Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30001962
Length (bp)2160
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001962

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 36

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30001962h1SMcG0021503 Contig4368GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30001962h1SMcG0021503 Contig4368GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30001962h1SMcG0020718 Contig4368GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30001962h1SMcG0020718 Contig4368GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30001962h1SMcG0020717 Contig4368GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30001962h1SMcG0020717 Contig4368GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30001962h1SMcG0020719 dd_Smed_v4_311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001962h1SMcG0020719 dd_Smed_v4_311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001962h1SMcG0020719 dd_Smed_v4_311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001962h1SMcG0020719 dd_Smed_v4_311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30001962h1SMcG0020719 dd_Smed_v4_311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001962h1SMcG0020719 dd_Smed_v4_311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30001962h1SMcG0020718 dd_Smed_v4_311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001962h1SMcG0020718 dd_Smed_v4_311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001962h1SMcG0020718 dd_Smed_v4_311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001962h1SMcG0020718 dd_Smed_v4_311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30001962h1SMcG0020718 dd_Smed_v4_311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001962h1SMcG0020718 dd_Smed_v4_311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001962h1SMcG0020718 Contig41911newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001962h1SMcG0020718 Contig41911uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001962h1SMcG0020718 Contig36994newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001962h1SMcG0020718 Contig36994uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001962h1SMcG0020718 Contig16197newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001962h1SMcG0020718 Contig16197uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30001962 dd_Smed_v4_12113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001962 dd_Smed_v4_12113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001962h1SMcG0020718 dd_Smed_v6_311_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30001962h1SMcG0020718 dd_Smed_v6_311_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30001962h1SMcG0020718 dd_Smed_v6_311_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001962h1SMcG0020718 dd_Smed_v6_311_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001962h1SMcG0020719 dd_Smed_v6_311_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30001962h1SMcG0020719 dd_Smed_v6_311_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30001962h1SMcG0020719 dd_Smed_v6_311_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001962h1SMcG0020719 dd_Smed_v6_311_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001962h1SMcG0020719 dd_Smed_v4_311_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001962h1SMcG0020718 dd_Smed_v4_311_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 125.561 bits (314), Expect = 2.645e-29
Identity = 77/202 (38.12%), Postives = 114/202 (56.44%), Query Frame = 2
Query:  857 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
            G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L HERI++YYG + +  +  L I MEY+  GS++D++       ++    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  392 GKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKN-LQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 591          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 125.561 bits (314), Expect = 2.744e-29
Identity = 77/202 (38.12%), Postives = 114/202 (56.44%), Query Frame = 2
Query:  857 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
            G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L HERI++YYG + +  +  L I MEY+  GS++D++       ++    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  396 GKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKN-LQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 595          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 125.561 bits (314), Expect = 2.744e-29
Identity = 77/202 (38.12%), Postives = 114/202 (56.44%), Query Frame = 2
Query:  857 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
            G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L HERI++YYG + +  +  L I MEY+  GS++D++       ++    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  396 GKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKN-LQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 595          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 125.176 bits (313), Expect = 2.844e-29
Identity = 77/202 (38.12%), Postives = 114/202 (56.44%), Query Frame = 2
Query:  857 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
            G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L HERI++YYG + +  +  L I MEY+  GS++D++       ++    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  361 GKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKN-LQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 560          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 125.176 bits (313), Expect = 2.934e-29
Identity = 77/202 (38.12%), Postives = 114/202 (56.44%), Query Frame = 2
Query:  857 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
            G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L HERI++YYG + +  +  L I MEY+  GS++D++       ++    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  365 GKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKN-LQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 564          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: mtk-1 (MTK1/MEKK4 homolog [Source:UniProtKB/TrEMBL;Acc:O01837])

HSP 1 Score: 126.716 bits (317), Expect = 1.169e-29
Identity = 74/201 (36.82%), Postives = 111/201 (55.22%), Query Frame = 2
Query:  866 IGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEI----------GTGNQYGTPVDIWSLGATVLFMLTGK 1438
            I  G+FG V++  +  + R+ A K M I + N ++++  IN F+ ++ HE ++KYYG   ED+ + I MEY   G+LE   + K +        +Y+  +L  +++LH + IIHRD+KP NI LD    +KL DFG    L +         T  G+  F APEI          G+ + YG  VDIW+LGATV+ M+TGK
Sbjct: 1131 IASGSFGSVHRAMDIDSHRVIAAKVMRIQRENHKAIESEINIFRQLI-HENLVKYYGVQVEDSDVIIFMEYCSQGTLERICHGKMDLKMVR---QYTNSLLRAVQYLHSHKIIHRDIKPANIFLDKCTVLKLGDFGCSSRLVESSTVYGEFQTTAGTPQFMAPEIYSYGEKDETTGSYSGYGRSVDIWALGATVVNMMTGK 1327          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: mtk-1 (MTK1/MEKK4 homolog [Source:UniProtKB/TrEMBL;Acc:O01837])

HSP 1 Score: 126.716 bits (317), Expect = 1.263e-29
Identity = 74/201 (36.82%), Postives = 111/201 (55.22%), Query Frame = 2
Query:  866 IGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEI----------GTGNQYGTPVDIWSLGATVLFMLTGK 1438
            I  G+FG V++  +  + R+ A K M I + N ++++  IN F+ ++ HE ++KYYG   ED+ + I MEY   G+LE   + K +        +Y+  +L  +++LH + IIHRD+KP NI LD    +KL DFG    L +         T  G+  F APEI          G+ + YG  VDIW+LGATV+ M+TGK
Sbjct: 1131 IASGSFGSVHRAMDIDSHRVIAAKVMRIQRENHKAIESEINIFRQLI-HENLVKYYGVQVEDSDVIIFMEYCSQGTLERICHGKMDLKMVR---QYTNSLLRAVQYLHSHKIIHRDIKPANIFLDKCTVLKLGDFGCSSRLVESSTVYGEFQTTAGTPQFMAPEIYSYGEKDETTGSYSGYGRSVDIWALGATVVNMMTGK 1327          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: mig-15 (Serine/threonine-protein kinase mig-15 [Source:UniProtKB/Swiss-Prot;Acc:Q23356])

HSP 1 Score: 120.939 bits (302), Expect = 6.903e-28
Identity = 88/271 (32.47%), Postives = 140/271 (51.66%), Query Frame = 2
Query:  845 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITED--------TKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRY-SKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ-----YGTPVDIWSLGATVLFMLTG----------KKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLK 1585
            +FE    +G+GT+G VYK +   T +L A+K M IN+   + +K+ IN  +   +H  +  YYGA  +          +L++VME+  +GS+ D +   K     ++ + Y  ++IL GL HLH++ +IHRD+K  N+LL     VKL DFG+   LDK +G      T  G+ Y+ APE+   ++     Y +  D+WSLG T L M  G          + L  +  +  P++ +    T   K+  TF+E +L KD  +R    ALL+
Sbjct:   20 IFELIEVVGNGTYGQVYKGRHVKTAQLAAIKIMNINEDEEDEIKLEINMLKKHSHHRNVATYYGAFIKKLPSSTGKHDQLWLVMEFCGSGSITDLVKNTKGGSLKEEWIAYICREILRGLYHLHQSKVIHRDIKGQNVLLTDSAEVKLVDFGVSAQLDKTVGRR---NTFIGTPYWMAPEVIACDESPEATYDSRSDLWSLGITALEMAEGHPPLCDMHPMRALFLIPRNPPPKLKRNKKWT---KKFETFIETVLVKDYHQRPYTGALLR 284          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: mig-15 (Serine/threonine-protein kinase mig-15 [Source:UniProtKB/Swiss-Prot;Acc:Q23356])

HSP 1 Score: 120.939 bits (302), Expect = 6.972e-28
Identity = 88/271 (32.47%), Postives = 140/271 (51.66%), Query Frame = 2
Query:  845 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITED--------TKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRY-SKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ-----YGTPVDIWSLGATVLFMLTG----------KKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLK 1585
            +FE    +G+GT+G VYK +   T +L A+K M IN+   + +K+ IN  +   +H  +  YYGA  +          +L++VME+  +GS+ D +   K     ++ + Y  ++IL GL HLH++ +IHRD+K  N+LL     VKL DFG+   LDK +G      T  G+ Y+ APE+   ++     Y +  D+WSLG T L M  G          + L  +  +  P++ +    T   K+  TF+E +L KD  +R    ALL+
Sbjct:   20 IFELIEVVGNGTYGQVYKGRHVKTAQLAAIKIMNINEDEEDEIKLEINMLKKHSHHRNVATYYGAFIKKLPSSTGKHDQLWLVMEFCGSGSITDLVKNTKGGSLKEEWIAYICREILRGLYHLHQSKVIHRDIKGQNVLLTDSAEVKLVDFGVSAQLDKTVGRR---NTFIGTPYWMAPEVIACDESPEATYDSRSDLWSLGITALEMAEGHPPLCDMHPMRALFLIPRNPPPKLKRNKKWT---KKFETFIETVLVKDYHQRPYTGALLR 284          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: mig-15 (Serine/threonine-protein kinase mig-15 [Source:UniProtKB/Swiss-Prot;Acc:Q23356])

HSP 1 Score: 120.939 bits (302), Expect = 7.543e-28
Identity = 88/271 (32.47%), Postives = 140/271 (51.66%), Query Frame = 2
Query:  845 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITED--------TKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRY-SKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ-----YGTPVDIWSLGATVLFMLTG----------KKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLK 1585
            +FE    +G+GT+G VYK +   T +L A+K M IN+   + +K+ IN  +   +H  +  YYGA  +          +L++VME+  +GS+ D +   K     ++ + Y  ++IL GL HLH++ +IHRD+K  N+LL     VKL DFG+   LDK +G      T  G+ Y+ APE+   ++     Y +  D+WSLG T L M  G          + L  +  +  P++ +    T   K+  TF+E +L KD  +R    ALL+
Sbjct:   20 IFELIEVVGNGTYGQVYKGRHVKTAQLAAIKIMNINEDEEDEIKLEINMLKKHSHHRNVATYYGAFIKKLPSSTGKHDQLWLVMEFCGSGSITDLVKNTKGGSLKEEWIAYICREILRGLYHLHQSKVIHRDIKGQNVLLTDSAEVKLVDFGVSAQLDKTVGRR---NTFIGTPYWMAPEVIACDESPEATYDSRSDLWSLGITALEMAEGHPPLCDMHPMRALFLIPRNPPPKLKRNKKWT---KKFETFIETVLVKDYHQRPYTGALLR 284          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: msn (gene:FBgn0010909 transcript:FBtr0333364)

HSP 1 Score: 123.635 bits (309), Expect = 1.293e-28
Identity = 92/265 (34.72%), Postives = 137/265 (51.70%), Query Frame = 2
Query:  845 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAIT------EDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRY-SKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ-----YGTPVDIWSLGATVLFMLTGKK----LEKLEN-SVTPQMS-KLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLK 1585
            +FE    +G+GT+G VYK + + TG+L A+K M + +   E +K+ IN  +   NH  I  YYGA        +D +L++VMEY   GS+ D +   K     ++ + Y  ++IL GL +LH N +IHRD+K  N+LL     VKL DFG+   LD+ IG      T  G+ Y+ APE+   ++     Y    D+WSLG T L M   +     L  +    + P+ S   L   K  K+   F++ +L KD  +R   E LLK
Sbjct:   31 IFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRR---NTFIGTPYWMAPEVIACDENPDATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKSKKWSKKFHGFIDTVLVKDYHQRPYTENLLK 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: msn (gene:FBgn0010909 transcript:FBtr0333365)

HSP 1 Score: 123.635 bits (309), Expect = 1.489e-28
Identity = 92/265 (34.72%), Postives = 137/265 (51.70%), Query Frame = 2
Query:  845 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAIT------EDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRY-SKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ-----YGTPVDIWSLGATVLFMLTGKK----LEKLEN-SVTPQMS-KLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLK 1585
            +FE    +G+GT+G VYK + + TG+L A+K M + +   E +K+ IN  +   NH  I  YYGA        +D +L++VMEY   GS+ D +   K     ++ + Y  ++IL GL +LH N +IHRD+K  N+LL     VKL DFG+   LD+ IG      T  G+ Y+ APE+   ++     Y    D+WSLG T L M   +     L  +    + P+ S   L   K  K+   F++ +L KD  +R   E LLK
Sbjct:   31 IFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRR---NTFIGTPYWMAPEVIACDENPDATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKSKKWSKKFHGFIDTVLVKDYHQRPYTENLLK 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: msn (gene:FBgn0010909 transcript:FBtr0072957)

HSP 1 Score: 123.635 bits (309), Expect = 1.489e-28
Identity = 92/265 (34.72%), Postives = 137/265 (51.70%), Query Frame = 2
Query:  845 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAIT------EDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRY-SKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ-----YGTPVDIWSLGATVLFMLTGKK----LEKLEN-SVTPQMS-KLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLK 1585
            +FE    +G+GT+G VYK + + TG+L A+K M + +   E +K+ IN  +   NH  I  YYGA        +D +L++VMEY   GS+ D +   K     ++ + Y  ++IL GL +LH N +IHRD+K  N+LL     VKL DFG+   LD+ IG      T  G+ Y+ APE+   ++     Y    D+WSLG T L M   +     L  +    + P+ S   L   K  K+   F++ +L KD  +R   E LLK
Sbjct:   31 IFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRR---NTFIGTPYWMAPEVIACDENPDATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKSKKWSKKFHGFIDTVLVKDYHQRPYTENLLK 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: msn (gene:FBgn0010909 transcript:FBtr0072959)

HSP 1 Score: 123.25 bits (308), Expect = 1.650e-28
Identity = 92/265 (34.72%), Postives = 137/265 (51.70%), Query Frame = 2
Query:  845 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAIT------EDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRY-SKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ-----YGTPVDIWSLGATVLFMLTGKK----LEKLEN-SVTPQMS-KLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLK 1585
            +FE    +G+GT+G VYK + + TG+L A+K M + +   E +K+ IN  +   NH  I  YYGA        +D +L++VMEY   GS+ D +   K     ++ + Y  ++IL GL +LH N +IHRD+K  N+LL     VKL DFG+   LD+ IG      T  G+ Y+ APE+   ++     Y    D+WSLG T L M   +     L  +    + P+ S   L   K  K+   F++ +L KD  +R   E LLK
Sbjct:   31 IFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRR---NTFIGTPYWMAPEVIACDENPDATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKSKKWSKKFHGFIDTVLVKDYHQRPYTENLLK 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: msn (gene:FBgn0010909 transcript:FBtr0072958)

HSP 1 Score: 123.25 bits (308), Expect = 1.650e-28
Identity = 92/265 (34.72%), Postives = 137/265 (51.70%), Query Frame = 2
Query:  845 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAIT------EDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRY-SKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ-----YGTPVDIWSLGATVLFMLTGKK----LEKLEN-SVTPQMS-KLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLK 1585
            +FE    +G+GT+G VYK + + TG+L A+K M + +   E +K+ IN  +   NH  I  YYGA        +D +L++VMEY   GS+ D +   K     ++ + Y  ++IL GL +LH N +IHRD+K  N+LL     VKL DFG+   LD+ IG      T  G+ Y+ APE+   ++     Y    D+WSLG T L M   +     L  +    + P+ S   L   K  K+   F++ +L KD  +R   E LLK
Sbjct:   31 IFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRR---NTFIGTPYWMAPEVIACDENPDATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKSKKWSKKFHGFIDTVLVKDYHQRPYTENLLK 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 131.724 bits (330), Expect = 1.528e-31
Identity = 78/206 (37.86%), Postives = 117/206 (56.80%), Query Frame = 2
Query:  845 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
             +  G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L+HERI++YYG + +  +  L I MEY+  GS++D++       +N    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S+    ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  343 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKN-LHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 546          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 131.339 bits (329), Expect = 1.847e-31
Identity = 78/206 (37.86%), Postives = 117/206 (56.80%), Query Frame = 2
Query:  845 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
             +  G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L+HERI++YYG + +  +  L I MEY+  GS++D++       +N    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S+    ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  355 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKN-LHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 558          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 131.339 bits (329), Expect = 2.198e-31
Identity = 78/206 (37.86%), Postives = 117/206 (56.80%), Query Frame = 2
Query:  845 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
             +  G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L+HERI++YYG + +  +  L I MEY+  GS++D++       +N    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S+    ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  361 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKN-LHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 564          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 126.716 bits (317), Expect = 7.221e-30
Identity = 78/202 (38.61%), Postives = 116/202 (57.43%), Query Frame = 2
Query:  857 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAI--TEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
            G  +G G FG V+   ++ TGR  AVK +  +  + E      +L+  I   +N+  HERI++YYG +  T +  L I MEY+  GS++D++       +N    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  R L     S     ++ G+ Y+ +PE+ +G  YG   DIWS+G TV+ MLT +
Sbjct:  365 GKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVSALECEIQLLKNLF-HERIVQYYGCLRDTHEKTLSIFMEYMPGGSIKDQLKSYGALTENVTR-KYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICLSGTGIKSVTGTPYWMSPEVISGEGYGRKADIWSIGCTVVEMLTQR 564          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 126.331 bits (316), Expect = 7.270e-30
Identity = 78/202 (38.61%), Postives = 116/202 (57.43%), Query Frame = 2
Query:  857 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAI--TEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
            G  +G G FG V+   ++ TGR  AVK +  +  + E      +L+  I   +N+  HERI++YYG +  T +  L I MEY+  GS++D++       +N    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  R L     S     ++ G+ Y+ +PE+ +G  YG   DIWS+G TV+ MLT +
Sbjct:  357 GKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVSALECEIQLLKNLF-HERIVQYYGCLRDTHEKTLSIFMEYMPGGSIKDQLKSYGALTENVTR-KYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICLSGTGIKSVTGTPYWMSPEVISGEGYGRKADIWSIGCTVVEMLTQR 556          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 128.642 bits (322), Expect = 1.815e-30
Identity = 78/202 (38.61%), Postives = 117/202 (57.92%), Query Frame = 2
Query:  857 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAI--TEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
            G  +G G FG VY   ++ TGR  AVK +  +  + E      +L+  I   +N+L HERI++YYG +  +++  L I MEY+  GS++D++       +     +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   DIWS+G TV+ MLT K
Sbjct:  342 GKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPDSLETSKEVNALECEIQLLKNLL-HERIVQYYGCLRDSQEKTLSIFMEYMPGGSIKDQLKAYGALTEFVTR-KYTRQILEGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTEK 541          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 128.642 bits (322), Expect = 2.568e-30
Identity = 78/202 (38.61%), Postives = 117/202 (57.92%), Query Frame = 2
Query:  857 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAI--TEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
            G  +G G FG VY   ++ TGR  AVK +  +  + E      +L+  I   +N+L HERI++YYG +  +++  L I MEY+  GS++D++       +     +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   DIWS+G TV+ MLT K
Sbjct:  370 GKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPDSLETSKEVNALECEIQLLKNLL-HERIVQYYGCLRDSQEKTLSIFMEYMPGGSIKDQLKAYGALTEFVTR-KYTRQILEGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTEK 569          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 126.716 bits (317), Expect = 7.787e-30
Identity = 78/202 (38.61%), Postives = 116/202 (57.43%), Query Frame = 2
Query:  857 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
            G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L+H+RI++YYG++ +  +  L I MEY+  GS++D++       +N    RY++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  350 GKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEIQLLKN-LHHDRIVQYYGSLRDKGEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-RYTRQILEGVSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 549          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 127.102 bits (318), Expect = 7.917e-30
Identity = 78/202 (38.61%), Postives = 116/202 (57.43%), Query Frame = 2
Query:  857 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
            G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L+H+RI++YYG++ +  +  L I MEY+  GS++D++       +N    RY++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  368 GKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEIQLLKN-LHHDRIVQYYGSLRDKGEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-RYTRQILEGVSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 567          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: dennd1a (DENN domain containing 1A [Source:Xenbase;Acc:XB-GENE-5729862])

HSP 1 Score: 125.561 bits (314), Expect = 2.271e-29
Identity = 89/261 (34.10%), Postives = 140/261 (53.64%), Query Frame = 2
Query:  857 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQ------NILNHERIIKYYGAITEDT--KLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGKKLEKLENSVTPQMSKLLDLTKVP-----KEMVT-----FLEYMLDKDPKRRWTAEALLK 1585
            G  +G G FG+VY   +   GR  AVK +  +  + E+ K  +NA +       +  HERI++YYG + + T  KL I +EY+  GS++D++       +N    RY++QIL+G+ +LH N I+HRD+K  NIL D   NVKL DFG  + +     S     ++ G+ Y+ +PE+ +G  YG   D+WS+  TV+ MLT    EK   S    M+ +  +   P      + V+     F++ +  ++ KRR TAE LL+
Sbjct:  364 GKLLGRGAFGEVYLCYDVDKGRELAVKQVPFDPDSQETSK-EVNALECEIQLLKLHRHERIVQYYGCLRDPTERKLSIFVEYMPGGSIKDQLKAYGALTENVTR-RYTRQILQGVSYLHGNMIVHRDIKGANILRDSAGNVKLGDFGASKRIQTICMSGTGIKSVTGTPYWMSPEVISGEGYGRKADVWSVACTVVEMLT----EKPPWSEYEAMAAIFKIATQPTKPRLPDTVSDACRDFMKQIFVEE-KRRPTAEELLR 617          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346873])

HSP 1 Score: 125.561 bits (314), Expect = 1.440e-29
Identity = 78/202 (38.61%), Postives = 115/202 (56.93%), Query Frame = 2
Query:  857 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAI--TEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
            G  +G G FG VY   +  TGR  AVK +  N  + E      +L+  I   +N+L HERI++YYG +   ++  L I MEY+  GS++D++       +N    +Y++QILEG+ +LH N I+HRD+K  NIL D   N+KL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   DIWS+  TV+ MLT K
Sbjct:  359 GKLLGQGAFGRVYLCYDVDTGRELAVKQVQFNPESPETSKEVNALECEIQLLKNLL-HERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTR-KYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNIKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEK 558          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:MGI Symbol;Acc:MGI:1346874])

HSP 1 Score: 125.561 bits (314), Expect = 1.793e-29
Identity = 77/202 (38.12%), Postives = 114/202 (56.44%), Query Frame = 2
Query:  857 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITEDTK--LYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
            G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L HERI++YYG + +  +  L I MEY+  GS++D++       ++    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  365 GKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKN-LQHERIVQYYGCLRDRAEKILTIFMEYMPGGSVKDQLKAYGALTESVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 564          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map4k2 (mitogen-activated protein kinase kinase kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346883])

HSP 1 Score: 121.709 bits (304), Expect = 4.597e-28
Identity = 84/259 (32.43%), Postives = 132/259 (50.97%), Query Frame = 2
Query:  848 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVN-AESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ---YGTPVDIWSLGATV---------LFMLTGKKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLK 1585
            FE   ++G GT+GDVYK +++VT  L AVK + ++  +   SL+  I   +    H  ++ Y G+   + +L+I ME+   GSL++  +      +        ++ L+GL HLH  G IHRD+K  N+LL  + +VKLADFG+   L   +       +  G+ Y+ APE+    +   Y    D+W+LG T          LF L   +   L +  + Q  KL D T+  +    FL+  L K+PK+R TAE LL+
Sbjct:   16 FELLQRVGAGTYGDVYKARDTVTSELAAVKIVKLDPGDDISSLQQEITILREC-RHPNVVAYIGSYLRNDRLWICMEFCGGGSLQEIYHATGPLEERQIAY-VCREALKGLHHLHSQGKIHRDIKGANLLLTLQGDVKLADFGVSGELTASVAKR---RSFIGTPYWMAPEVAAVERKGGYNELCDVWALGITAIELGELQPPLFHLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFLKLALTKNPKKRPTAERLLQ 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map4k2 (mitogen-activated protein kinase kinase kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346883])

HSP 1 Score: 121.709 bits (304), Expect = 4.597e-28
Identity = 84/259 (32.43%), Postives = 132/259 (50.97%), Query Frame = 2
Query:  848 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVN-AESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ---YGTPVDIWSLGATV---------LFMLTGKKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLK 1585
            FE   ++G GT+GDVYK +++VT  L AVK + ++  +   SL+  I   +    H  ++ Y G+   + +L+I ME+   GSL++  +      +        ++ L+GL HLH  G IHRD+K  N+LL  + +VKLADFG+   L   +       +  G+ Y+ APE+    +   Y    D+W+LG T          LF L   +   L +  + Q  KL D T+  +    FL+  L K+PK+R TAE LL+
Sbjct:   16 FELLQRVGAGTYGDVYKARDTVTSELAAVKIVKLDPGDDISSLQQEITILREC-RHPNVVAYIGSYLRNDRLWICMEFCGGGSLQEIYHATGPLEERQIAY-VCREALKGLHHLHSQGKIHRDIKGANLLLTLQGDVKLADFGVSGELTASVAKR---RSFIGTPYWMAPEVAAVERKGGYNELCDVWALGITAIELGELQPPLFHLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFLKLALTKNPKKRPTAERLLQ 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Tnik (TRAF2 and NCK interacting kinase [Source:MGI Symbol;Acc:MGI:1916264])

HSP 1 Score: 121.324 bits (303), Expect = 1.131e-27
Identity = 89/275 (32.36%), Postives = 136/275 (49.45%), Query Frame = 2
Query:  845 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITE------DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRY-SKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEI-----GTGNQYGTPVDIWSLGATVLFMLTG----------KKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLKLEMFRN 1603
            +FE    +G+GT+G VYK +   TG+L A+K M +     E +K  IN  +   +H  I  YYGA  +      D +L++VME+   GS+ D I   K +   ++ + Y  ++IL GL HLH++ +IHRD+K  N+LL     VKL DFG+   LD+ +G      T  G+ Y+ APE+          Y    D+WSLG T + M  G          + L  +  +  P+    L   K  K+  +F+E  L K+  +R   E L+K    R+
Sbjct:   24 IFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRR---NTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPR----LKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRD 291          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9CAD5|YODA_ARATH (Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana OX=3702 GN=YDA PE=1 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.281e-30
Identity = 94/267 (35.21%), Postives = 140/267 (52.43%), Query Frame = 2
Query:  848 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFI------NKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVR-YSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPE-IGTGNQYGTPVDIWSLGATVLFMLTGKKLEKLENSVTPQMSKLLDLTKVP-------KEMVTFLEYMLDKDPKRRWTAEALLKLEMFRN 1603
            ++ G  +G G+FG VY    S +G + A+K + +      ++ +A+ L   I+     L H+ I++YYG+ T D KLYI +EYV  GS+      ++     ++ +R Y++QIL GL +LH    +HRD+K  NIL+D    VK+ADFG+ + +    G    P++ KGS Y+ APE I   N     VDIWSLG TVL M T K        V P M K+ +  ++P       +E   F+   L ++P  R TA  LL     RN
Sbjct:  400 WKKGRLLGMGSFGHVYLGFNSESGEMCAMKEVTLCSDDPKSRESAQQLGQEISVLSR-LRHQNIVQYYGSETVDDKLYIYLEYVSGGSI--YKLLQEYGQFGENAIRNYTQQILSGLAYLHAKNTVHRDIKGANILVDPHGRVKVADFGMAKHITAQSG----PLSFKGSPYWMAPEVIKNSNGSNLAVDIWSLGCTVLEMATTKPPWSQYEGV-PAMFKIGNSKELPDIPDHLSEEGKDFVRKCLQRNPANRPTAAQLLDHAFVRN 658          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q54PX0|Y4251_DICDI (Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284251 PE=3 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 2.443e-29
Identity = 87/256 (33.98%), Postives = 135/256 (52.73%), Query Frame = 2
Query:  857 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNI--LNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTG-------KKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLKLEMF 1597
            G KIG G FG V+K     TG   A+K +  NK++  SL+      + +  L H  I+K  G +    +L  ++EYV NGSL D I K     +   I+ Y  Q+L+GL +LH N +IHRD+K  NIL+  E  +KLADFG+   +D     + +  ++ G+ Y+ APE    +   +  DIWSLG+T++ +LTG       + +  +   V+ Q       T + KE + + +    KDP +R TA+ LL+  +F
Sbjct:   39 GEKIGRGAFGQVFKGLNGKTGEFVAIKQIDSNKIDESSLQSVKGEVEILHKLRHNNIVKVLGVVEVQAQLNFILEYVENGSLRDVIEKFGPLSEELCII-YLYQMLQGLAYLHSNKVIHRDIKASNILITKEGVIKLADFGVASQID---SESQLRFSVVGTPYWMAPESIEISGCSSASDIWSLGSTMIELLTGNPPYYTLQPMAAMFRIVSDQHPPF--PTDISKEFLDYFQQSFKKDPTQRPTAQELLQHPIF 288          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8T2I8|SEPA_DICDI (Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum OX=44689 GN=sepA PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.717e-29
Identity = 93/266 (34.96%), Postives = 136/266 (51.13%), Query Frame = 2
Query:  824 PTSIRKKVFEG----GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNI--LNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGKKLEKLENSVTPQMSKLL--DLTKVPK----EMVTFLEYMLDKDPKRRWTAEALLK 1585
            P  I+K V  G    G  IG G FG VY+  +   G   A+K + + K+  + L+  +N    +  LNH  I+KY   +     LYIV+EYV NGSL   I K     +    V Y +Q+LEGL +LH+ G++HRD+K  NIL   E  +KLADFG+    D    + ++     G+ Y+ APEI   N   T  DIWS+G TV+ +LTG      +    P + +++  D   +P+     +  +L     KDP  R +A+ LLK
Sbjct:    6 PEEIKKNVTVGNYNLGVVIGKGGFGTVYQGLDIEDGDFVAIKQINLTKIPKDQLQGIMNEIDLLKNLNHANIVKYIKYVKTKDNLYIVLEYVENGSLSGIIKKFGKFPETLVCV-YIRQVLEGLVYLHEQGVVHRDIKGANILTTKEGKIKLADFGVATKFDDTSAAAVV-----GTPYWMAPEIIELNGATTKSDIWSVGCTVIELLTGSP-PYYDLGQMPALFRIVQDDCPPLPEGISPPLKDWLMQCFQKDPNLRISAQKLLK 264          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7RZD3|STE20_NEUCR (Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=stk-4 PE=3 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 7.123e-29
Identity = 85/267 (31.84%), Postives = 133/267 (49.81%), Query Frame = 2
Query:  815 KFCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGKKLEKLENSV----------TPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLK 1585
            + C     ++++ G TKIG G  G VY   E  + RL A+K M + +   + L +N        +H  I+ +  +     +L++VMEY+  GSL D +            V   ++ L GL+HLH  G+IHRD+K  NILL  E N+KL DFG    +++         T+ G+ Y+ APE+ T  +YG  VDIWSLG   + M+ G+     E+ +          TP +     L+ V ++   FL + L  DP++R +A  LL+
Sbjct:  663 RICSDGDPREIYRGFTKIGQGASGGVYTGHERGSNRLVAIKQMNLEQQPKKDLIINEILVMKESSHPNIVNFIDSYLCAGELWVVMEYMEGGSLTDVVTFNIMTEGQIASV--CRETLRGLQHLHSKGVIHRDIKSDNILLSMEGNIKLTDFGFCATINEAQSKRT---TMVGTPYWMAPEVVTRKEYGRKVDIWSLGIMAIEMIEGEPPYLTESPLRALWLIATNGTPHIKDEQSLSPVFRD---FLYFALKVDPEKRASAHDLLR 921          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q61084|M3K3_MOUSE (Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus OX=10090 GN=Map3k3 PE=1 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.254e-28
Identity = 77/202 (38.12%), Postives = 114/202 (56.44%), Query Frame = 2
Query:  857 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITEDTK--LYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
            G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L HERI++YYG + +  +  L I MEY+  GS++D++       ++    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  365 GKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKN-LQHERIVQYYGCLRDRAEKILTIFMEYMPGGSVKDQLKAYGALTESVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 564          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A0H3YJG2 (Slc42a-1 OS=Schmidtea mediterranea OX=79327 GN=slc42a-1 PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 6.060e-52
Identity = 153/501 (30.54%), Postives = 242/501 (48.30%), Query Frame = 2
Query:  125 DKMSEFQAF---VDSIKLGNFESFVQLYKPEYLN-KKDKQSWCAIHYACQFGHKEVLEKLISWNCDINQMG--GRNGLLPIQLACSEGQTDIVALLTQAECDIEIKCLENSLMKCPNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLVHNCDIDALDKADQAPKDIARNNRNDELIKVLDEERSERPLRRLISSMGVTCKGDTCDHKFCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGKKLEKLENSVTPQMSKLLDLTK---------VPKEMVTFLEYMLDKDPKRRWTAEALL 1582
            ++ SEF+ F   + +IK G+ E   + Y    L  K    S   I YAC++GH+++++  I   C+++      R  L     A      DIV LL ++   I +          P+                         S+L              PIH A +  + E  +LL+ +NCD+  LDK  ++P  IA     + +IK++ E +    +R + + M + C G  C+HKFC TS ++K  +    I  G++G V+ + ES T R FAVK +    + A  ++ NIN F+N+L HERI+K++GA  +    YI MEY     L+    KK       D++ ++KQILE L  LH+  IIHRD+KP N+LLD + N+KL+DFG+  +L              G+  + APEI     Y   VDIWSLGAT++ + TG+      N     +  ++  T+         +PK +   +++ML+KD  +R +A+ LL
Sbjct:  499 ERYSEFEKFGQLIKAIKDGSIEDVKKYYSRRILEIKLGSYSRSPILYACKYGHRKIVKYFIKQKCNVDSFDCEFRRAL---HYAVISNNNDIVKLLIESGAAINV----------PD-------------------------SLLM------------MPIHLACKVNNIEAAQLLMENNCDMVTLDKLKRSPLQIAETGDFENMIKLIKECQ---IIREIAAEMQLKC-GKLCNHKFCYTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEY-----LDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNLKLSDFGLSLLLSSVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQ--PPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 938          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: K1PKP1 (Mitogen-activated protein kinase kinase kinase 2 OS=Crassostrea gigas OX=29159 GN=CGI_10008499 PE=4 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 8.842e-35
Identity = 98/268 (36.57%), Postives = 148/268 (55.22%), Query Frame = 2
Query:  821 CPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILN------HERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK----KLEKLENSVTPQMSKLLDLTKVPKEMVTF----LEYMLDKDPKRRWTAEALL 1582
            CP +     ++ G  +G G FG+VY   +  TGR  A+K + + ++NAE+ K  + A +N ++      HERI+ Y+G   +   LYI MEY+  GS++D+I K  +  +N    +Y+KQ+LEGL +LHKN I+HRD+K  NIL DG  N+KL DFG  + L   + +T +  ++ G+ Y+ APE+  G  YG   DIWS+G T++ MLT K    + E +       M K    T +P  +       L    D++P  R TA  LL
Sbjct:   60 CPVN-----WKAGALLGSGAFGEVYVCHDKDTGRDLAMKVVRLEQMNAETSK-EVRALENEIHLLRNFEHERIVSYFGCAQDKQSLYIFMEYLPGGSVKDEITKYGSLTENVSR-KYTKQMLEGLAYLHKNVIVHRDIKGANILRDGNGNIKLGDFGASKRLQTIVSATGL-HSVVGTPYWMAPEVINGEGYGRKADIWSVGCTIVEMLTTKPPWAEFESMAALYKIAMEKRPHFT-LPNHISELCHDVLSKAFDRNPSTRPTAIDLL 318          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A5B8MXT0 (Mitogen-activated protein kinase OS=Chloropicon primus OX=1764295 GN=A3770_17p78750 PE=4 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 2.560e-34
Identity = 136/464 (29.31%), Postives = 209/464 (45.04%), Query Frame = 2
Query:  299 WNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDIEIKCLENSLMKCPNEKIVDILKGRKFLLACKKGDLETVRSMLT-DVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLVHNCDIDALDKADQAPKDIARNNRNDELIKVLDEER---------SERPLRRLISSMGVTCKGDTCDHKFCPTSIRKKVFE----GGTKIGHGTFGDVYKFQESVTGRLFAVKTMFIN------KVNAESLKVNINAFQNILNHERIIKYYGAITEDTK--LYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGR--VLDKGIGSTII-PMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK-KLEKLENSVTP--QMSKLLDLTKVPKEMVT----FLEYMLDKDPKRRWTAEALLKLEM 1594
            WN  ++ +   +G  P+Q A    Q +    L     D ++  L  +             +G   ++ACK G  E    ++T   +V   D+D   P+H A   GH    +++L     I A  K    P  +A  +   +L       R          ERP  R  +SM            F  +S R +  E     G  +G G +G VY      TG++ AVK + ++        N ++L+  I  F   L HE I++YYGA  +  +  +Y+ +EYV  GS+   + +     +    + Y+KQIL GL  LH+N  IHRD+K  NIL+  E + KLADFG  +  V  +  GS +    ++ GS Y+ APE+  G  +G   DIWSLG TV+ MLTGK   ++ +N+ T   Q++K      +PK +      FL+     DP +R TA  LL  + 
Sbjct:  236 WNVLLDAITLPSGRTPLQEAVFYDQGERAKELLDVGVDADLDPLRGAGQHH---------QGSPLIIACKLGHHEVADLLITYGASVHCVDQDAFTPLHHACAEGHARCAEVVLSQGASIRARTKGGLTPLQLASTDGVRDLFNPSSRSRKAEEEDGGVPERPRGRDSNSM------------FRESSKRIESGEMEWKKGELLGEGAYGRVYAGLNHETGQIMAVKQIAVDMDNDKHTDNLKALEREIE-FYKTLKHEHIVEYYGAFLDKDQHLMYVFLEYVSGGSISSMLKRFGPFSEALTKI-YTKQILRGLLFLHENKTIHRDVKGANILITQEGSAKLADFGASKRYVNAENSGSGLSNSKSITGSVYWMAPEVMKGTGHGRKADIWSLGCTVVEMLTGKHPWKEYDNTWTAMFQIAKSESGPGLPKNISKDAREFLQLCFQLDPTKRPTALDLLGTQF 676          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0BQX0 (Protein kinase domain-containing protein OS=Paramecium tetraurelia OX=5888 GN=GSPATT00031166001 PE=3 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 1.628e-33
Identity = 97/256 (37.89%), Postives = 146/256 (57.03%), Query Frame = 2
Query:  857 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFI-----NKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK-KLEKLEN--SVTPQMSKLLDLTKVPKEMVT-----FLEYMLDKDPKRRWTAEALLK 1585
            G  IG G FG V      V+G++ AVK +FI     NKV +   ++ I +    L H  I++YYG+  +  +L I +EYV  GS+   I +     ++   V Y KQIL GL++LH  G+IHRD+K  NIL++    VKLADFG G+ L + I   ++  +L G+  F APE+    QYG   DIWSLG T++ M TG     +++N  ++  ++SKL D+  +P+E+ +     FL+  L  +P+ RW AE LL+
Sbjct:   63 GEMIGQGAFGRVILGMNRVSGQIMAVKQVFIKSGDENKVQSIQREIEILS---KLQHLHIVRYYGSERKKDQLNIFLEYVSGGSVLMMIKRFGKFKESLIKV-YLKQILLGLQYLHSQGVIHRDIKGANILINQNGQVKLADFGSGKQLSE-IQQDVVG-SLCGTPNFMAPEVINQQQYGKKADIWSLGCTMIEMATGHPPFSEVKNIYTIMVKISKLTDMIPIPEELKSEQARDFLKKCLQLNPEDRWEAEDLLQ 312          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A0G4FXQ4 (Protein kinase domain-containing protein OS=Vitrella brassicaformis (strain CCMP3155) OX=1169540 GN=Vbra_6072 PE=4 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.766e-33
Identity = 96/268 (35.82%), Postives = 155/268 (57.84%), Query Frame = 2
Query:  827 TSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVK---TMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGKKLEKLENSVTPQMSKLLDLTKVP------KEMVTFLEYMLDKDPKRRWTAEALLKLEMFRN 1603
            +SI+   ++ G  IG G FG V+K  ++ TG   AVK   T  ++K   +SL++ I+  +  LNH  I+KY+ ++T+ T LYIV+EYV +GSL   I K  + M+    + Y+ Q+L G+ +LH+ G++HRD+K  NIL      VKLADFG+ R L +   ++    ++ G+ Y+ APEI   +   T  DIWS+G TV+ MLTGK     + +  P + +++   + P       E+ +FL    +K+P++R TA  L++ E  R+
Sbjct:    2 SSIKIGRYQLGEAIGKGGFGVVFKALDTKTGEFVAVKQVPTHNLSKEKLDSLRMEISLLRR-LNHRNIVKYHDSLTDGTFLYIVLEYVESGSLASIIKKYGSFMETLAAI-YTSQVLRGMRYLHEQGVVHRDIKGANILTTKRGIVKLADFGVARSLSEAEKTS----SVVGTPYWMAPEIIEMHVTSTACDIWSVGCTVIEMLTGKP-PYFDLAPMPALFRIVQDPRPPLPHDISPELQSFLMACFEKNPEKRITAAELMEHEWIRH 262          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 130.568 bits (327), Expect = 2.572e-31
Identity = 78/206 (37.86%), Postives = 118/206 (57.28%), Query Frame = 2
Query:  845 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAES------LKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
             +  G  +G G FG VY   +  TGR  A K +  +  + E+      L+  I   +N L+HERI++YYG + +  +  L I MEY+  GS++D++       +N    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S+    ++ G+ Y+ +PE+ +G+ YG   D+WSLG TV+ MLT K
Sbjct:  355 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEIQLLKN-LHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEK 558          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 130.568 bits (327), Expect = 2.572e-31
Identity = 78/206 (37.86%), Postives = 118/206 (57.28%), Query Frame = 2
Query:  845 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAES------LKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
             +  G  +G G FG VY   +  TGR  A K +  +  + E+      L+  I   +N L+HERI++YYG + +  +  L I MEY+  GS++D++       +N    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S+    ++ G+ Y+ +PE+ +G+ YG   D+WSLG TV+ MLT K
Sbjct:  355 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEIQLLKN-LHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEK 558          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 130.568 bits (327), Expect = 2.572e-31
Identity = 78/206 (37.86%), Postives = 118/206 (57.28%), Query Frame = 2
Query:  845 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAES------LKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
             +  G  +G G FG VY   +  TGR  A K +  +  + E+      L+  I   +N L+HERI++YYG + +  +  L I MEY+  GS++D++       +N    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S+    ++ G+ Y+ +PE+ +G+ YG   D+WSLG TV+ MLT K
Sbjct:  355 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEIQLLKN-LHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEK 558          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:103026704])

HSP 1 Score: 126.331 bits (316), Expect = 6.233e-30
Identity = 78/200 (39.00%), Postives = 115/200 (57.50%), Query Frame = 2
Query:  857 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAI--TEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLT 1432
            G  +G G FG V+   ++ TGR  AVK +  +  + E      +L+  I   +N+  HERI++YYG +  T +  L I MEY+  GS++D++       +N    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  R L     S     ++ G+ Y+ +PE+ +G  YG   DIWS+G TV+ MLT
Sbjct:  362 GKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVSALECEIQLLKNLF-HERIVQYYGCLRDTHERTLSIFMEYMPGGSIKDQLKSYGALTENVTR-KYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICLSGTGIKSVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLT 559          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3-like [Source:NCBI gene;Acc:103044968])

HSP 1 Score: 123.25 bits (308), Expect = 7.378e-29
Identity = 78/207 (37.68%), Postives = 116/207 (56.04%), Query Frame = 2
Query:  848 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFIN--------KVNAESLKVNINAFQNILNHERIIKYYGAI--TEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
            +  G  +G G FG+VY   ++ TGR  AVK +  +        +VNA  L+  I   +N L HERI++YYG +   E  KL I +E++  GS++D++       +     RY++QIL+G+ +LH N I+HRD+K  NIL D   NVKL DFG  + +     S     T+ G+ Y+ +PE+  G  YG   D+WS+  TV+ MLT K
Sbjct:  357 WRQGKLLGRGAFGEVYLCYDADTGRELAVKQVPFDPECHETSKEVNA--LECEIQLLKN-LRHERIVQYYGCLRDPEQRKLSIFVEFMPGGSIKDQLKAYGALTEKVTR-RYTRQILQGVFYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTICMSGTGIKTVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQK 559          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 125.946 bits (315), Expect = 2.153e-30
Identity = 77/205 (37.56%), Postives = 115/205 (56.10%), Query Frame = 2
Query:  848 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQ------NILNHERIIKYYGAITEDTK--LYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
            ++ G  +G G FG VY   ++ TGR  AVK +  +  + E+ K  +NA +        L HERI++Y+G + +  +  L I MEY+  GS++D++       +N    +Y++QILEG+  LH N I+HRD+K  NIL D   NVKL DFG  + L           ++ G+ Y+ +PE+  G  YG   DIWS+G TV+ MLT K
Sbjct:  359 WQRGKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPGSVETSK-EVNALECEIQLLKNLQHERIVQYFGCLRDPQQKTLSIFMEYMPGGSIKDQLRAYGALTENVTR-KYTRQILEGVSFLHGNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICSQGTAMRSVTGTPYWMSPEVINGEGYGRKADIWSVGCTVVEMLTEK 561          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: cdk2 (cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2741])

HSP 1 Score: 109.768 bits (273), Expect = 8.362e-27
Identity = 85/296 (28.72%), Postives = 133/296 (44.93%), Query Frame = 2
Query:  845 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNI-----LNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSE----YFTAPEIGTG-NQYGTPVDIWSLGATVLFMLTGKKLEKLENSV-----------TPQMSKLLDLTKVPKEMVTFLEY----------------------MLDKDPKRRWTAEALLKLEMFRN 1603
            +F+   KIG GT+G VYK +  +TG   A+K +   +++ E+  V   A + I     LNH  I++    I  +TKLY+V E++     +   N     +    +  Y  Q+L+G+   H    +HRDLKP N+L++ +  +KLADFG+ R          +P+     E    ++ APEI  G   Y T VD+WSLG     MLT + L   ++ +           TP  +    +T++P    +F  +                      ML  DP RR +A+A L    F N
Sbjct:    3 LFQKVEKIGEGTYGVVYKARHKMTGDTVALKKI---RLDTETEGVPSTAIREIALLRELNHPNIVRLLDVIHSETKLYLVFEFLDQDLKKYMDNAPPLGISLPLVKSYMHQLLQGIAFCHAQRTLHRDLKPQNLLINADGAIKLADFGLARAFG-------VPLRTYTHEVVTLWYRAPEILLGCKYYSTAVDVWSLGCIFAEMLTRRALFPGDSEIDQLFRIFRTLGTPDETVWQGITQLPDYKPSFPRWCAQDLTKVVPLLDAAGHDLLMQMLQYDPTRRVSAKAALNHHFFHN 288          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: pak4 (p21 protein (Cdc42/Rac)-activated kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040704-69])

HSP 1 Score: 112.079 bits (279), Expect = 7.782e-26
Identity = 80/262 (30.53%), Postives = 130/262 (49.62%), Query Frame = 2
Query:  848 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTG----------KKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLKLEMFRN 1603
             E   KIG G+ G V    +  +GR  AVK M + K     L  N        +HE ++  Y +     +L++VME++  G+L D +   + + +    V  S  +L  L +LH  G+IHRD+K  +ILL  +  +KL+DFG    + K +       +L G+ Y+ APE+ +   YG  VD+WSLG  V+ M+ G          + + ++ ++V P+M    ++ K    +  FL+ ML +DP  R TA  LL+    +N
Sbjct:  419 LENFIKIGEGSTGVVCLAVDRRSGRQVAVKKMHLRKQQRRELLFNEVVIMREYHHENVVDMYNSYLVADELWVVMEFLEGGALTDIVTHTRMNEEQIATVCVS--VLRALAYLHGQGVIHRDIKSDSILLTADGRIKLSDFGFCAQVSKEVTRR---KSLVGTPYWMAPEVISRLPYGPEVDVWSLGIMVIEMVDGEPPYFNEPPLQAMRRIRDNVPPKMK---NIQKASPLLRGFLDQMLVRDPALRATALELLQHPFLQN 672          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: MAP4K3 (mitogen-activated protein kinase kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6865])

HSP 1 Score: 111.694 bits (278), Expect = 1.192e-25
Identity = 79/257 (30.74%), Postives = 123/257 (47.86%), Query Frame = 2
Query:  848 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ---YGTPVDIWSLGATV---------LFMLTGKKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALL 1582
            FE   ++G GT+GDV+K +   TG L A+K + +   +  S+            H  I+ YYG+     KL+I ME+   GSL+D  +      +       +++ L+GL +LH  G +HRD+K  NILL  + +VKLADFG+   +   I       +  G+ Y+ APE+    +   Y    D+W++G T          +F L   +   L +    Q  KL D  K       F++  L K+PK+R TAE +L
Sbjct:   14 FELAERLGSGTYGDVHKARNVQTGELVAIKIIKLEPGDDFSVIQQEIVMMKECKHTNIVAYYGSYLRHDKLWICMEHCGGGSLQDIYHVTGPLTERQIAY-VTRETLQGLAYLHSEGKMHRDIKGANILLTDDGDVKLADFGVSAQITATIAKR---KSFIGTPYWMAPEVAAVERKGGYNHQCDVWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFQPPKLRDKQKWSPVFHNFIKMALTKNPKKRPTAEKML 266          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 108.997 bits (271), Expect = 9.110e-25
Identity = 79/253 (31.23%), Postives = 130/253 (51.38%), Query Frame = 2
Query:  866 IGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQ--NILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTP-VDIWSLGATVLFMLT------GKKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDK----DPKRRWTAEALLK 1585
            IG G F  V   + ++TGR  AVK +   ++N  SL+      +   ILNH  I+K +  I  +  LY+VMEY   G + D +       + +   ++ +QI+  +++ H+  I+HRDLK  N+LLD + N+K+ADFG        +GS +   T  GS  + APE+  G +Y  P VD+WSLG  +  +++      G+ L++L   V      L    ++P  M T  E +L +    +P +R + E ++K
Sbjct:   60 IGKGNFAKVKLARHTLTGREVAVKIIDKTQLNPSSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKF-RQIVSAVQYCHQKHIVHRDLKAENLLLDADMNIKIADFGFSNEFT--LGSKLD--TFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERV------LRGKYRIPFYMSTDCENLLKRFLVLNPAKRGSLEQIMK 301          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 124.79 bits (312), Expect = 6.840e-30
Identity = 75/190 (39.47%), Postives = 110/190 (57.89%), Query Frame = 2
Query:  866 IGHGTFGDVYKFQESVTGRLFAVK-TMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLT 1432
            IG G++G VYK     T ++ A+K  ++ N      +   I+  +N LNH  I+KY+G I +  +LYI++EY  NGSL   I++    +  ++   Y  Q L GL++LH  G+IHRD+K  NILL  ++ VKLADFG+  +++         +TL G+  + APEI       T  DIWSLGATV+ MLT
Sbjct:   31 IGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELNDIMAEISLLKN-LNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSS------ALTLAGTLNWMAPEILGNRGASTLSDIWSLGATVVEMLT 213          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 121.709 bits (304), Expect = 6.229e-29
Identity = 87/260 (33.46%), Postives = 140/260 (53.85%), Query Frame = 2
Query:  866 IGHGTFGDVYKFQESVTGRLFAVKTMFINKVN--AESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPE-IGTGNQYGTPVDIWSLGATVLFMLTGKK----LEKLENSVTPQMSKLLDLTKVPK--------EMVTFLEYMLDKDPKRRWTAEALLKLEMFR 1600
            IG G FG VYK     TGR++A+K + ++  +   E ++  I    ++     I +YYG+  +DT L+I+ME+   GSL   +   K D K   ++   +++L  L+ +HK+ +IHRD+K  N+L+  E NVKL DFG+   +++   +++   T+ G+ Y+ APE I  G  Y T VDIWSLG T   + TG      +E L      +  +L+  +K P+         +  F+   LD+DPK R +A+ LLK +  R
Sbjct:   29 IGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISNITRYYGSYLKDTSLWIIMEHCAGGSLRSLLRPGKIDEKYIGVIM--RELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQ---TSLRRQTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEAL------RAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDEDPKERLSADDLLKSKFIR 277          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: RAD53 (DNA damage response protein kinase; required for cell-cycle arrest, regulation of copper genes in response to DNA damage; phosphorylates nuclear pores to counteract gene gating, preventing aberrant transitions at forks approaching transcribed genes; activates downstream kinase Dun1p; differentially senses mtDNA depletion, mitochondrial ROS; relocalizes to cytosol under hypoxia; human homolog CHEK2 implicated in breast cancer can complement yeast null mutant [Source:SGD;Acc:S000006074])

HSP 1 Score: 110.923 bits (276), Expect = 1.482e-25
Identity = 96/323 (29.72%), Postives = 149/323 (46.13%), Query Frame = 2
Query:  710 NDELIKVLDEERSERPLRRLISSMGVTCKGDTCDHKFCPTSIRKKVFEGGTKI----GHGTFGDVYKFQESVTGRLFAVKTMFINKV--NAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDN--VKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTG-------------NQYGTPVDIWSLGATVLFMLTGKKLEKLENSVTPQMSK-----------LLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALL 1582
            ND+  + L++ + +R    L ++  +   G T        + +  +F+  + I    G G F  V K  E  TG+ FAVK +   KV  N + +   +   Q  LNH RI++  G   +    Y+VME+V  G L          +  D     S+QIL  ++++H  GI HRDLKP NIL++ +D   VK+ DFG+ +V  +G GS +   T  G+  + APE+  G             N+Y + VD+WS+G  V  +LTG        S   Q+ K           L D  ++ +E   F++ +L  DP  R TA   L
Sbjct:  148 NDKFKQCLEQNKVDRIRSNLKNTSKIASPGLTSSTASSMVANKTGIFKDFSIIDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMDGVTRELEVLQK-LNHPRIVRLKGFYEDTESYYMVMEFVSGGDL-MDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKV--QGNGSFM--KTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHL--PFSGSTQDQLYKQIGRGSYHEGPLKDF-RISEEARDFIDSLLQVDPNNRSTAAKAL 461          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 107.457 bits (267), Expect = 6.102e-25
Identity = 78/263 (29.66%), Postives = 125/263 (47.53%), Query Frame = 2
Query:  866 IGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNIN--AFQNILNHERIIKYYGAITED--TKLYIVMEYVVNGSLEXXXXXXXXX---XXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK---KLEKLENSVTPQMSKLLDLTKVP-------------KEMVTFLEYMLDKDPKRRWTAEALLK 1585
            +G G  G V K +     ++FA+KT+     + E  K       F      + I++YYG  T++  + +YI MEY+   SLE            +    I + ++ +L GL +LH+  +IHRD+KP NILL+ +  +KL DFG+      G     + MT  G+ ++ APE   G  Y    D+WSLG T+L +  G+   + +K+  +V P     + LT  P             K   +F++Y L KD + R +   +LK
Sbjct:  220 LGEGAGGSVAKCRLKNGKKVFALKTINTMNTDPEYQKQIFRELQFNKSFKSDYIVQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKGEIKLCDFGVS-----GEAVNSLAMTFTGTSFYMAPERIQGQPYSVTCDVWSLGLTLLEVAGGRFPFESDKITQNVAPIELLTMILTFSPQLKDEPELDISWSKTFRSFIDYCLKKDARERPSPRQMLK 477          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: MKK1 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p; MKK1 has a paralog, MKK2, that arose from the whole genome duplication [Source:SGD;Acc:S000005757])

HSP 1 Score: 104.375 bits (259), Expect = 5.753e-24
Identity = 75/262 (28.63%), Postives = 120/262 (45.80%), Query Frame = 2
Query:  866 IGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNIN--AFQNILNHERIIKYYGAITED--TKLYIVMEYVVNGSLEXXXXXXXXX---XXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK---KLEKLENSVTPQMSKLLDLTKVPK-------------EMVTFLEYMLDKDPKRRWTAEALL 1582
            +G G  G V K +     ++FA+K +     + E  K       F      E I++YYG  T+D  + +YI MEY+   SL+            +    + + ++ +L GL +LH+  +IHRD+KP NILL+    VKL DFG+      G     +  T  G+ ++ APE   G  Y    D+WSLG T+L +  GK     EK+  ++ P    +  LT  P+                +F++Y L KD + R +   ++
Sbjct:  227 LGEGAGGSVSKCKLKNGSKIFALKVINTLNTDPEYQKQIFRELQFNRSFQSEYIVRYYGMFTDDENSSIYIAMEYMGGRSLDAIYKNLLERGGRISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNENGQVKLCDFGVS-----GEAVNSLATTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTILEVANGKFPCSSEKMAANIAPFELLMWILTFTPELKDEPESNIIWSPSFKSFIDYCLKKDSRERPSPRQMI 483          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 136.732 bits (343), Expect = 4.163e-36
Identity = 96/265 (36.23%), Postives = 137/265 (51.70%), Query Frame = 2
Query:  857 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINA------FQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGKKLEKLENSVTPQMSKLLDLTKVPKE----------MVTFLEYMLDKDPKRRWTAEALLKLEMFRN 1603
            G  +G G FG VY   +  TGR  AVK +   ++N+ S K  + A      F     +ERI++YYG  T+D  +YI MEY+  GS+ + I +     ++    +YS+QILEG+ +LH N I+HRD+K  NIL D   NVKLADFG  + L + I S     ++ G+ Y+ APE+  G  YG   D+WS+G TV+ MLT K          P M+ L  +   P E           V F+   L  + K R +A+ LL+     N
Sbjct:    7 GKLLGAGAFGQVYMCHDLDTGRELAVKQIETGQLNS-STKNEVKALEGEIEFMKAFRNERIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTR-KYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRL-QTIRSKTGFRSVHGTPYWMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWA---DFEP-MAALFKIATQPTEPELPSDLSVDAVEFVRSTLRMNSKSRPSADELLRFSFVTN 264          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49138 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH03])

HSP 1 Score: 118.242 bits (295), Expect = 9.645e-30
Identity = 81/247 (32.79%), Postives = 126/247 (51.01%), Query Frame = 2
Query:  866 IGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQ--NILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGKKLEKLENSVTPQMSKLL--DLTKVPKEMVTFLE----YMLDKDPKRRWTAEALL 1582
            IG GTFG  +  +   + RL+A+K +    + +E   + +N  +  + L H  I++Y  A  E  + YIVMEY   G L  KI +      ++ I+ +  Q+L  L+H+H   I+HRDLK  NI L  +D VK+ DFGI R+LD          T  G+ Y+ +PEI     Y    DIW+LG  VL+ LT +      +++T  + K+L  +   +P+     LE     ML  +P  R +A+ L+
Sbjct:   10 IGKGTFGSAWLVESRQSKRLYALKELNATAMPSEDRHLALNEVKILSTLKHRNIVRYRDAFEETGRFYIVMEYAEGGDLHTKIKQAVEPFSSERILNWLAQLLLALKHIHGQNILHRDLKTQNIFLTKDDVVKIGDFGIARILDSTCDHA---RTTVGTPYYLSPEICQRQPYNNKSDIWALGC-VLYELTTRTHPFTADNLTNLVVKILHGNYPPIPRFYGPLLEDLVAVMLKINPADRPSAKQLI 252          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO40961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5T6])

HSP 1 Score: 117.472 bits (293), Expect = 4.688e-29
Identity = 85/281 (30.25%), Postives = 138/281 (49.11%), Query Frame = 2
Query:  845 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAIT------EDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRY-SKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ-----YGTPVDIWSLGATVLFMLTGKKLEKLENSVTP--QMSKLLDLTKVPK--------------EMVTFLEYMLDKDPKRRWTAEALLKLEMFRN 1603
            +F+    +G+GT+G V+K +   TG+L A+K M + +   E +K+ IN  +   NH  I  YYGA        +D +L++VME+   GS+ D +   +N    ++ + Y  +++L G+ HLH N +IHRD+K  N+LL     VKL DFG+   LD+ IG      T  G+ Y+ APE+   ++     Y    D+WS+G T +         ++  S  P   M  +  L  +P+                  F+   L KD + R TA+ LL+ E  ++
Sbjct:   19 IFDLVEVVGNGTYGQVHKGRHKRTGQLTAIKIMDVTEDEEEEIKLEINVLRKFSNHRNIATYYGAFIKKSLQGQDDQLWLVMEFCGAGSVTDLVKTARNKALKEEWISYICREVLNGVSHLHMNHVIHRDIKGQNVLLTESAEVKLVDFGVSAQLDRTIGRR---NTFIGTPYWMAPEVIACDEQPDATYDNRCDMWSIGITAI---------EMAESQPPLCDMHPMRALFLIPRSDPPKLKSKKSWSKRFHHFVNTCLIKDYQHRPTADQLLQHEFIKD 287          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO33667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRJ0])

HSP 1 Score: 117.087 bits (292), Expect = 1.160e-27
Identity = 89/264 (33.71%), Postives = 130/264 (49.24%), Query Frame = 2
Query:  839 KKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIP-----MTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGKKLEKLENSV----------TPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLK 1585
            KK +    KIG G  G VY   E  TG   A+K M +++   + L +N         H  I+ Y  +     +L++VMEY+  GSL D + +   D      V   ++ L+ LE LH NG+IHRD+K  NILL  +  VKL DF        G  +TI P      T+ G+ Y+ APE+ T  QYG  VD+WSLG   + M+ G+     EN +          TP+++    L+ V K+   FL   L+ D ++R +A  LL+
Sbjct:  223 KKKYTKFEKIGQGASGTVYTAIEVATGHEVAIKQMNLSQQPKKELIINEILVMRENKHPNIVNYVDSYLVGEELWVVMEYLAGGSLTDVVTETCMDEGQIAAV--CRECLQALEFLHSNGVIHRDIKSDNILLGMDGQVKLTDF--------GFCATITPEQNKRSTMVGTPYWMAPEVVTRKQYGPRVDVWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELAHPEKLSPVFKD---FLAQSLEMDVEKRSSARELLQ 473          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO45846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRL1])

HSP 1 Score: 113.235 bits (282), Expect = 1.270e-27
Identity = 85/255 (33.33%), Postives = 123/255 (48.24%), Query Frame = 2
Query:  863 KIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGKKLEKLENSVTPQMSKLLDL--------TKVPKEMVTFLEYMLDKDPKRRWTAEALLKLEMFRN 1603
            KIG G+ G V    +  TGR  AVK M + K     L  N         H  I++ YG+     +L++VME++  G+L D +       +    V   + +L+ L  LH  G+IHRD+K  +ILL     VKL+DFG    + + +       +L G+ Y+ APE+ +   YGT VDIWSLG  VL M+ G+     E  +   M KL DL         ++   + +FL+  L +DP  R TA  LL     RN
Sbjct:   34 KIGEGSTGIVCLATDKRTGRQVAVKKMDLKKQQRRELLFNEVVIMRDYPHPNIVEMYGSHLVGDELWVVMEFLEGGTLTDIVTHTNLSEEQVACV--CRAVLKALTFLHSQGVIHRDIKSDSILLTSNGTVKLSDFGFCAQVTEDMPRR---KSLVGTPYWMAPEVISRKPYGTEVDIWSLGIMVLEMVDGEPPYFNEPPLQ-AMRKLRDLEPPTSRNPIQISPRLQSFLDNALIRDPLYRATAFELLNHPFIRN 282          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101169290])

HSP 1 Score: 127.102 bits (318), Expect = 4.403e-30
Identity = 78/206 (37.86%), Postives = 117/206 (56.80%), Query Frame = 2
Query:  845 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITEDTK--LYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
             +  G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L+HERI++YYG + + ++  L I MEY+  GS++D++       +N    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  352 TWRRGKLLGQGAFGLVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEIQLLKN-LHHERIVQYYGCLRDHSEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 555          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:101160297])

HSP 1 Score: 126.331 bits (316), Expect = 8.102e-30
Identity = 80/202 (39.60%), Postives = 116/202 (57.43%), Query Frame = 2
Query:  857 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAI--TEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
            G  +G G FG VY   ++ TGR  AVK +  +  + E      +L+  I   +N L HERI++YYG +  T +  L I ME++  GS++D++       +N    RY++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  R L     S     ++ G+ Y+ +PE+ +G  YG   DIWS+G TV+ MLT +
Sbjct:  392 GKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPESPETSKEVSALECEIQLLKN-LCHERIVQYYGCLRDTMERTLSIFMEHMPGGSIKDQLKSYGALTENVTR-RYTRQILEGVSYLHSNMIVHRDIKGANILRDSVGNVKLGDFGASRRLQTICLSGTGIKSVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTQR 591          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 125.561 bits (314), Expect = 1.171e-29
Identity = 82/237 (34.60%), Postives = 126/237 (53.16%), Query Frame = 2
Query:  758 LRRLISSMGVTCKGDTCDHKFCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFIN--------KVNAESLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
            LR L  S   +C+  T      P + R+     G  +G G FG+VY   ++ TGR  A K +  +        +VNA  L+  I   +N L H+RI++YYG + +    KL I +E++  GS++D++       +     RY++QIL+G+ +LH N I+HRD+K  NIL D   NVKL DFG  + +     S     ++ G+ Y+ +PE+  G  YG   D+WS+  TV+ MLT K
Sbjct:  302 LRSLGRSADKSCQRGTAKSPRAPVNWRQ-----GKLLGRGAFGEVYLCYDADTGRELAAKQVPFDPDCQETSKEVNA--LECEIQLLKN-LRHDRIVQYYGCLRDLDQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTR-RYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTICMSGTGIKSVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQK 529          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 125.176 bits (313), Expect = 1.813e-29
Identity = 82/237 (34.60%), Postives = 126/237 (53.16%), Query Frame = 2
Query:  758 LRRLISSMGVTCKGDTCDHKFCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFIN--------KVNAESLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
            LR L  S   +C+  T      P + R+     G  +G G FG+VY   ++ TGR  A K +  +        +VNA  L+  I   +N L H+RI++YYG + +    KL I +E++  GS++D++       +     RY++QIL+G+ +LH N I+HRD+K  NIL D   NVKL DFG  + +     S     ++ G+ Y+ +PE+  G  YG   D+WS+  TV+ MLT K
Sbjct:  332 LRSLGRSADKSCQRGTAKSPRAPVNWRQ-----GKLLGRGAFGEVYLCYDADTGRELAAKQVPFDPDCQETSKEVNA--LECEIQLLKN-LRHDRIVQYYGCLRDLDQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTR-RYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTICMSGTGIKSVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQK 559          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 125.176 bits (313), Expect = 1.813e-29
Identity = 82/237 (34.60%), Postives = 126/237 (53.16%), Query Frame = 2
Query:  758 LRRLISSMGVTCKGDTCDHKFCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFIN--------KVNAESLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1438
            LR L  S   +C+  T      P + R+     G  +G G FG+VY   ++ TGR  A K +  +        +VNA  L+  I   +N L H+RI++YYG + +    KL I +E++  GS++D++       +     RY++QIL+G+ +LH N I+HRD+K  NIL D   NVKL DFG  + +     S     ++ G+ Y+ +PE+  G  YG   D+WS+  TV+ MLT K
Sbjct:  332 LRSLGRSADKSCQRGTAKSPRAPVNWRQ-----GKLLGRGAFGEVYLCYDADTGRELAAKQVPFDPDCQETSKEVNA--LECEIQLLKN-LRHDRIVQYYGCLRDLDQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTR-RYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTICMSGTGIKSVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQK 559          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017248.1 (SMESG000017248.1)

HSP 1 Score: 879.011 bits (2270), Expect = 0.000e+0
Identity = 446/492 (90.65%), Postives = 464/492 (94.31%), Query Frame = 2
Query:  131 MSEFQAFVDSIKLGNFESFVQLYKPEYLNKKDKQSWCAIHYACQFGHKEVLEKLISWNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDIEIKCLENSLMKCPNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLVHNCDIDALDKADQAPKDIARNNRNDELIKVLDEERSERPLRRLISSMGVTCKGDTCDHKFCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTG-KKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLKLEMFRN 1603
            MSEFQAFVD+IKLGN ESFVQLYKP+YLNKKDKQSWCAIHYACQFGHKEVLEKLISWNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDI+IKCLENSLMKCPNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLL   CDID  DKA  AP DIA++ +  +LIK+ +E   ERPLR+LISSMGV C  DTCDHK CPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEDKINKKKNDMKNDDIVRYSKQ+LEGLEHLHK GIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLT  + ++ L++ VTPQMS+LLD+ KVPKEMVTFLEYML KDPKRRWTAEALLKLEMFRN
Sbjct:    1 MSEFQAFVDAIKLGNLESFVQLYKPDYLNKKDKQSWCAIHYACQFGHKEVLEKLISWNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDIDIKCLENSLMKCPNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEENLPERPLRKLISSMGVKC-SDTCDHKLCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEDKINKKKNDMKNDDIVRYSKQVLEGLEHLHKIGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTDIENVKGLKDLVTPQMSELLDINKVPKEMVTFLEYMLVKDPKRRWTAEALLKLEMFRN 491          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017245.1 (SMESG000017245.1)

HSP 1 Score: 689.493 bits (1778), Expect = 0.000e+0
Identity = 361/501 (72.06%), Postives = 413/501 (82.44%), Query Frame = 2
Query:  131 MSEFQAFVDSIKLGNFESFVQLYKPEYLNKKDKQSWCAIHYACQFGHKEVLEKLISWNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDIEIKCLENSLMKC----PNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLVHNCDIDALDKADQAPKDIARNNRNDELIKVLDEERSERPLRRLISSMGVTCKGDTCDHKFCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXX----VRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTG--NQYGTPVDIWSLGATVLFMLTGKKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLKLEMFRN 1603
            M+EF++F++++KLGN ESF +LYKPEYLNKKD Q W AIHYAC    + +LE LIS NC+INQ GG++G+ PIQ+AC      IV +LT+AECDIE +   + ++K      +E I++ILK RKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLL HNCDIDALDKA+QAP+DIARNNRNDELIKVLDEERSERPLRRLISSMGVTCKGDTCDHKFC  +IR K F GG +IGHG++G VYKFQES T R+FAVKT+  +K N  S++ +IN FQ+ LNHERIIKYYGA+++ T+ YI+MEY +NGSL DK+NKKKNDMKND      VRYSKQILEGLEHLHK GIIHRDLKPGNILLDGEDNVKLADFGIGRVL++  G     M + G+  F A E+     N YG P DIWSLGATVLFML  + LEKL+NSVTPQMS+LLDLTKVPKEMVTFLEYML KDPKRRWTAEALLKLEMFRN
Sbjct:    1 MNEFESFLETVKLGNPESFEKLYKPEYLNKKDDQGWYAIHYACHEDQQAILENLISKNCNINQPGGQSGMRPIQVACYAEHDGIVEILTRAECDIEFEPERDPVIKIVEKYEDETIINILKARKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLAHNCDIDALDKANQAPEDIARNNRNDELIKVLDEERSERPLRRLISSMGVTCKGDTCDHKFCSKTIRNKSFNGGKEIGHGSYGTVYKFQESGTERMFAVKTITNSKAN--SIEADINKFQHRLNHERIIKYYGAVSDGTQQYIIMEYAINGSLADKMNKKKNDMKNDMKNDDIVRYSKQILEGLEHLHKIGIIHRDLKPGNILLDGEDNVKLADFGIGRVLERETGKDFT-MNM-GTPGFIAYEVQHKDENGYGPPADIWSLGATVLFMLDIENLEKLKNSVTPQMSELLDLTKVPKEMVTFLEYMLVKDPKRRWTAEALLKLEMFRN 497          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017248.1 (SMESG000017248.1)

HSP 1 Score: 598.971 bits (1543), Expect = 0.000e+0
Identity = 289/319 (90.60%), Postives = 299/319 (93.73%), Query Frame = 2
Query:  131 MSEFQAFVDSIKLGNFESFVQLYKPEYLNKKDKQSWCAIHYACQFGHKEVLEKLISWNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDIEIKCLENSLMKCPNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLVHNCDIDALDKADQAPKDIARNNRNDELIKVLDEERSERPLRRLISSMGVTCKGDTCDHKFCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVN 1087
            MSEFQAFVD+IKLGN ESFVQLYKP+YLNKKDKQSWCAIHYACQFGHKEVLEKLISWNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDI+IKCLENSLMKCPNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLL   CDID  DKA  AP DIA++ +  +LIK+ +E   ERPLR+LISSMGV C  DTCDHK CPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVN
Sbjct:    1 MSEFQAFVDAIKLGNLESFVQLYKPDYLNKKDKQSWCAIHYACQFGHKEVLEKLISWNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDIDIKCLENSLMKCPNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEENLPERPLRKLISSMGVKC-SDTCDHKLCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVN 318          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017252.1 (SMESG000017252.1)

HSP 1 Score: 483.411 bits (1243), Expect = 1.472e-168
Identity = 230/233 (98.71%), Postives = 232/233 (99.57%), Query Frame = 2
Query:  131 MSEFQAFVDSIKLGNFESFVQLYKPEYLNKKDKQSWCAIHYACQFGHKEVLEKLISWNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDIEIKCLENSLMKCPNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLVHNCDIDALDKADQAPKDIARNNRNDELIKVLDEERSERPLRRLISSMGVTCKGDTCDHKFCPT 829
            MSEFQAFVDSIKLGNFESFVQLYKPEYLNKKDKQSWCAIHYACQFGHKEVLEKLISWNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDIEIKCLENSLMKCPNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLL HNCDIDALDKA+QAP+DIARNNRNDELIKVLDEERSERPLRRLISSMGVTCKGDTCDHKFCPT
Sbjct:    1 MSEFQAFVDSIKLGNFESFVQLYKPEYLNKKDKQSWCAIHYACQFGHKEVLEKLISWNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDIEIKCLENSLMKCPNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLAHNCDIDALDKANQAPEDIARNNRNDELIKVLDEERSERPLRRLISSMGVTCKGDTCDHKFCPT 233          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017261.1 (SMESG000017261.1)

HSP 1 Score: 356.681 bits (914), Expect = 2.455e-114
Identity = 224/569 (39.37%), Postives = 307/569 (53.95%), Query Frame = 2
Query:  137 EFQAFVDSIKLGNFESFVQLYKPEYLNKKDKQSWCAIHYACQFGHKEVLEKLIS----------WN-----------------------CDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDIE-------------------------------IKCLENS-------LMKCPNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLVHNCDIDALDKADQAPKDIARNNRNDELIKVLDEERSERPLRRLISSMGVTCKGDTCDHKFCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEI----GTGNQYGTPVDIWSLGATVLFMLTGK-------KLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLKLEMF 1597
            EF+ F+++IK G+   F + +K EYL +KD   W  IH+AC  GH E+++ LI           WN                       CDI      N   PI  AC +G+++ V LL + +CDIE                               I+ L+ S        +K  NE+I+ IL G   L ACK GDL+ V + L    +EYCDKD RRPIHWA E G+ ++VK L+   CDI A DK++ +P DIA  N+N EL+++L  E     L + I  MG+ CK   C+H+ C TS+RKK F+ G++IG G FG VYK + S    +FAVK + + K+  + ++ NIN F   LNH+RIIKY+GAI  +  L I MEY+  GSLE    K+K  +  ++I+RYSKQILEGLE LH N IIHRD+KP NIL+   +N+K+ DFG+ R L +  G+     T  G+  FTAPE+      G  Y    DIWSLGATV+ M+TG+           ++     +   L D   + KEM  F+E MLD DP +R TA  LLKL++F
Sbjct:    4 EFKLFINAIKSGSAVLFRRYFKEEYLERKDADLWSPIHHACFAGHAEIVKLLIEHNCDIEALDKWNLRPIHYACYQGHSEAVKLLIEHKCDIEAFDWWNQR-PIHYACYQGRSEAVKLLIEHKCDIEAIDEWNQRPIHHACDQGHSEAVKLLIENKCDIEALDESGDSPMEIAVKSHNERIIHILNGPCLLRACKNGDLKKVSTYLNGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKSNLSPLDIAIKNQNKELVELLKAEE----LEQQILMMGLKCKS-FCNHRLCNTSLRKKTFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSGGSLE-DEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCGCHPYAVVKKIADTKKLDLPDSQSMSKEMKEFIEKMLDPDPDQRSTAAQLLKLKLF 565          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP3K32.645e-2938.12mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K32.744e-2938.12mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K32.744e-2938.12mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K32.844e-2938.12mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K32.934e-2938.12mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtk-11.169e-2936.82MTK1/MEKK4 homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
mtk-11.263e-2936.82MTK1/MEKK4 homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
mig-156.903e-2832.47Serine/threonine-protein kinase mig-15 [Source:Un... [more]
mig-156.972e-2832.47Serine/threonine-protein kinase mig-15 [Source:Un... [more]
mig-157.543e-2832.47Serine/threonine-protein kinase mig-15 [Source:Un... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msn1.293e-2834.72gene:FBgn0010909 transcript:FBtr0333364[more]
msn1.489e-2834.72gene:FBgn0010909 transcript:FBtr0333365[more]
msn1.489e-2834.72gene:FBgn0010909 transcript:FBtr0072957[more]
msn1.650e-2834.72gene:FBgn0010909 transcript:FBtr0072959[more]
msn1.650e-2834.72gene:FBgn0010909 transcript:FBtr0072958[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k31.528e-3137.86mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k31.847e-3137.86mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k32.198e-3137.86mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k27.221e-3038.61mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k27.270e-3038.61mitogen-activated protein kinase kinase kinase 2 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP3K21.815e-3038.61mitogen-activated protein kinase kinase kinase 2 [... [more]
MAP3K22.568e-3038.61mitogen-activated protein kinase kinase kinase 2 [... [more]
samd87.787e-3038.61sterile alpha motif domain containing 8 [Source:Xe... [more]
samd87.917e-3038.61sterile alpha motif domain containing 8 [Source:Xe... [more]
dennd1a2.271e-2934.10DENN domain containing 1A [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map3k21.440e-2938.61mitogen-activated protein kinase kinase kinase 2 [... [more]
Map3k31.793e-2938.12mitogen-activated protein kinase kinase kinase 3 [... [more]
Map4k24.597e-2832.43mitogen-activated protein kinase kinase kinase kin... [more]
Map4k24.597e-2832.43mitogen-activated protein kinase kinase kinase kin... [more]
Tnik1.131e-2732.36TRAF2 and NCK interacting kinase [Source:MGI Symbo... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CAD5|YODA_ARATH1.281e-3035.21Mitogen-activated protein kinase kinase kinase YOD... [more]
sp|Q54PX0|Y4251_DICDI2.443e-2933.98Probable serine/threonine-protein kinase DDB_G0284... [more]
sp|Q8T2I8|SEPA_DICDI2.717e-2934.96Serine/threonine-protein kinase sepA OS=Dictyostel... [more]
sp|Q7RZD3|STE20_NEUCR7.123e-2931.84Serine/threonine-protein kinase ste20 OS=Neurospor... [more]
sp|Q61084|M3K3_MOUSE1.254e-2838.12Mitogen-activated protein kinase kinase kinase 3 O... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJG26.060e-5230.54Slc42a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
K1PKP18.842e-3536.57Mitogen-activated protein kinase kinase kinase 2 O... [more]
A0A5B8MXT02.560e-3429.31Mitogen-activated protein kinase OS=Chloropicon pr... [more]
A0BQX01.628e-3337.89Protein kinase domain-containing protein OS=Parame... [more]
A0A0G4FXQ41.766e-3335.82Protein kinase domain-containing protein OS=Vitrel... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k32.572e-3137.86mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k32.572e-3137.86mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k32.572e-3137.86mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k26.233e-3039.00mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k227.378e-2937.68mitogen-activated protein kinase kinase kinase 3-l... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k22.153e-3037.56mitogen-activated protein kinase kinase kinase 2 [... [more]
cdk28.362e-2728.72cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
pak47.782e-2630.53p21 protein (Cdc42/Rac)-activated kinase 4 [Source... [more]
MAP4K31.192e-2530.74mitogen-activated protein kinase kinase kinase kin... [more]
MARK39.110e-2531.23microtubule affinity regulating kinase 3 [Source:H... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC156.840e-3039.47Protein kinase of the Mitotic Exit Network; locali... [more]
KIC16.229e-2933.46Protein kinase of the PAK/Ste20 family, required f... [more]
RAD531.482e-2529.72DNA damage response protein kinase; required for c... [more]
MKK26.102e-2529.66MAPKK involved in the protein kinase C signaling p... [more]
MKK15.753e-2428.63MAPKK involved in the protein kinase C signaling p... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO414104.163e-3636.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491389.645e-3032.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409614.688e-2930.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336671.160e-2733.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458461.270e-2733.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k34.403e-3037.86mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k28.102e-3039.60mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k221.171e-2934.60mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k221.813e-2934.60mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k221.813e-2934.60mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017248.10.000e+090.65SMESG000017248.1[more]
SMESG000017245.10.000e+072.06SMESG000017245.1[more]
SMESG000017248.10.000e+090.60SMESG000017248.1[more]
SMESG000017252.11.472e-16898.71SMESG000017252.1[more]
SMESG000017261.12.455e-11439.37SMESG000017261.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001962 ID=SMED30001962|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2160bp
TTATAATCAACATTTATTTTTACTTTTAAATTTCGGAAGTTGCGGAGTTT
TATCAAAATTCTAAAAATTCTTTCTGTTCAGATAAATTTTGATTTATTTC
CATCTTGTTTGATCTGAATCAGCGGATAAAATGAGCGAATTCCAAGCATT
TGTCGATTCCATCAAATTGGGAAATTTTGAATCATTTGTGCAACTTTACA
AACCCGAATATTTAAACAAAAAGGATAAGCAGTCATGGTGCGCAATCCAT
TATGCGTGCCAATTTGGCCACAAAGAGGTTTTAGAAAAGCTGATCAGTTG
GAATTGTGATATCAACCAAATGGGGGGACGGAACGGATTGCTTCCGATTC
AGCTTGCCTGCTCGGAAGGCCAGACGGATATAGTAGCACTATTGACGCAA
GCAGAGTGCGATATTGAAATAAAATGTCTGGAGAACTCGCTAATGAAATG
TCCGAATGAGAAAATTGTGGACATTCTCAAAGGGAGGAAATTCTTGCTTG
CTTGCAAAAAGGGCGACCTTGAAACGGTCCGTTCAATGCTTACAGATGTC
AACGTGGAATATTGTGACAAGGACAACAGACGGCCGATTCACTGGGCGGT
GGAGGGGGGCCACACGGAAATCGTCAAGTTACTGCTGGTGCATAATTGTG
ACATTGACGCACTAGATAAAGCGGACCAAGCTCCGAAGGACATTGCTAGA
AACAACAGAAATGATGAGCTCATCAAGGTTTTGGACGAAGAACGTTCAGA
ACGTCCACTAAGGAGATTGATTTCCAGCATGGGGGTGACATGCAAGGGTG
ACACATGCGACCATAAGTTCTGCCCTACATCAATCAGGAAAAAGGTATTT
GAGGGTGGAACAAAGATTGGACACGGAACATTTGGAGATGTATACAAATT
TCAAGAATCTGTGACTGGGAGGTTGTTTGCAGTAAAGACGATGTTTATAA
ATAAAGTTAATGCCGAAAGTTTAAAAGTCAACATTAATGCATTTCAAAAT
ATTCTGAATCATGAAAGAATCATCAAATATTACGGAGCGATCACTGAAGA
CACCAAGCTATATATCGTCATGGAGTATGTTGTCAATGGATCTCTTGAAG
ATAAAATTAATAAAAAGAAAAATGATATGAAAAATGATGATATTGTCCGG
TACAGCAAGCAGATCCTTGAAGGTCTGGAGCACCTGCATAAAAATGGCAT
CATCCATCGGGACTTGAAGCCGGGAAATATTTTGCTGGATGGAGAGGATA
ATGTAAAATTAGCAGACTTTGGCATTGGCAGAGTTTTAGACAAGGGGATT
GGCAGTACAATTATTCCTATGACATTAAAAGGCTCAGAGTACTTTACTGC
ACCTGAAATTGGAACGGGAAATCAATATGGAACCCCAGTTGACATTTGGT
CGCTTGGCGCCACTGTACTTTTTATGCTCACTGGTAAAAAGCTTGAAAAA
CTGGAAAATTCGGTGACCCCCCAAATGTCCAAATTGCTGGATTTGACTAA
AGTCCCAAAAGAAATGGTAACGTTTCTTGAATATATGCTGGATAAAGACC
CAAAACGCCGCTGGACCGCTGAGGCTTTATTGAAATTGGAAATGTTTAGA
AATTAAACTGAATTTATAATAAAAAAATCTATTAAAAAATACTTTATTTT
ACTTAACAGTAATTCAACCCCCCTCCCCCAGCCGTTGCCCCTTGAAAATA
ATATTGAAGCTGCGTTATGAGACCGCTCCCTTCAATAGCAGTAGCGCTTC
TGCTAGCTCCCCCGTTGCCTCTGGCACGGATAACACAAACCCAATTTTCC
GATTGCAAAACTTTATTCCAAAATTTGCTTGCACCAAAAATATTTAATTC
AATAAATAAATGAAATTTGTTTTAGTTTTATTGAACTGAAATATAATTTT
AAACAAAATTTTACGAGGTTTTCCCAAAATAAAATCTGCCCCATAGAAAG
ACAAAGAGCCGTGGCACAGACAGACCTAAAGTATTTCCGAGAAGTCGAAA
ACTGGAACTAATTGTTCTCCACATCTCAGGATCAATTGAAAAGTGCCAAA
TTTGAGAAATGCGCTACTTGGAGGCACATTAGTGTTGTAGCAAGTGAGAT
TATATGCCAAGGCCTTTCAGGAAAGAATGCCAGTTGATAATCATTGTGAT
TTATTTATCA
back to top

protein sequence of SMED30001962-orf-1

>SMED30001962-orf-1 ID=SMED30001962-orf-1|Name=SMED30001962-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=492bp
MSEFQAFVDSIKLGNFESFVQLYKPEYLNKKDKQSWCAIHYACQFGHKEV
LEKLISWNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDIEIKCL
ENSLMKCPNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNR
RPIHWAVEGGHTEIVKLLLVHNCDIDALDKADQAPKDIARNNRNDELIKV
LDEERSERPLRRLISSMGVTCKGDTCDHKFCPTSIRKKVFEGGTKIGHGT
FGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKY
YGAITEDTKLYIVMEYVVNGSLEDKINKKKNDMKNDDIVRYSKQILEGLE
HLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLK
GSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGKKLEKLENSVTPQMS
KLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLKLEMFRN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR000719Prot_kinase_dom
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 68..97
e-value: 0.23
score: 20.6
coord: 148..177
e-value: 0.0057
score: 25.9
coord: 34..63
e-value: 34.0
score: 13.3
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 148..180
score: 12.048
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 239..487
e-value: 4.3E-73
score: 258.8
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 241..486
e-value: 4.7E-58
score: 196.6
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 239..487
score: 44.683
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 2..120
e-value: 2.6E-17
score: 64.6
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 121..207
e-value: 1.9E-17
score: 65.3
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 7..203
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 10..98
e-value: 1.1E-8
score: 35.5
coord: 123..179
e-value: 5.1E-9
score: 36.6
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 28..201
score: 19.227
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 220..489
e-value: 4.9E-68
score: 231.1
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 101..447
e-value: 3.1E-42
score: 142.4
coord: 20..113
e-value: 4.2E-6
score: 23.3
NoneNo IPR availablePANTHERPTHR45832FAMILY NOT NAMEDcoord: 236..483
NoneNo IPR availablePANTHERPTHR45832:SF5coord: 236..483
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 356..368
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 245..268
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 237..489