA
TAAAATTTAATGTTGTTGTTCAAATTTTGATATTCAATATTTTATGTGGA
TTTGTGTTTTGAATAATGATTAAATTTCTAATTAAGTGGTACTTTGAATC
TGTTTATGTGCATTTCTGTTGTTGTTG
back to top

protein sequence of SMED30001977-orf-1

>SMED30001977-orf-1 ID=SMED30001977-orf-1|Name=SMED30001977-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=674bp
MLTKNSLCFHKTEKYVKRRYSQALEIDNVNEPIKKIRKIKKNKADNDSET
QSLSEDVLKSHSVEFQDFLKHFMIPSNIYKNLALRHKTNPIILKRNLSYL
NHSKTDIQKSNLRTIADHLSTVRFHDENLALMKGKLPIKPNYPNYPNKVI
FKFDQFVDSKTEKDWKTIEGIVYMDIVHFYRDNRKNKESFTVKRVISGQK
IKCNEDMKSEQKSHSINIADIMKSANFYRVYKSVFHFKVLAKEKKLNGKE
DKTGDIYPVTYEAMMPLFSNTCSRNLRSSNYFVQSGKYQIYMDVTDMEKC
DNSVYNGTTRIVYNNNQDLESESSNKADCQWCRIDDPQHKIINKNKAKII
FEICNHEVEKVKNKPMQTRNKSLPPIIKISPNKTRDGYSAGGYGENDFTQ
DLRLSSIRLKEKEKIEVNIAYKFVVNEKIVQWTQTKHLICPWCLLNFNSG
NDLYNTFQQLLSHLNNWHSRLVFTCKKLKNRMTLNKTNKITVDVNLNQVN
PNDFDFGYVLSENYPVRRMPLTELIYYRYQKSAVKTFRKYHNRLYSHTWS
AMSLKDDEFDIDSESEENKQWLFDQYYRKVEEFSDLNHIEKKVIQMWNHE
LLSYGIYVSDSQLENFVKNFIQRIIEDDNQLKEVKSMRNTFMLHLVNLVD
FGVLSAAAMLECMKWLDEALDKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000422tail stripe
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR019135Polycomb_protein_VEFS-Box
Vocabulary: biological process
TermDefinition
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0008284positive regulation of cell proliferation
GO:0016569covalent chromatin modification
GO:0016571histone methylation
GO:0016574histone ubiquitination
GO:0045596negative regulation of cell differentiation
Vocabulary: molecular function
TermDefinition
GO:0000979RNA polymerase II core promoter sequence-specific DNA binding
GO:0003682chromatin binding
GO:0003723RNA binding
GO:0005515protein binding
GO:0031490chromatin DNA binding
GO:0035064methylated histone binding
GO:0042054histone methyltransferase activity
GO:0043565sequence-specific DNA binding
GO:0046872metal ion binding
GO:1990841promoter-specific chromatin binding
Vocabulary: cellular component
TermDefinition
GO:0001739sex chromatin
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005694chromosome
GO:0005730nucleolus
GO:0016586RSC complex
GO:0016604nuclear body
GO:0032993protein-DNA complex
GO:0035098ESC/E(Z) complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019135Polycomb protein, VEFS-BoxPFAMPF09733VEFS-Boxcoord: 533..664
e-value: 1.9E-19
score: 69.8
NoneNo IPR availablePANTHERPTHR22597POLYCOMB GROUP PROTEINcoord: 48..669
NoneNo IPR availablePANTHERPTHR22597:SF0POLYCOMB PROTEIN SUZ12coord: 48..669