Eukaryotic translation initiation factor 4 gamma 2

Overview
NameEukaryotic translation initiation factor 4 gamma 2
Smed IDSMED30001960
Length (bp)3697
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Eukaryotic translation initiation factor 4 gamma 2 (SMED30001960) t-SNE clustered cells

Violin plots show distribution of expression levels for Eukaryotic translation initiation factor 4 gamma 2 (SMED30001960) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Eukaryotic translation initiation factor 4 gamma 2 (SMED30001960) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Eukaryotic translation initiation factor 4 gamma 2 (SMED30001960) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001960

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30001960SMESG000061587.1 dd_Smed_v4_6383_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001960SMESG000061587.1 dd_Smed_v4_6383_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30001960SMESG000061587.1 dd_Smed_v4_6383_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30001960SMESG000061587.1 dd_Smed_v4_6383_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001960SMESG000061587.1 dd_Smed_v4_6383_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Human
Match: EIF4G2 (eukaryotic translation initiation factor 4 gamma 2 [Source:HGNC Symbol;Acc:HGNC:3297])

HSP 1 Score: 184.882 bits (468), Expect = 9.681e-50
Identity = 113/292 (38.70%), Postives = 168/292 (57.53%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNF-------EPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDVRE----------------KCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELI 1012
            K++   I RK+RGILNK+TPE FDKL L++LN+G+ES  ++  ++ L+  KA  EPK+++LY++LCLRL +D PNF       +P    STTFR  L+ K Q EFE       + D RE                K LGN++FI ELG+  L+ E ILH+C+K LL  + +      + D  E+             ECLCQ +  +G  +D  E+AK L+DQYF RM  L+ L+ E          LP+RIRF+++D ++LR+ +W+P+KA      + PK ++QIR++ +
Sbjct:   71 KERHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVESKLILKGVILLIVDKALEEPKYSSLYAQLCLRLAEDAPNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVDVYDKRENPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKKRV----QLKDMGED------------LECLCQIMRTVGPRLD-HERAKSLMDQYFARMCSLM-LSKE----------LPARIRFLLQDTVELREHHWVPRKA---FLDNGPKTINQIRQDAV 331          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Human
Match: EIF4G2 (eukaryotic translation initiation factor 4 gamma 2 [Source:HGNC Symbol;Acc:HGNC:3297])

HSP 1 Score: 183.341 bits (464), Expect = 1.570e-46
Identity = 113/292 (38.70%), Postives = 168/292 (57.53%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNF-------EPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDVRE----------------KCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELI 1012
            K++   I RK+RGILNK+TPE FDKL L++LN+G+ES  ++  ++ L+  KA  EPK+++LY++LCLRL +D PNF       +P    STTFR  L+ K Q EFE       + D RE                K LGN++FI ELG+  L+ E ILH+C+K LL  + +      + D  E+             ECLCQ +  +G  +D  E+AK L+DQYF RM  L+ L+ E          LP+RIRF+++D ++LR+ +W+P+KA      + PK ++QIR++ +
Sbjct:   71 KERHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVESKLILKGVILLIVDKALEEPKYSSLYAQLCLRLAEDAPNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVDVYDKRENPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKKRV----QLKDMGED------------LECLCQIMRTVGPRLD-HERAKSLMDQYFARMCSLM-LSKE----------LPARIRFLLQDTVELREHHWVPRKA---FLDNGPKTINQIRQDAV 331          

HSP 2 Score: 84.3445 bits (207), Expect = 9.579e-16
Identity = 64/220 (29.09%), Postives = 115/220 (52.27%), Query Frame = 2
Query: 2348 DSQLTNQLVKESGLSIYSTIPDEIKTNAD-IITLFLDPNLSYLVPEYALKQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIGS----EKQAMEFTVIWLLEFVLAQLFQSSD----SGKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYL 2980
            D +   +L ++S +++   +P EI  N D ++ +     LS+L P   L++ L +  K       SP +    +  WI +NI      +K  +   +   L+++ +++   SD    S   +K+ +E EK +  +  P+++ +L   +  + Q++ L  LQ     +  PKG+LLR F+ FYD+E+I E  +  WK D+ +  P KGKALF+VN+WL +L
Sbjct:  686 DREWLTELFQQSKVNMQKMLP-EIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQIK----LDPSPQT----IYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLH--DHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWL 894          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Human
Match: EIF4G2 (eukaryotic translation initiation factor 4 gamma 2 [Source:HGNC Symbol;Acc:HGNC:3297])

HSP 1 Score: 182.956 bits (463), Expect = 1.715e-46
Identity = 113/292 (38.70%), Postives = 168/292 (57.53%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNF-------EPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDVRE----------------KCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELI 1012
            K++   I RK+RGILNK+TPE FDKL L++LN+G+ES  ++  ++ L+  KA  EPK+++LY++LCLRL +D PNF       +P    STTFR  L+ K Q EFE       + D RE                K LGN++FI ELG+  L+ E ILH+C+K LL  + +      + D  E+             ECLCQ +  +G  +D  E+AK L+DQYF RM  L+ L+ E          LP+RIRF+++D ++LR+ +W+P+KA      + PK ++QIR++ +
Sbjct:   71 KERHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVESKLILKGVILLIVDKALEEPKYSSLYAQLCLRLAEDAPNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVDVYDKRENPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKKRV----QLKDMGED------------LECLCQIMRTVGPRLD-HERAKSLMDQYFARMCSLM-LSKE----------LPARIRFLLQDTVELREHHWVPRKA---FLDNGPKTINQIRQDAV 331          

HSP 2 Score: 84.3445 bits (207), Expect = 9.744e-16
Identity = 64/220 (29.09%), Postives = 115/220 (52.27%), Query Frame = 2
Query: 2348 DSQLTNQLVKESGLSIYSTIPDEIKTNAD-IITLFLDPNLSYLVPEYALKQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIGS----EKQAMEFTVIWLLEFVLAQLFQSSD----SGKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYL 2980
            D +   +L ++S +++   +P EI  N D ++ +     LS+L P   L++ L +  K       SP +    +  WI +NI      +K  +   +   L+++ +++   SD    S   +K+ +E EK +  +  P+++ +L   +  + Q++ L  LQ     +  PKG+LLR F+ FYD+E+I E  +  WK D+ +  P KGKALF+VN+WL +L
Sbjct:  686 DREWLTELFQQSKVNMQKMLP-EIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQIK----LDPSPQT----IYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLH--DHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWL 894          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Human
Match: EIF4G2 (eukaryotic translation initiation factor 4 gamma 2 [Source:HGNC Symbol;Acc:HGNC:3297])

HSP 1 Score: 182.956 bits (463), Expect = 1.715e-46
Identity = 113/292 (38.70%), Postives = 168/292 (57.53%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNF-------EPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDVRE----------------KCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELI 1012
            K++   I RK+RGILNK+TPE FDKL L++LN+G+ES  ++  ++ L+  KA  EPK+++LY++LCLRL +D PNF       +P    STTFR  L+ K Q EFE       + D RE                K LGN++FI ELG+  L+ E ILH+C+K LL  + +      + D  E+             ECLCQ +  +G  +D  E+AK L+DQYF RM  L+ L+ E          LP+RIRF+++D ++LR+ +W+P+KA      + PK ++QIR++ +
Sbjct:   71 KERHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVESKLILKGVILLIVDKALEEPKYSSLYAQLCLRLAEDAPNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVDVYDKRENPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKKRV----QLKDMGED------------LECLCQIMRTVGPRLD-HERAKSLMDQYFARMCSLM-LSKE----------LPARIRFLLQDTVELREHHWVPRKA---FLDNGPKTINQIRQDAV 331          

HSP 2 Score: 84.3445 bits (207), Expect = 9.744e-16
Identity = 64/220 (29.09%), Postives = 115/220 (52.27%), Query Frame = 2
Query: 2348 DSQLTNQLVKESGLSIYSTIPDEIKTNAD-IITLFLDPNLSYLVPEYALKQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIGS----EKQAMEFTVIWLLEFVLAQLFQSSD----SGKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYL 2980
            D +   +L ++S +++   +P EI  N D ++ +     LS+L P   L++ L +  K       SP +    +  WI +NI      +K  +   +   L+++ +++   SD    S   +K+ +E EK +  +  P+++ +L   +  + Q++ L  LQ     +  PKG+LLR F+ FYD+E+I E  +  WK D+ +  P KGKALF+VN+WL +L
Sbjct:  686 DREWLTELFQQSKVNMQKMLP-EIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQIK----LDPSPQT----IYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLH--DHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWL 894          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Human
Match: EIF4G2 (eukaryotic translation initiation factor 4 gamma 2 [Source:HGNC Symbol;Acc:HGNC:3297])

HSP 1 Score: 182.956 bits (463), Expect = 1.715e-46
Identity = 113/292 (38.70%), Postives = 168/292 (57.53%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNF-------EPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDVRE----------------KCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELI 1012
            K++   I RK+RGILNK+TPE FDKL L++LN+G+ES  ++  ++ L+  KA  EPK+++LY++LCLRL +D PNF       +P    STTFR  L+ K Q EFE       + D RE                K LGN++FI ELG+  L+ E ILH+C+K LL  + +      + D  E+             ECLCQ +  +G  +D  E+AK L+DQYF RM  L+ L+ E          LP+RIRF+++D ++LR+ +W+P+KA      + PK ++QIR++ +
Sbjct:   71 KERHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVESKLILKGVILLIVDKALEEPKYSSLYAQLCLRLAEDAPNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVDVYDKRENPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKKRV----QLKDMGED------------LECLCQIMRTVGPRLD-HERAKSLMDQYFARMCSLM-LSKE----------LPARIRFLLQDTVELREHHWVPRKA---FLDNGPKTINQIRQDAV 331          

HSP 2 Score: 84.3445 bits (207), Expect = 9.744e-16
Identity = 64/220 (29.09%), Postives = 115/220 (52.27%), Query Frame = 2
Query: 2348 DSQLTNQLVKESGLSIYSTIPDEIKTNAD-IITLFLDPNLSYLVPEYALKQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIGS----EKQAMEFTVIWLLEFVLAQLFQSSD----SGKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYL 2980
            D +   +L ++S +++   +P EI  N D ++ +     LS+L P   L++ L +  K       SP +    +  WI +NI      +K  +   +   L+++ +++   SD    S   +K+ +E EK +  +  P+++ +L   +  + Q++ L  LQ     +  PKG+LLR F+ FYD+E+I E  +  WK D+ +  P KGKALF+VN+WL +L
Sbjct:  686 DREWLTELFQQSKVNMQKMLP-EIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQIK----LDPSPQT----IYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLH--DHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWL 894          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Celegans
Match: ifg-1 (Initiation Factor 4G (eIF4G) family [Source:UniProtKB/TrEMBL;Acc:B5BM23])

HSP 1 Score: 92.0485 bits (227), Expect = 1.492e-18
Identity = 75/289 (25.95%), Postives = 137/289 (47.40%), Query Frame = 2
Query:  218 ILISRKIRGILNKVTPENFDKLSLDVLNIGIESS-AVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNS-TTFRNALLIKCQYEFE---------------------KNLPFC-YIDDVREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPL-IDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREEL 1009
            I + +K+R ++NKVTP +   L+ + ++  + S+ A ++ +V++++ KA  EPKF ALY+     +CK   N E S +   + FRN +L + Q  F+                     K L         R +  G + F+  L RN L+  KI+  C  +L          N+I D     +I +      +  C  Q +  +G  +DKS+ +  + +DQ+F++++               K Y  ++IRFM+ +L++LRK  WIP+K+ +      PK + +I +++
Sbjct:   93 IEVCKKVRSLMNKVTPTSQRPLTEEFISYNVSSNDAQLAQVVEIVFDKAVEEPKFCALYA----EMCKAQANHELSQTGGKSAFRNKVLTRTQMTFQDKKDIDADKLAIIEKEEDPVKKELMLAEEKQKFRRRKFGVMTFMGYLYRNQLLSTKIVQTCTFELF---------NSIKDQ----DIKKEDVDEESIHCGLQLIETVGVMLDKSKDSTTVFLDQWFQKLEAA-------------KPYCSNKIRFMIMNLMELRKDKWIPRKSTE----SGPKKIDEIHKDI 347          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Celegans
Match: ifg-1 (Initiation Factor 4G (eIF4G) family [Source:UniProtKB/TrEMBL;Acc:B5BM23])

HSP 1 Score: 90.5077 bits (223), Expect = 5.869e-18
Identity = 75/289 (25.95%), Postives = 137/289 (47.40%), Query Frame = 2
Query:  218 ILISRKIRGILNKVTPENFDKLSLDVLNIGIESS-AVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNS-TTFRNALLIKCQYEFE---------------------KNLPFC-YIDDVREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPL-IDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREEL 1009
            I + +K+R ++NKVTP +   L+ + ++  + S+ A ++ +V++++ KA  EPKF ALY+     +CK   N E S +   + FRN +L + Q  F+                     K L         R +  G + F+  L RN L+  KI+  C  +L          N+I D     +I +      +  C  Q +  +G  +DKS+ +  + +DQ+F++++               K Y  ++IRFM+ +L++LRK  WIP+K+ +      PK + +I +++
Sbjct:  514 IEVCKKVRSLMNKVTPTSQRPLTEEFISYNVSSNDAQLAQVVEIVFDKAVEEPKFCALYA----EMCKAQANHELSQTGGKSAFRNKVLTRTQMTFQDKKDIDADKLAIIEKEEDPVKKELMLAEEKQKFRRRKFGVMTFMGYLYRNQLLSTKIVQTCTFELF---------NSIKDQ----DIKKEDVDEESIHCGLQLIETVGVMLDKSKDSTTVFLDQWFQKLEAA-------------KPYCSNKIRFMIMNLMELRKDKWIPRKSTE----SGPKKIDEIHKDI 768          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Celegans
Match: ifg-1 (Initiation Factor 4G (eIF4G) family [Source:UniProtKB/TrEMBL;Acc:B5BM23])

HSP 1 Score: 90.5077 bits (223), Expect = 6.075e-18
Identity = 75/289 (25.95%), Postives = 137/289 (47.40%), Query Frame = 2
Query:  218 ILISRKIRGILNKVTPENFDKLSLDVLNIGIESS-AVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNS-TTFRNALLIKCQYEFE---------------------KNLPFC-YIDDVREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPL-IDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREEL 1009
            I + +K+R ++NKVTP +   L+ + ++  + S+ A ++ +V++++ KA  EPKF ALY+     +CK   N E S +   + FRN +L + Q  F+                     K L         R +  G + F+  L RN L+  KI+  C  +L          N+I D     +I +      +  C  Q +  +G  +DKS+ +  + +DQ+F++++               K Y  ++IRFM+ +L++LRK  WIP+K+ +      PK + +I +++
Sbjct:  515 IEVCKKVRSLMNKVTPTSQRPLTEEFISYNVSSNDAQLAQVVEIVFDKAVEEPKFCALYA----EMCKAQANHELSQTGGKSAFRNKVLTRTQMTFQDKKDIDADKLAIIEKEEDPVKKELMLAEEKQKFRRRKFGVMTFMGYLYRNQLLSTKIVQTCTFELF---------NSIKDQ----DIKKEDVDEESIHCGLQLIETVGVMLDKSKDSTTVFLDQWFQKLEAA-------------KPYCSNKIRFMIMNLMELRKDKWIPRKSTE----SGPKKIDEIHKDI 769          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Celegans
Match: ifg-1 (Initiation Factor 4G (eIF4G) family [Source:UniProtKB/TrEMBL;Acc:B5BM23])

HSP 1 Score: 90.1225 bits (222), Expect = 6.523e-18
Identity = 75/289 (25.95%), Postives = 137/289 (47.40%), Query Frame = 2
Query:  218 ILISRKIRGILNKVTPENFDKLSLDVLNIGIESS-AVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNS-TTFRNALLIKCQYEFE---------------------KNLPFC-YIDDVREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPL-IDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREEL 1009
            I + +K+R ++NKVTP +   L+ + ++  + S+ A ++ +V++++ KA  EPKF ALY+     +CK   N E S +   + FRN +L + Q  F+                     K L         R +  G + F+  L RN L+  KI+  C  +L          N+I D     +I +      +  C  Q +  +G  +DKS+ +  + +DQ+F++++               K Y  ++IRFM+ +L++LRK  WIP+K+ +      PK + +I +++
Sbjct:  401 IEVCKKVRSLMNKVTPTSQRPLTEEFISYNVSSNDAQLAQVVEIVFDKAVEEPKFCALYA----EMCKAQANHELSQTGGKSAFRNKVLTRTQMTFQDKKDIDADKLAIIEKEEDPVKKELMLAEEKQKFRRRKFGVMTFMGYLYRNQLLSTKIVQTCTFELF---------NSIKDQ----DIKKEDVDEESIHCGLQLIETVGVMLDKSKDSTTVFLDQWFQKLEAA-------------KPYCSNKIRFMIMNLMELRKDKWIPRKSTE----SGPKKIDEIHKDI 655          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Celegans
Match: ifg-1 (Initiation Factor 4G (eIF4G) family [Source:UniProtKB/TrEMBL;Acc:B5BM23])

HSP 1 Score: 90.1225 bits (222), Expect = 6.523e-18
Identity = 75/289 (25.95%), Postives = 137/289 (47.40%), Query Frame = 2
Query:  218 ILISRKIRGILNKVTPENFDKLSLDVLNIGIESS-AVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNS-TTFRNALLIKCQYEFE---------------------KNLPFC-YIDDVREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPL-IDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREEL 1009
            I + +K+R ++NKVTP +   L+ + ++  + S+ A ++ +V++++ KA  EPKF ALY+     +CK   N E S +   + FRN +L + Q  F+                     K L         R +  G + F+  L RN L+  KI+  C  +L          N+I D     +I +      +  C  Q +  +G  +DKS+ +  + +DQ+F++++               K Y  ++IRFM+ +L++LRK  WIP+K+ +      PK + +I +++
Sbjct:  401 IEVCKKVRSLMNKVTPTSQRPLTEEFISYNVSSNDAQLAQVVEIVFDKAVEEPKFCALYA----EMCKAQANHELSQTGGKSAFRNKVLTRTQMTFQDKKDIDADKLAIIEKEEDPVKKELMLAEEKQKFRRRKFGVMTFMGYLYRNQLLSTKIVQTCTFELF---------NSIKDQ----DIKKEDVDEESIHCGLQLIETVGVMLDKSKDSTTVFLDQWFQKLEAA-------------KPYCSNKIRFMIMNLMELRKDKWIPRKSTE----SGPKKIDEIHKDI 655          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Fly
Match: NAT1 (gene:FBgn0010488 transcript:FBtr0334772)

HSP 1 Score: 146.747 bits (369), Expect = 4.600e-35
Identity = 86/277 (31.05%), Postives = 156/277 (56.32%), Query Frame = 2
Query:  224 ISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNSTTFRNALLIKCQYEFEKNL----------PFCYIDD------VREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREE 1006
            + R++RGILNK+TPE F +LS ++L + + S A++  ++ L++ KA +EPK++++Y++LC RL ++ P+F+   SNS+TF   L+  C+ +F   L          P    D+       +++ LGN++FI EL +  ++ + +LH+C+ +L   + K              E+ +        ECL Q L   G  +D SE+ K L++QYF++++         +   +++Y  P RIRFM++D+++LR+ NW+P+K G     + P  + QIR +
Sbjct:  517 VFRRVRGILNKLTPEKFQELSDELLKLDLNSIAILKGVILLIFDKALDEPKYSSMYAQLCKRLSEEAPSFDKEPSNSSTFLRLLIAVCRDKFNNRLKRDENDNRPPPENEADEEERRHLAKQRMLGNVKFIGELNKLDMLSKNVLHQCIMELFDKKKKRTAGTQ--------EMCEDM------ECLAQLLKTCGKNLD-SEQGKELMNQYFEKLE---------RRSKSSEY--PPRIRFMLKDVIELRQNNWVPRKLG---TTEGPVPIKQIRSD 764          

HSP 2 Score: 65.0846 bits (157), Expect = 4.228e-10
Identity = 56/215 (26.05%), Postives = 99/215 (46.05%), Query Frame = 2
Query: 2375 KESGLSIYSTIPDEIKTNADIITLFLDPNLSYLVPEYALKQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIGSEK-------QAMEFTVIWLL--EFVLAQLFQSSDSGKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYLKNEE 2992
            + S + + +++P+  +    +  +  D  LS+L P   ++  +           S PN ++     WI  N+ ++        QA+   V+  +  E  LA      +     K + + E+ + +N S +++ +L  +   E QL  L  LQ F      PKG+L R F   Y+ E+I E  + LWK +++   P KG ALF+VN WL +L+  E
Sbjct: 1281 RASKVDLMNSLPEADRNKERLAGILEDRKLSFLYPLLKVQAEM------LKQLQSDPNPNN--FYKWIKANVDNKYYKDPGFIQALMTVVVKYVTKETTLADNLDPKE--HPEKSVTQKEQQLLENYSQMLQTFLGQN---ELQLMALYALQTFCYNENFPKGMLCRWFKYLYESEIIEEEAFVLWKEEISDKYPGKGSALFQVNAWLTWLQEAE 1482          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Fly
Match: eIF4G1 (gene:FBgn0023213 transcript:FBtr0289951)

HSP 1 Score: 119.783 bits (299), Expect = 1.063e-26
Identity = 86/297 (28.96%), Postives = 142/297 (47.81%), Query Frame = 2
Query:  230 RKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFE-----PSSSNSTTFRNALLIKCQYEFEKNLPFCY--------IDDVREKCL------------------------GNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDL-AIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREE 1006
            R++RGILNK+TPE FD L  +++ + I++   +  ++ L+++KA +EP F+  Y+RLC RL  ++   +      + SNS  FRNALL K + EF +N+            I D  +KC                         G +RFI EL +  ++  KI++ C+  LL+  S+ +                        ECLC+ LT +G+  +K+        + +   K +  + AI +KTD +    + SR+RFM++D++DLRK  W      Q    + PK + QI +E
Sbjct:  751 RRVRGILNKLTPERFDTLVEEIIKLKIDTPDKVDEVIVLVFEKAIDEPNFSVSYARLCQRLAAEVKVIDERMESETKSNSAHFRNALLDKTEQEFTQNVSQSTAKEKKLQPIVDKIKKCTDANEKAELEAFLEEEERKIRRRSGGTVRFIGELFKISMLTGKIIYSCIDTLLNPHSEDM-----------------------LECLCKLLTTVGAKFEKTPVNSKDPSRCYSLEKSITRMQAIASKTDKDGA-RVSSRVRFMLQDVIDLRKNKW------QTSRNEAPKTMGQIEKE 1017          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Fly
Match: eIF4G1 (gene:FBgn0023213 transcript:FBtr0089243)

HSP 1 Score: 119.783 bits (299), Expect = 1.063e-26
Identity = 86/297 (28.96%), Postives = 142/297 (47.81%), Query Frame = 2
Query:  230 RKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFE-----PSSSNSTTFRNALLIKCQYEFEKNLPFCY--------IDDVREKCL------------------------GNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDL-AIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREE 1006
            R++RGILNK+TPE FD L  +++ + I++   +  ++ L+++KA +EP F+  Y+RLC RL  ++   +      + SNS  FRNALL K + EF +N+            I D  +KC                         G +RFI EL +  ++  KI++ C+  LL+  S+ +                        ECLC+ LT +G+  +K+        + +   K +  + AI +KTD +    + SR+RFM++D++DLRK  W      Q    + PK + QI +E
Sbjct:  751 RRVRGILNKLTPERFDTLVEEIIKLKIDTPDKVDEVIVLVFEKAIDEPNFSVSYARLCQRLAAEVKVIDERMESETKSNSAHFRNALLDKTEQEFTQNVSQSTAKEKKLQPIVDKIKKCTDANEKAELEAFLEEEERKIRRRSGGTVRFIGELFKISMLTGKIIYSCIDTLLNPHSEDM-----------------------LECLCKLLTTVGAKFEKTPVNSKDPSRCYSLEKSITRMQAIASKTDKDGA-RVSSRVRFMLQDVIDLRKNKW------QTSRNEAPKTMGQIEKE 1017          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Fly
Match: eIF4G1 (gene:FBgn0023213 transcript:FBtr0112904)

HSP 1 Score: 119.013 bits (297), Expect = 1.922e-26
Identity = 94/335 (28.06%), Postives = 160/335 (47.76%), Query Frame = 2
Query:  116 LSDSQFSFDRNHLNKSICTATSNQNQLYISKDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFE-----PSSSNSTTFRNALLIKCQYEFEKNLP--------FCYIDDVREKCL------------------------GNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDL-AIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREE 1006
            LS+++ ++    LNKS   + +      + KD+   + R++RGILNK+TPE FD L  +++ + I++   +  ++ L+++KA +EP F+  Y+RLC RL  ++   +      + SNS  FRNALL K + EF +N+            I D  +KC                         G +RFI EL +  ++  KI++ C+  LL+  S+ +                        ECLC+ LT +G+  +K+        + +   K +  + AI +KTD +    + SR+RFM++D++DLRK  W      Q    + PK + QI +E
Sbjct:  972 LSENENAWRPRVLNKSDGDSDAKSA---LEKDE---LVRRVRGILNKLTPERFDTLVEEIIKLKIDTPDKVDEVIVLVFEKAIDEPNFSVSYARLCQRLAAEVKVIDERMESETKSNSAHFRNALLDKTEQEFTQNVSQSTAKEKKLQPIVDKIKKCTDANEKAELEAFLEEEERKIRRRSGGTVRFIGELFKISMLTGKIIYSCIDTLLNPHSEDM-----------------------LECLCKLLTTVGAKFEKTPVNSKDPSRCYSLEKSITRMQAIASKTDKDGA-RVSSRVRFMLQDVIDLRKNKW------QTSRNEAPKTMGQIEKE 1270          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Fly
Match: NAT1 (gene:FBgn0010488 transcript:FBtr0087786)

HSP 1 Score: 97.8265 bits (242), Expect = 3.510e-20
Identity = 64/224 (28.57%), Postives = 115/224 (51.34%), Query Frame = 2
Query:  386 LYSRLCLRLCKDIPNFEPSSSNSTTFRNALLIKCQYEFEKNL----------PFCYIDD------VREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSK-AIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREE 1006
            +Y++LC RL ++ P+F+   SNS+TF   L+  C+ +F   L          P    D+       +++ LGN++FI EL +  ++ + +LH+C+ +L   + K   G   + +                 ECL Q L   G  +D SE+ K L++QYF++++         +   +++Y  P RIRFM++D+++LR+ NW+P+K G     + P  + QIR +
Sbjct:    1 MYAQLCKRLSEEAPSFDKEPSNSSTFLRLLIAVCRDKFNNRLKRDENDNRPPPENEADEEERRHLAKQRMLGNVKFIGELNKLDMLSKNVLHQCIMELFDKKKKRTAGTQEMCED---------------MECLAQLLKTCGKNLD-SEQGKELMNQYFEKLE---------RRSKSSEY--PPRIRFMLKDVIELRQNNWVPRKLG---TTEGPVPIKQIRSD 194          

HSP 2 Score: 67.3958 bits (163), Expect = 8.198e-11
Identity = 56/215 (26.05%), Postives = 98/215 (45.58%), Query Frame = 2
Query: 2375 KESGLSIYSTIPDEIKTNADIITLFLDPNLSYLVPEYALKQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIGSEK-------QAMEFTVIWLL--EFVLAQLFQSSDSGKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYLKNEE 2992
            + S + + +++P+  +    +  +  D  LS+L P   ++  +           S PN ++     WI  N+ ++        QA+   V+  +  E  LA      +     K + + E+ + +N S +++ +L      E QL  L  LQ F      PKG+L R F   Y+ E+I E  + LWK +++   P KG ALF+VN WL +L+  E
Sbjct:  711 RASKVDLMNSLPEADRNKERLAGILEDRKLSFLYPLLKVQAEM------LKQLQSDPNPNN--FYKWIKANVDNKYYKDPGFIQALMTVVVKYVTKETTLADNLDPKEH--PEKSVTQKEQQLLENYSQMLQTFLG---QNELQLMALYALQTFCYNENFPKGMLCRWFKYLYESEIIEEEAFVLWKEEISDKYPGKGSALFQVNAWLTWLQEAE 912          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Zebrafish
Match: eif4g2b (eukaryotic translation initiation factor 4, gamma 2b [Source:ZFIN;Acc:ZDB-GENE-030131-6550])

HSP 1 Score: 186.037 bits (471), Expect = 1.016e-47
Identity = 117/293 (39.93%), Postives = 172/293 (58.70%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNF-------EPSSSNSTTFRNALLIKCQYEFE---KNL--------PFCYIDD-----VREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDE-PKLLSQIREELI 1012
            K+    I RK+RGILNK+TPE FDKL L++LN+G++S  V+  ++ L+  KA  EPK+++LY++LCLRL +D PNF       + S   STTFR  L+ K Q EFE   KN+        P    ++      + K LGN++FI ELG+  L+ E ILH+C+K LL  + +      + D  E+             ECLCQ +  +G  +D  EKAK L+DQYF RM+ L+          NNK  LP+RIRF+++D ++LR+ NW+P+KA     +D  PK ++QIR++ +
Sbjct:   36 KEHHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVDSKLVLKGIILLIVDKALEEPKYSSLYAQLCLRLAEDAPNFDGPTPEIQSSQKQSTTFRRLLITKLQDEFENRTKNVDLYDKQDNPLTSEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKKRV----QLKDMGED------------LECLCQIMRTVGPRLD-HEKAKSLMDQYFGRMQSLM----------NNK-DLPARIRFLLQDTVELRENNWVPRKAF----IDNGPKTINQIRQDAV 296          

HSP 2 Score: 86.2705 bits (212), Expect = 1.437e-16
Identity = 50/143 (34.97%), Postives = 81/143 (56.64%), Query Frame = 2
Query: 2573 WILENIGS----EKQAMEFTVIWLLEFVLAQL-FQSSDSGKS--TKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYL 2980
            WI +NI      +K  +   V   L+++ A+L     D   S  +K+ ++ EK +  +  P+++ +L    +   Q++ L  LQ   N N  PKG+LLR F+ FYD+E+I E  +  WK D+++  P KGKALF+VN+WL +L
Sbjct:  715 WIKDNISPKLHIDKGFINILVTSFLQYIFAELGVPECDEQLSFPSKEQLDQEKQLLHSFKPVMQKFLHEHTNL--QVSALYALQVHCNANAFPKGMLLRYFVHFYDMEIIEEEAFLAWKEDISQEFPGKGKALFQVNQWLTWL 855          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Zebrafish
Match: eif4g2b (eukaryotic translation initiation factor 4, gamma 2b [Source:ZFIN;Acc:ZDB-GENE-030131-6550])

HSP 1 Score: 186.037 bits (471), Expect = 1.089e-47
Identity = 116/292 (39.73%), Postives = 171/292 (58.56%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNF-------EPSSSNSTTFRNALLIKCQYEFE---KNL--------PFCYIDD-----VREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELI 1012
            K+    I RK+RGILNK+TPE FDKL L++LN+G++S  V+  ++ L+  KA  EPK+++LY++LCLRL +D PNF       + S   STTFR  L+ K Q EFE   KN+        P    ++      + K LGN++FI ELG+  L+ E ILH+C+K LL  + +      + D  E+             ECLCQ +  +G  +D  EKAK L+DQYF RM+ L+          NNK  LP+RIRF+++D ++LR+ NW+P+KA      + PK ++QIR++ +
Sbjct:   66 KEHHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVDSKLVLKGIILLIVDKALEEPKYSSLYAQLCLRLAEDAPNFDGPTPEIQSSQKQSTTFRRLLITKLQDEFENRTKNVDLYDKQDNPLTSEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKKRV----QLKDMGED------------LECLCQIMRTVGPRLD-HEKAKSLMDQYFGRMQSLM----------NNK-DLPARIRFLLQDTVELRENNWVPRKA---FIDNGPKTINQIRQDAV 326          

HSP 2 Score: 86.6557 bits (213), Expect = 1.387e-16
Identity = 50/143 (34.97%), Postives = 80/143 (55.94%), Query Frame = 2
Query: 2573 WILENIGS----EKQAMEFTVIWLLEFVLAQL-FQSSDSGKS--TKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYL 2980
            WI +NI      +K  +   V   L+++ A+L     D   S  +K+ ++ EK +  +  P+++ +L        Q++ L  LQ   N N  PKG+LLR F+ FYD+E+I E  +  WK D+++  P KGKALF+VN+WL +L
Sbjct:  745 WIKDNISPKLHIDKGFINILVTSFLQYIFAELGVPECDEQLSFPSKEQLDQEKQLLHSFKPVMQKFLH--EHTNLQVSALYALQVHCNANAFPKGMLLRYFVHFYDMEIIEEEAFLAWKEDISQEFPGKGKALFQVNQWLTWL 885          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Zebrafish
Match: eif4g2a (eukaryotic translation initiation factor 4, gamma 2a [Source:ZFIN;Acc:ZDB-GENE-030131-2173])

HSP 1 Score: 186.037 bits (471), Expect = 1.212e-47
Identity = 116/293 (39.59%), Postives = 170/293 (58.02%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSS-------NSTTFRNALLIKCQYEFEKNLPFCYIDD----------------VREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDE-PKLLSQIREELI 1012
            K++   I RK+RGILNK+TPE FDKL L++LN+G++S  V+  ++ L+  KA  EPK+++LY++LCLRL +D PNF+  S+        STTFR  L+ K Q EFE       I D                 + K LGN++FI ELG+  L+ E ILH+C+K LL  + +      + D  E+             ECLCQ +  +G  +D  EKAK L+DQYF RM+ L+          NNK  LP+RIRF+++D ++LR+ NW+P+KA     +D  PK ++QIR++ +
Sbjct:   66 KERHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVDSKLVLKGIILLIVDKALEEPKYSSLYAQLCLRLAEDAPNFDGPSTEIQSSQKQSTTFRRLLISKLQDEFENRTRNVDIYDKNDSPLTSEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKKRV----QLKDMGED------------LECLCQIMRTVGPRLD-HEKAKSLMDQYFGRMRSLM----------NNK-DLPARIRFLLQDTVELRENNWVPRKAF----IDNGPKTINQIRQDAV 326          

HSP 2 Score: 93.5893 bits (231), Expect = 8.271e-19
Identity = 64/220 (29.09%), Postives = 114/220 (51.82%), Query Frame = 2
Query: 2348 DSQLTNQLVKESGLSIYSTIPDEIKTNAD-IITLFLDPNLSYLVPEYAL-KQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIG----SEKQAMEFTVIWLLEFVLAQLFQSSDS---GKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYL 2980
            D +    L ++S +++   +P EI  N D ++ +     LS+L P   L K+ L QI        + P   +  +  WI +NI     +++  +   +   L+++  +++ + D       TK+ ++ EK +     P+++ +L   +  E Q++ L  LQ   N +  PKG+LLR F+ FYD+E+I E  +  WK D+ +  P KGKALF+VN+WL +L
Sbjct:  671 DREWLTDLFQQSKVNMQKMLP-EIDQNKDRMLEILEGKGLSFLFPLMKLEKELLKQI-------KADPAPQT--IYKWIKDNISPKLHTDRGFVNILMTSFLQYIFHEMYATDDEEQLSAPTKEQLDQEKQLLLAFKPVMQKFLH--DHVELQVSALYALQVHCNAHAFPKGMLLRYFVNFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLMWL 878          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Zebrafish
Match: eif4g2b (eukaryotic translation initiation factor 4, gamma 2b [Source:ZFIN;Acc:ZDB-GENE-030131-6550])

HSP 1 Score: 185.652 bits (470), Expect = 1.359e-47
Identity = 117/293 (39.93%), Postives = 172/293 (58.70%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNF-------EPSSSNSTTFRNALLIKCQYEFE---KNL--------PFCYIDD-----VREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDE-PKLLSQIREELI 1012
            K+    I RK+RGILNK+TPE FDKL L++LN+G++S  V+  ++ L+  KA  EPK+++LY++LCLRL +D PNF       + S   STTFR  L+ K Q EFE   KN+        P    ++      + K LGN++FI ELG+  L+ E ILH+C+K LL  + +      + D  E+             ECLCQ +  +G  +D  EKAK L+DQYF RM+ L+          NNK  LP+RIRF+++D ++LR+ NW+P+KA     +D  PK ++QIR++ +
Sbjct:   56 KEHHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVDSKLVLKGIILLIVDKALEEPKYSSLYAQLCLRLAEDAPNFDGPTPEIQSSQKQSTTFRRLLITKLQDEFENRTKNVDLYDKQDNPLTSEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKKRV----QLKDMGED------------LECLCQIMRTVGPRLD-HEKAKSLMDQYFGRMQSLM----------NNK-DLPARIRFLLQDTVELRENNWVPRKAF----IDNGPKTINQIRQDAV 316          

HSP 2 Score: 86.6557 bits (213), Expect = 1.285e-16
Identity = 50/143 (34.97%), Postives = 80/143 (55.94%), Query Frame = 2
Query: 2573 WILENIGS----EKQAMEFTVIWLLEFVLAQL-FQSSDSGKS--TKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYL 2980
            WI +NI      +K  +   V   L+++ A+L     D   S  +K+ ++ EK +  +  P+++ +L        Q++ L  LQ   N N  PKG+LLR F+ FYD+E+I E  +  WK D+++  P KGKALF+VN+WL +L
Sbjct:  735 WIKDNISPKLHIDKGFINILVTSFLQYIFAELGVPECDEQLSFPSKEQLDQEKQLLHSFKPVMQKFLH--EHTNLQVSALYALQVHCNANAFPKGMLLRYFVHFYDMEIIEEEAFLAWKEDISQEFPGKGKALFQVNQWLTWL 875          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Zebrafish
Match: eif4g3b (eukaryotic translation initiation factor 4 gamma, 3b [Source:ZFIN;Acc:ZDB-GENE-090312-49])

HSP 1 Score: 137.887 bits (346), Expect = 3.200e-32
Identity = 93/295 (31.53%), Postives = 146/295 (49.49%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNSTTFRNALLIKCQYEFEKN----------------------------LPFCYIDDVREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREE 1006
            + QE+   RK+R ILNK+TP+ F +L   V ++ I++   +  ++DL+++KA NEP F+  Y  +C  L           +++  FR  LL +CQ EFEK+                                  D  R + +GN++FI EL +  ++ E I+H+CV +LL             +H E            + ECLC+ LT IG  +D  EKAKP +DQYF +M++++    E KT         SRIRFM++D++DLR  NW+ ++A Q      PK + QI ++
Sbjct:  865 RTQELF--RKVRSILNKLTPQMFSQLMKQVTDLTIDTEERLKGVIDLVFEKAINEPSFSVAYGNMCSCLATLKVPMTDKPNSTVNFRKLLLNRCQKEFEKDKMDDDAFEKKHRELEAATASSERERLQEELEEAKDKARRRSIGNIKFIGELFKLRMLTEAIMHDCVVKLLK------------NHDEE-----------SLECLCRLLTTIGKDLD-FEKAKPRMDQYFNQMEKIVK---ERKTS--------SRIRFMLQDVIDLRLHNWVSRRADQ-----GPKTIEQIHKD 1117          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Xenopus
Match: safb (scaffold attachment factor B [Source:Xenbase;Acc:XB-GENE-5873119])

HSP 1 Score: 180.644 bits (457), Expect = 5.636e-46
Identity = 116/315 (36.83%), Postives = 174/315 (55.24%), Query Frame = 2
Query:  140 DRNHLNKSICTATSNQNQLYISKDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNF-------EPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDVRE----------------KCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDE-PKLLSQIREELI 1012
            D N  N S  TA S+       K++   I RK+RGILNK+ PE FDKL L++LN+G+++  ++  ++ L+  KA  EPK+++LY++LCLRL ++ PNF       +P    STTFR  L+ K Q EFE       + D R+                K LGN++FI ELG+  L+ E ILH C+K LL  + +      + D  E+             ECLCQ +  +G  +D  EKAK L+DQYF RM      A++A  +      LP+RIRF+++D ++LR+  W+P+KA     +D  PK ++QIR++ +
Sbjct:    8 DVNSTNNSANTAISSSE-----KERHDAIFRKVRGILNKLAPEKFDKLCLELLNVGVDTKLILKGVILLIVDKALEEPKYSSLYAQLCLRLAEEAPNFDGPSTDGQPGQKQSTTFRRLLISKLQDEFENRSRNVELYDKRDSPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHRCIKALLEKKKRV----QLKDMGED------------LECLCQIMRTVGPRLD-HEKAKSLMDQYFARM-----CALKANKE------LPARIRFLLQDTMELRENTWVPRKA----FIDNGPKTITQIRQDAV 285          

HSP 2 Score: 76.2554 bits (186), Expect = 2.409e-13
Identity = 61/214 (28.50%), Postives = 105/214 (49.07%), Query Frame = 2
Query: 2348 DSQLTNQLVKESGLSIYSTIPDEIKTNAD-IITLFLDPNLSYLVPEYAL-KQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIGS----EKQAMEFTVIWLLEFV---LAQLFQSSDSGKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVN 2962
            D +    L ++S +++   +P EI  N D ++ +     LS+L P   L K+ L QI         SP +    +  WI +NI      +K  +   +   L+++      + +S  S   +K+ +E EK +     P+++ +L   +  + Q++ L  LQ    +   PKG+LLR F+ FYD+E+I E  +  WK D+ +  P KGKALF+V 
Sbjct:  629 DREWLTDLFQQSKINMQKMLP-EIDQNKDRMLEILEGKGLSFLFPLMKLEKELLKQI-----KMDPSPQT----IYKWIKDNISPKLHLDKGFVNILMTSFLQYISNEACPMEESDLSAAPSKEQLEQEKQLLLAFKPVMQKFLH--DHVDLQVSALYALQVHCCSKNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVQ 830          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Xenopus
Match: safb (scaffold attachment factor B [Source:Xenbase;Acc:XB-GENE-5873119])

HSP 1 Score: 181.03 bits (458), Expect = 6.010e-46
Identity = 115/314 (36.62%), Postives = 173/314 (55.10%), Query Frame = 2
Query:  140 DRNHLNKSICTATSNQNQLYISKDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNF-------EPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDVRE----------------KCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELI 1012
            D N  N S  TA S+       K++   I RK+RGILNK+ PE FDKL L++LN+G+++  ++  ++ L+  KA  EPK+++LY++LCLRL ++ PNF       +P    STTFR  L+ K Q EFE       + D R+                K LGN++FI ELG+  L+ E ILH C+K LL  + +      + D  E+             ECLCQ +  +G  +D  EKAK L+DQYF RM      A++A  +      LP+RIRF+++D ++LR+  W+P+KA      + PK ++QIR++ +
Sbjct:   50 DVNSTNNSANTAISSSE-----KERHDAIFRKVRGILNKLAPEKFDKLCLELLNVGVDTKLILKGVILLIVDKALEEPKYSSLYAQLCLRLAEEAPNFDGPSTDGQPGQKQSTTFRRLLISKLQDEFENRSRNVELYDKRDSPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHRCIKALLEKKKRV----QLKDMGED------------LECLCQIMRTVGPRLD-HEKAKSLMDQYFARM-----CALKANKE------LPARIRFLLQDTMELRENTWVPRKA---FIDNGPKTITQIRQDAV 327          

HSP 2 Score: 76.2554 bits (186), Expect = 2.781e-13
Identity = 61/214 (28.50%), Postives = 105/214 (49.07%), Query Frame = 2
Query: 2348 DSQLTNQLVKESGLSIYSTIPDEIKTNAD-IITLFLDPNLSYLVPEYAL-KQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIGS----EKQAMEFTVIWLLEFV---LAQLFQSSDSGKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVN 2962
            D +    L ++S +++   +P EI  N D ++ +     LS+L P   L K+ L QI         SP +    +  WI +NI      +K  +   +   L+++      + +S  S   +K+ +E EK +     P+++ +L   +  + Q++ L  LQ    +   PKG+LLR F+ FYD+E+I E  +  WK D+ +  P KGKALF+V 
Sbjct:  663 DREWLTDLFQQSKINMQKMLP-EIDQNKDRMLEILEGKGLSFLFPLMKLEKELLKQI-----KMDPSPQT----IYKWIKDNISPKLHLDKGFVNILMTSFLQYISNEACPMEESDLSAAPSKEQLEQEKQLLLAFKPVMQKFLH--DHVDLQVSALYALQVHCCSKNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVQ 864          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Xenopus
Match: safb (scaffold attachment factor B [Source:Xenbase;Acc:XB-GENE-5873119])

HSP 1 Score: 181.03 bits (458), Expect = 6.554e-46
Identity = 115/314 (36.62%), Postives = 173/314 (55.10%), Query Frame = 2
Query:  140 DRNHLNKSICTATSNQNQLYISKDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNF-------EPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDVRE----------------KCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELI 1012
            D N  N S  TA S+       K++   I RK+RGILNK+ PE FDKL L++LN+G+++  ++  ++ L+  KA  EPK+++LY++LCLRL ++ PNF       +P    STTFR  L+ K Q EFE       + D R+                K LGN++FI ELG+  L+ E ILH C+K LL  + +      + D  E+             ECLCQ +  +G  +D  EKAK L+DQYF RM      A++A  +      LP+RIRF+++D ++LR+  W+P+KA      + PK ++QIR++ +
Sbjct:   50 DVNSTNNSANTAISSSE-----KERHDAIFRKVRGILNKLAPEKFDKLCLELLNVGVDTKLILKGVILLIVDKALEEPKYSSLYAQLCLRLAEEAPNFDGPSTDGQPGQKQSTTFRRLLISKLQDEFENRSRNVELYDKRDSPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHRCIKALLEKKKRV----QLKDMGED------------LECLCQIMRTVGPRLD-HEKAKSLMDQYFARM-----CALKANKE------LPARIRFLLQDTMELRENTWVPRKA---FIDNGPKTITQIRQDAV 327          

HSP 2 Score: 85.5001 bits (210), Expect = 3.635e-16
Identity = 65/220 (29.55%), Postives = 111/220 (50.45%), Query Frame = 2
Query: 2348 DSQLTNQLVKESGLSIYSTIPDEIKTNAD-IITLFLDPNLSYLVPEYAL-KQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIGS----EKQAMEFTVIWLLEFV---LAQLFQSSDSGKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYL 2980
            D +    L ++S +++   +P EI  N D ++ +     LS+L P   L K+ L QI         SP +    +  WI +NI      +K  +   +   L+++      + +S  S   +K+ +E EK +     P+++ +L   +  + Q++ L  LQ    +   PKG+LLR F+ FYD+E+I E  +  WK D+ +  P KGKALF+VN+WL +L
Sbjct:  673 DREWLTDLFQQSKINMQKMLP-EIDQNKDRMLEILEGKGLSFLFPLMKLEKELLKQI-----KMDPSPQT----IYKWIKDNISPKLHLDKGFVNILMTSFLQYISNEACPMEESDLSAAPSKEQLEQEKQLLLAFKPVMQKFLH--DHVDLQVSALYALQVHCCSKNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWL 880          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Xenopus
Match: safb (scaffold attachment factor B [Source:Xenbase;Acc:XB-GENE-5873119])

HSP 1 Score: 180.259 bits (456), Expect = 6.706e-46
Identity = 116/315 (36.83%), Postives = 174/315 (55.24%), Query Frame = 2
Query:  140 DRNHLNKSICTATSNQNQLYISKDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNF-------EPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDVRE----------------KCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDE-PKLLSQIREELI 1012
            D N  N S  TA S+       K++   I RK+RGILNK+ PE FDKL L++LN+G+++  ++  ++ L+  KA  EPK+++LY++LCLRL ++ PNF       +P    STTFR  L+ K Q EFE       + D R+                K LGN++FI ELG+  L+ E ILH C+K LL  + +      + D  E+             ECLCQ +  +G  +D  EKAK L+DQYF RM      A++A  +      LP+RIRF+++D ++LR+  W+P+KA     +D  PK ++QIR++ +
Sbjct:    8 DVNSTNNSANTAISSSE-----KERHDAIFRKVRGILNKLAPEKFDKLCLELLNVGVDTKLILKGVILLIVDKALEEPKYSSLYAQLCLRLAEEAPNFDGPSTDGQPGQKQSTTFRRLLISKLQDEFENRSRNVELYDKRDSPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHRCIKALLEKKKRV----QLKDMGED------------LECLCQIMRTVGPRLD-HEKAKSLMDQYFARM-----CALKANKE------LPARIRFLLQDTMELRENTWVPRKA----FIDNGPKTITQIRQDAV 285          

HSP 2 Score: 76.2554 bits (186), Expect = 2.527e-13
Identity = 61/214 (28.50%), Postives = 105/214 (49.07%), Query Frame = 2
Query: 2348 DSQLTNQLVKESGLSIYSTIPDEIKTNAD-IITLFLDPNLSYLVPEYAL-KQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIGS----EKQAMEFTVIWLLEFV---LAQLFQSSDSGKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVN 2962
            D +    L ++S +++   +P EI  N D ++ +     LS+L P   L K+ L QI         SP +    +  WI +NI      +K  +   +   L+++      + +S  S   +K+ +E EK +     P+++ +L   +  + Q++ L  LQ    +   PKG+LLR F+ FYD+E+I E  +  WK D+ +  P KGKALF+V 
Sbjct:  593 DREWLTDLFQQSKINMQKMLP-EIDQNKDRMLEILEGKGLSFLFPLMKLEKELLKQI-----KMDPSPQT----IYKWIKDNISPKLHLDKGFVNILMTSFLQYISNEACPMEESDLSAAPSKEQLEQEKQLLLAFKPVMQKFLH--DHVDLQVSALYALQVHCCSKNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVQ 794          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Xenopus
Match: safb (scaffold attachment factor B [Source:Xenbase;Acc:XB-GENE-5873119])

HSP 1 Score: 180.644 bits (457), Expect = 7.412e-46
Identity = 115/314 (36.62%), Postives = 173/314 (55.10%), Query Frame = 2
Query:  140 DRNHLNKSICTATSNQNQLYISKDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNF-------EPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDVRE----------------KCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELI 1012
            D N  N S  TA S+       K++   I RK+RGILNK+ PE FDKL L++LN+G+++  ++  ++ L+  KA  EPK+++LY++LCLRL ++ PNF       +P    STTFR  L+ K Q EFE       + D R+                K LGN++FI ELG+  L+ E ILH C+K LL  + +      + D  E+             ECLCQ +  +G  +D  EKAK L+DQYF RM      A++A  +      LP+RIRF+++D ++LR+  W+P+KA      + PK ++QIR++ +
Sbjct:   50 DVNSTNNSANTAISSSE-----KERHDAIFRKVRGILNKLAPEKFDKLCLELLNVGVDTKLILKGVILLIVDKALEEPKYSSLYAQLCLRLAEEAPNFDGPSTDGQPGQKQSTTFRRLLISKLQDEFENRSRNVELYDKRDSPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHRCIKALLEKKKRV----QLKDMGED------------LECLCQIMRTVGPRLD-HEKAKSLMDQYFARM-----CALKANKE------LPARIRFLLQDTMELRENTWVPRKA---FIDNGPKTITQIRQDAV 327          

HSP 2 Score: 76.2554 bits (186), Expect = 2.917e-13
Identity = 61/214 (28.50%), Postives = 105/214 (49.07%), Query Frame = 2
Query: 2348 DSQLTNQLVKESGLSIYSTIPDEIKTNAD-IITLFLDPNLSYLVPEYAL-KQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIGS----EKQAMEFTVIWLLEFV---LAQLFQSSDSGKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVN 2962
            D +    L ++S +++   +P EI  N D ++ +     LS+L P   L K+ L QI         SP +    +  WI +NI      +K  +   +   L+++      + +S  S   +K+ +E EK +     P+++ +L   +  + Q++ L  LQ    +   PKG+LLR F+ FYD+E+I E  +  WK D+ +  P KGKALF+V 
Sbjct:  671 DREWLTDLFQQSKINMQKMLP-EIDQNKDRMLEILEGKGLSFLFPLMKLEKELLKQI-----KMDPSPQT----IYKWIKDNISPKLHLDKGFVNILMTSFLQYISNEACPMEESDLSAAPSKEQLEQEKQLLLAFKPVMQKFLH--DHVDLQVSALYALQVHCCSKNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVQ 872          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Mouse
Match: Eif4g2 (eukaryotic translation initiation factor 4, gamma 2 [Source:MGI Symbol;Acc:MGI:109207])

HSP 1 Score: 184.111 bits (466), Expect = 4.578e-47
Identity = 117/307 (38.11%), Postives = 172/307 (56.03%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNF-------EPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDVRE----------------KCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELI--------APEGDGR 1033
            K++   I RK+RGILNK+TPE FDKL L++LN+G+ES  ++  ++ L+  KA  EPK+++LY++LCLRL +D PNF       +P    STTFR  L+ K Q EFE       + D RE                K LGN++FI ELG+  L+ E ILH+C+K LL  + +      + D  E+             ECLCQ +  +G  +D  E+AK L+DQYF RM  L+ L+ E          LP+RIRF+++D ++LR+ +W+P+KA      + PK ++QIR++ +        AP   GR
Sbjct:   71 KERHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVESKLILKGVILLIVDKALEEPKYSSLYAQLCLRLAEDAPNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVDVYDKRENPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKKRV----QLKDMGED------------LECLCQIMRTVGPRLD-HERAKSLMDQYFARMCSLM-LSKE----------LPARIRFLLQDTVELREHHWVPRKA---FLDNGPKTINQIRQDAVKDLGVFIPAPMAQGR 346          

HSP 2 Score: 85.5001 bits (210), Expect = 3.368e-16
Identity = 64/220 (29.09%), Postives = 115/220 (52.27%), Query Frame = 2
Query: 2348 DSQLTNQLVKESGLSIYSTIPDEIKTNAD-IITLFLDPNLSYLVPEYALKQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIGS----EKQAMEFTVIWLLEFVLAQLFQSSD----SGKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYL 2980
            D +   +L ++S +++   +P EI  N D ++ +     LS+L P   L++ L +  K       SP +    +  WI +NI      +K  +   +   L+++ +++   SD    S   +K+ +E EK +  +  P+++ +L   +  + Q++ L  LQ     +  PKG+LLR F+ FYD+E+I E  +  WK D+ +  P KGKALF+VN+WL +L
Sbjct:  647 DREWLTELFQQSKVNMQKMLP-EIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQIK----LDPSPQT----IYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVSPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLH--DHVDLQVSALYALQVHCYNSSFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWL 855          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Mouse
Match: Eif4g2 (eukaryotic translation initiation factor 4, gamma 2 [Source:MGI Symbol;Acc:MGI:109207])

HSP 1 Score: 184.496 bits (467), Expect = 4.677e-47
Identity = 117/307 (38.11%), Postives = 172/307 (56.03%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNF-------EPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDVRE----------------KCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELI--------APEGDGR 1033
            K++   I RK+RGILNK+TPE FDKL L++LN+G+ES  ++  ++ L+  KA  EPK+++LY++LCLRL +D PNF       +P    STTFR  L+ K Q EFE       + D RE                K LGN++FI ELG+  L+ E ILH+C+K LL  + +      + D  E+             ECLCQ +  +G  +D  E+AK L+DQYF RM  L+ L+ E          LP+RIRF+++D ++LR+ +W+P+KA      + PK ++QIR++ +        AP   GR
Sbjct:   71 KERHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVESKLILKGVILLIVDKALEEPKYSSLYAQLCLRLAEDAPNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVDVYDKRENPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKKRV----QLKDMGED------------LECLCQIMRTVGPRLD-HERAKSLMDQYFARMCSLM-LSKE----------LPARIRFLLQDTVELREHHWVPRKA---FLDNGPKTINQIRQDAVKDLGVFIPAPMAQGR 346          

HSP 2 Score: 85.1149 bits (209), Expect = 4.044e-16
Identity = 64/220 (29.09%), Postives = 115/220 (52.27%), Query Frame = 2
Query: 2348 DSQLTNQLVKESGLSIYSTIPDEIKTNAD-IITLFLDPNLSYLVPEYALKQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIGS----EKQAMEFTVIWLLEFVLAQLFQSSD----SGKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYL 2980
            D +   +L ++S +++   +P EI  N D ++ +     LS+L P   L++ L +  K       SP +    +  WI +NI      +K  +   +   L+++ +++   SD    S   +K+ +E EK +  +  P+++ +L   +  + Q++ L  LQ     +  PKG+LLR F+ FYD+E+I E  +  WK D+ +  P KGKALF+VN+WL +L
Sbjct:  685 DREWLTELFQQSKVNMQKMLP-EIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQIK----LDPSPQT----IYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVSPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLH--DHVDLQVSALYALQVHCYNSSFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWL 893          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Mouse
Match: Eif4g1 (eukaryotic translation initiation factor 4, gamma 1 [Source:MGI Symbol;Acc:MGI:2384784])

HSP 1 Score: 141.739 bits (356), Expect = 2.708e-33
Identity = 108/353 (30.59%), Postives = 172/353 (48.73%), Query Frame = 2
Query:  203 SKDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCK-DIPNFEPSSSNSTTFRNALLIKCQYEFEKNLPFCYI----------------------------DDVREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELIAPEGDGRLFVCEFHEVKKYEKIM-KNYDYKQQMGNGESKNYGVSASNKGSFNRV 1171
            SK Q++   R++R ILNK+TP+ F +L   V  + I++   +  ++DL+++KA +EP F+  Y+ +C  L    +P  E   + +  FR  LL +CQ EFEK+     +                            D  R + LGN++FI EL +  ++ E I+H+CV +LL             +H E            + ECLC+ LT IG  +D + KAKP +DQYF +M++++    E KT         SRIRFM++D+LDLR+ NW+P++  Q      PK + QI +E           + E  E  K +++M K  D ++    G   N G+   + G +N V
Sbjct:  753 SKTQDLF--RRVRSILNKLTPQMFQQLMKQVTQLAIDTEERLKGVIDLIFEKAISEPNFSVAYANMCRCLMALKVPTTE-KPTVTVNFRKLLLNRCQKEFEKDKDDDEVFEKKQKEMDEAATAEERGRLKEELEEARDIARRRSLGNIKFIGELFKLKMLTEAIMHDCVVKLLK------------NHDEE-----------SLECLCRLLTTIGKDLDFA-KAKPRMDQYFNQMEKIIK---EKKTS--------SRIRFMLQDVLDLRQSNWVPRRGDQG-----PKTIDQIHKE---------AEMEEHREHIKVQQLMAKGSDKRRGGPPGPPINRGLPLVDDGGWNTV 1053          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Mouse
Match: Eif4g1 (eukaryotic translation initiation factor 4, gamma 1 [Source:MGI Symbol;Acc:MGI:2384784])

HSP 1 Score: 141.354 bits (355), Expect = 2.897e-33
Identity = 108/353 (30.59%), Postives = 172/353 (48.73%), Query Frame = 2
Query:  203 SKDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCK-DIPNFEPSSSNSTTFRNALLIKCQYEFEKNLPFCYI----------------------------DDVREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELIAPEGDGRLFVCEFHEVKKYEKIM-KNYDYKQQMGNGESKNYGVSASNKGSFNRV 1171
            SK Q++   R++R ILNK+TP+ F +L   V  + I++   +  ++DL+++KA +EP F+  Y+ +C  L    +P  E   + +  FR  LL +CQ EFEK+     +                            D  R + LGN++FI EL +  ++ E I+H+CV +LL             +H E            + ECLC+ LT IG  +D + KAKP +DQYF +M++++    E KT         SRIRFM++D+LDLR+ NW+P++  Q      PK + QI +E           + E  E  K +++M K  D ++    G   N G+   + G +N V
Sbjct:  752 SKTQDLF--RRVRSILNKLTPQMFQQLMKQVTQLAIDTEERLKGVIDLIFEKAISEPNFSVAYANMCRCLMALKVPTTE-KPTVTVNFRKLLLNRCQKEFEKDKDDDEVFEKKQKEMDEAATAEERGRLKEELEEARDIARRRSLGNIKFIGELFKLKMLTEAIMHDCVVKLLK------------NHDEE-----------SLECLCRLLTTIGKDLDFA-KAKPRMDQYFNQMEKIIK---EKKTS--------SRIRFMLQDVLDLRQSNWVPRRGDQG-----PKTIDQIHKE---------AEMEEHREHIKVQQLMAKGSDKRRGGPPGPPINRGLPLVDDGGWNTV 1052          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Mouse
Match: Eif4g1 (eukaryotic translation initiation factor 4, gamma 1 [Source:MGI Symbol;Acc:MGI:2384784])

HSP 1 Score: 141.354 bits (355), Expect = 2.981e-33
Identity = 108/353 (30.59%), Postives = 172/353 (48.73%), Query Frame = 2
Query:  203 SKDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCK-DIPNFEPSSSNSTTFRNALLIKCQYEFEKNLPFCYI----------------------------DDVREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELIAPEGDGRLFVCEFHEVKKYEKIM-KNYDYKQQMGNGESKNYGVSASNKGSFNRV 1171
            SK Q++   R++R ILNK+TP+ F +L   V  + I++   +  ++DL+++KA +EP F+  Y+ +C  L    +P  E   + +  FR  LL +CQ EFEK+     +                            D  R + LGN++FI EL +  ++ E I+H+CV +LL             +H E            + ECLC+ LT IG  +D + KAKP +DQYF +M++++    E KT         SRIRFM++D+LDLR+ NW+P++  Q      PK + QI +E           + E  E  K +++M K  D ++    G   N G+   + G +N V
Sbjct:  759 SKTQDLF--RRVRSILNKLTPQMFQQLMKQVTQLAIDTEERLKGVIDLIFEKAISEPNFSVAYANMCRCLMALKVPTTE-KPTVTVNFRKLLLNRCQKEFEKDKDDDEVFEKKQKEMDEAATAEERGRLKEELEEARDIARRRSLGNIKFIGELFKLKMLTEAIMHDCVVKLLK------------NHDEE-----------SLECLCRLLTTIGKDLDFA-KAKPRMDQYFNQMEKIIK---EKKTS--------SRIRFMLQDVLDLRQSNWVPRRGDQG-----PKTIDQIHKE---------AEMEEHREHIKVQQLMAKGSDKRRGGPPGPPINRGLPLVDDGGWNTV 1059          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. UniProt/SwissProt
Match: sp|Q62448|IF4G2_MOUSE (Eukaryotic translation initiation factor 4 gamma 2 OS=Mus musculus OX=10090 GN=Eif4g2 PE=1 SV=2)

HSP 1 Score: 184.496 bits (467), Expect = 3.021e-46
Identity = 117/307 (38.11%), Postives = 172/307 (56.03%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNF-------EPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDVRE----------------KCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELI--------APEGDGR 1033
            K++   I RK+RGILNK+TPE FDKL L++LN+G+ES  ++  ++ L+  KA  EPK+++LY++LCLRL +D PNF       +P    STTFR  L+ K Q EFE       + D RE                K LGN++FI ELG+  L+ E ILH+C+K LL  + +      + D  E+             ECLCQ +  +G  +D  E+AK L+DQYF RM  L+ L+ E          LP+RIRF+++D ++LR+ +W+P+KA      + PK ++QIR++ +        AP   GR
Sbjct:   71 KERHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVESKLILKGVILLIVDKALEEPKYSSLYAQLCLRLAEDAPNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVDVYDKRENPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKKRV----QLKDMGED------------LECLCQIMRTVGPRLD-HERAKSLMDQYFARMCSLM-LSKE----------LPARIRFLLQDTVELREHHWVPRKA---FLDNGPKTINQIRQDAVKDLGVFIPAPMAQGR 346          

HSP 2 Score: 85.1149 bits (209), Expect = 2.952e-15
Identity = 64/220 (29.09%), Postives = 115/220 (52.27%), Query Frame = 2
Query: 2348 DSQLTNQLVKESGLSIYSTIPDEIKTNAD-IITLFLDPNLSYLVPEYALKQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIGS----EKQAMEFTVIWLLEFVLAQLFQSSD----SGKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYL 2980
            D +   +L ++S +++   +P EI  N D ++ +     LS+L P   L++ L +  K       SP +    +  WI +NI      +K  +   +   L+++ +++   SD    S   +K+ +E EK +  +  P+++ +L   +  + Q++ L  LQ     +  PKG+LLR F+ FYD+E+I E  +  WK D+ +  P KGKALF+VN+WL +L
Sbjct:  685 DREWLTELFQQSKVNMQKMLP-EIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQIK----LDPSPQT----IYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVSPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLH--DHVDLQVSALYALQVHCYNSSFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWL 893          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. UniProt/SwissProt
Match: sp|Q5R7J9|IF4G2_PONAB (Eukaryotic translation initiation factor 4 gamma 2 OS=Pongo abelii OX=9601 GN=EIF4G2 PE=2 SV=2)

HSP 1 Score: 183.341 bits (464), Expect = 7.541e-46
Identity = 113/292 (38.70%), Postives = 168/292 (57.53%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNF-------EPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDVRE----------------KCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELI 1012
            K++   I RK+RGILNK+TPE FDKL L++LN+G+ES  ++  ++ L+  KA  EPK+++LY++LCLRL +D PNF       +P    STTFR  L+ K Q EFE       + D RE                K LGN++FI ELG+  L+ E ILH+C+K LL  + +      + D  E+             ECLCQ +  +G  +D  E+AK L+DQYF RM  L+ L+ E          LP+RIRF+++D ++LR+ +W+P+KA      + PK ++QIR++ +
Sbjct:   71 KERHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVESKLILKGVILLIVDKALEEPKYSSLYAQLCLRLAEDAPNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVDVYDKRENPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKKRV----QLKDMGED------------LECLCQIMRTVGPRLD-HERAKSLMDQYFARMCSLM-LSKE----------LPARIRFLLQDTVELREHHWVPRKA---FLDNGPKTINQIRQDAV 331          

HSP 2 Score: 84.3445 bits (207), Expect = 4.600e-15
Identity = 64/220 (29.09%), Postives = 115/220 (52.27%), Query Frame = 2
Query: 2348 DSQLTNQLVKESGLSIYSTIPDEIKTNAD-IITLFLDPNLSYLVPEYALKQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIGS----EKQAMEFTVIWLLEFVLAQLFQSSD----SGKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYL 2980
            D +   +L ++S +++   +P EI  N D ++ +     LS+L P   L++ L +  K       SP +    +  WI +NI      +K  +   +   L+++ +++   SD    S   +K+ +E EK +  +  P+++ +L   +  + Q++ L  LQ     +  PKG+LLR F+ FYD+E+I E  +  WK D+ +  P KGKALF+VN+WL +L
Sbjct:  686 DREWLTELFQQSKVNMQKMLP-EIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQIK----LDPSPQT----IYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLH--DHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWL 894          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. UniProt/SwissProt
Match: sp|P78344|IF4G2_HUMAN (Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 7.541e-46
Identity = 113/292 (38.70%), Postives = 168/292 (57.53%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNF-------EPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDVRE----------------KCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELI 1012
            K++   I RK+RGILNK+TPE FDKL L++LN+G+ES  ++  ++ L+  KA  EPK+++LY++LCLRL +D PNF       +P    STTFR  L+ K Q EFE       + D RE                K LGN++FI ELG+  L+ E ILH+C+K LL  + +      + D  E+             ECLCQ +  +G  +D  E+AK L+DQYF RM  L+ L+ E          LP+RIRF+++D ++LR+ +W+P+KA      + PK ++QIR++ +
Sbjct:   71 KERHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVESKLILKGVILLIVDKALEEPKYSSLYAQLCLRLAEDAPNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVDVYDKRENPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKKRV----QLKDMGED------------LECLCQIMRTVGPRLD-HERAKSLMDQYFARMCSLM-LSKE----------LPARIRFLLQDTVELREHHWVPRKA---FLDNGPKTINQIRQDAV 331          

HSP 2 Score: 84.3445 bits (207), Expect = 4.600e-15
Identity = 64/220 (29.09%), Postives = 115/220 (52.27%), Query Frame = 2
Query: 2348 DSQLTNQLVKESGLSIYSTIPDEIKTNAD-IITLFLDPNLSYLVPEYALKQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIGS----EKQAMEFTVIWLLEFVLAQLFQSSD----SGKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYL 2980
            D +   +L ++S +++   +P EI  N D ++ +     LS+L P   L++ L +  K       SP +    +  WI +NI      +K  +   +   L+++ +++   SD    S   +K+ +E EK +  +  P+++ +L   +  + Q++ L  LQ     +  PKG+LLR F+ FYD+E+I E  +  WK D+ +  P KGKALF+VN+WL +L
Sbjct:  686 DREWLTELFQQSKVNMQKMLP-EIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQIK----LDPSPQT----IYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLH--DHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWL 894          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. UniProt/SwissProt
Match: sp|Q95L46|IF4G2_BOVIN (Eukaryotic translation initiation factor 4 gamma 2 OS=Bos taurus OX=9913 GN=EIF4G2 PE=2 SV=2)

HSP 1 Score: 183.341 bits (464), Expect = 7.541e-46
Identity = 113/292 (38.70%), Postives = 168/292 (57.53%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNF-------EPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDVRE----------------KCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELI 1012
            K++   I RK+RGILNK+TPE FDKL L++LN+G+ES  ++  ++ L+  KA  EPK+++LY++LCLRL +D PNF       +P    STTFR  L+ K Q EFE       + D RE                K LGN++FI ELG+  L+ E ILH+C+K LL  + +      + D  E+             ECLCQ +  +G  +D  E+AK L+DQYF RM  L+ L+ E          LP+RIRF+++D ++LR+ +W+P+KA      + PK ++QIR++ +
Sbjct:   71 KERHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVESKLILKGVILLIVDKALEEPKYSSLYAQLCLRLAEDAPNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVDVYDKRENPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKKRV----QLKDMGED------------LECLCQIMRTVGPRLD-HERAKSLMDQYFARMCSLM-LSKE----------LPARIRFLLQDTVELREHHWVPRKA---FLDNGPKTINQIRQDAV 331          

HSP 2 Score: 84.3445 bits (207), Expect = 4.600e-15
Identity = 64/220 (29.09%), Postives = 115/220 (52.27%), Query Frame = 2
Query: 2348 DSQLTNQLVKESGLSIYSTIPDEIKTNAD-IITLFLDPNLSYLVPEYALKQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIGS----EKQAMEFTVIWLLEFVLAQLFQSSD----SGKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYL 2980
            D +   +L ++S +++   +P EI  N D ++ +     LS+L P   L++ L +  K       SP +    +  WI +NI      +K  +   +   L+++ +++   SD    S   +K+ +E EK +  +  P+++ +L   +  + Q++ L  LQ     +  PKG+LLR F+ FYD+E+I E  +  WK D+ +  P KGKALF+VN+WL +L
Sbjct:  686 DREWLTELFQQSKVNMQKMLP-EIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQIK----LDPSPQT----IYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLH--DHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWL 894          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. UniProt/SwissProt
Match: sp|P79398|IF4G2_RABIT (Eukaryotic translation initiation factor 4 gamma 2 OS=Oryctolagus cuniculus OX=9986 GN=EIF4G2 PE=2 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 8.021e-46
Identity = 113/292 (38.70%), Postives = 168/292 (57.53%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNF-------EPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDVRE----------------KCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELI 1012
            K++   I RK+RGILNK+TPE FDKL L++LN+G+ES  ++  ++ L+  KA  EPK+++LY++LCLRL +D PNF       +P    STTFR  L+ K Q EFE       + D RE                K LGN++FI ELG+  L+ E ILH+C+K LL  + +      + D  E+             ECLCQ +  +G  +D  E+AK L+DQYF RM  L+ L+ E          LP+RIRF+++D ++LR+ +W+P+KA      + PK ++QIR++ +
Sbjct:   71 KERHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVESKLILKGVILLIVDKALEEPKYSSLYAQLCLRLAEDAPNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVDVYDKRENPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKKRV----QLQDMGED------------LECLCQIMRTVGPRLD-HERAKSLMDQYFARMCSLM-LSKE----------LPARIRFLLQDTVELREHHWVPRKA---FLDNGPKTINQIRQDAV 331          

HSP 2 Score: 84.3445 bits (207), Expect = 4.883e-15
Identity = 64/220 (29.09%), Postives = 115/220 (52.27%), Query Frame = 2
Query: 2348 DSQLTNQLVKESGLSIYSTIPDEIKTNAD-IITLFLDPNLSYLVPEYALKQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIGS----EKQAMEFTVIWLLEFVLAQLFQSSD----SGKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYL 2980
            D +   +L ++S +++   +P EI  N D ++ +     LS+L P   L++ L +  K       SP +    +  WI +NI      +K  +   +   L+++ +++   SD    S   +K+ +E EK +  +  P+++ +L   +  + Q++ L  LQ     +  PKG+LLR F+ FYD+E+I E  +  WK D+ +  P KGKALF+VN+WL +L
Sbjct:  686 DREWLTELFQQSKVNMQKMLP-EIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQIK----LDPSPQT----IYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLH--DHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWL 894          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. TrEMBL
Match: A0A4Z2DXK0 (Eukaryotic translation initiation factor 4 gamma 2 isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_010932 PE=4 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 3.851e-52
Identity = 117/294 (39.80%), Postives = 184/294 (62.59%), Query Frame = 2
Query:  224 ISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDVREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSK--AIGNNTIPDHPEN-----GEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKY--------------------YLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELIAPEG 1024
            I +++  ILNK+T ENF++    +L++ I S++ + ++  L+Y+KA NEPKFT+LY++LCL+LC  +PNFE   S S TF+  L+  C+ EF+     C     R+KCLGNLRFIAELG  G++ E++LH CV++LL+ + +   I ++ +  H +        + +R+      ECLCQFLT +G +MD + KAK L+DQYF+R++++L  A E+   ++ K+                     L SR+RFM+EDL+DLR+ NWIP++AGQR  +++P+ L  IR E++   G
Sbjct:   34 IRKEVLFILNKLTAENFEQQGEKLLSLDISSTS-LHVIAQLIYQKAINEPKFTSLYAQLCLKLCNSVPNFEVEGSQS-TFQIFLIKCCEDEFKARDVACDDQVSRQKCLGNLRFIAELGICGVMSERVLHNCVQELLTRKGQHYPINDSEVLMHAQEKVKTADSVKERSLSNEL-ECLCQFLTSVGKHMD-TPKAKNLMDQYFQRLRRILSRAYESNGSSSIKHENVSIKGKVPPKTIKSNDNCTLSSRVRFMIEDLIDLRENNWIPRRAGQRTEINKPRFLRDIRLEILKESG 323          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. TrEMBL
Match: A0A1S3IAI0 (eukaryotic translation initiation factor 4 gamma 2 OS=Lingula unguis OX=7574 GN=LOC106161886 PE=4 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 7.034e-52
Identity = 115/275 (41.82%), Postives = 170/275 (61.82%), Query Frame = 2
Query:  230 RKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNSTTFRNALLIKCQYEFE-----------KNLPFCYID-----DVREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREE 1006
            RK+RGILNK+TPE FDKL L++LN+GI+S  V+  ++ L+++K+ +EPK+++LY++LC RLC+D PNFEP+SSN+T+FR  LL KCQ EFE           ++ P    +       + K LGN++FI ELG+  ++ E ILH+C+KQLL  +       T  D                 ECLCQ +  +G  +D ++KAK L+DQYF RMK L+          NN+  LP+RIRF+++D ++LR+ NW P+K  +      P+ ++QIREE
Sbjct:   79 RKVRGILNKLTPEKFDKLGLELLNVGIDSPVVLKGIILLIFEKSLDEPKYSSLYAQLCQRLCEDAPNFEPASSNNTSFRRHLLNKCQDEFENRSKATNEFDKRDTPLTPEELEKYHAAKFKMLGNIKFIGELGKLDMLHEGILHKCIKQLLEKKKHVPIQETAED----------------LECLCQIMKTVGRRLD-TDKAKALMDQYFSRMKTLM---------MNNE--LPTRIRFLLQDTIELRENNWTPRKVTRG---SAPRTITQIREE 322          

HSP 2 Score: 81.2629 bits (199), Expect = 1.500e-11
Identity = 59/213 (27.70%), Postives = 106/213 (49.77%), Query Frame = 2
Query: 2378 ESGLSIYSTIPDEIKTNADIITLFLDPNLSYLVP----EYALKQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIGSE----KQAMEFTVIWLLEFVLAQ--LFQSSD-SGKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYLK 2983
            ES + + + +P+  ++   ++ +  D +LS++ P    +  L + +   P   D++             W+ ENI  +     + +   V  LL ++ +Q  L   +D +    K L++ EK +      I++ +L   +    QL+ +  LQ        PKG+LLR F+ FYD+E+I E V+  WK +VN   P KGK+LF+VN+WL +L+
Sbjct:  760 ESKIDLQNMLPEGDRSKERMLKILEDRDLSFMFPLLRVQAELSRQIQGDPSPTDLY------------KWMKENIDPKLFNKTEFIHGLVTTLLRYITSQSTLADGADPAAMPEKHLVDKEKEILDKYKSILQLFLH--DKLGLQLSAVYALQVHCYNKGFPKGMLLRMFMHFYDMEIIDEEVFLKWKEEVNDEHPGKGKSLFQVNQWLTWLE 958          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. TrEMBL
Match: A0A293LZ71 (Eukaryotic translation initiation factor 4 gamma (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 1.923e-51
Identity = 110/290 (37.93%), Postives = 172/290 (59.31%), Query Frame = 2
Query:  185 QNQLYISKDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDVRE----------------KCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREE 1006
            Q    + + Q + + RK+RGILNK+TPE F+KL  ++L +G++S+ V+  ++ L+++KA +EPK++ +Y+ LC  LC++ PNF+P  SN  TFR  LL KCQ EFE         + RE                K LGN++FI ELG+ GL+QE ILH+C++QLL + ++  G  T P   E        W+    ECLCQ +  +G  +D +++A+ L+DQYF+RM+ L      +  D      LP RIRF+++D+++LR+  W+P++A        P+ + QIREE
Sbjct:   24 QTNRRLDEGQALQVFRKVRGILNKLTPEKFEKLRRELLVVGLDSTHVLKGVILLIFEKALDEPKYSCMYASLCRELCRESPNFDPPESN--TFRRLLLTKCQDEFENRRRVSEAYEHREGSLTQEEQEQRLLAKHKMLGNIKFIGELGKQGLLQESILHQCIQQLLVASARRSGGRTTPSEVE--------WQ--DLECLCQIMVTVGRRLD-TQRARSLMDQYFERMRTL-----ASAPD------LPPRIRFLLQDVVELRQNGWVPRRANSEHG---PRTIQQIREE 286          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. TrEMBL
Match: A0A1S8WJI6 (MIF4G domain protein OS=Opisthorchis viverrini OX=6198 GN=X801_09601 PE=4 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 1.991e-51
Identity = 120/308 (38.96%), Postives = 182/308 (59.09%), Query Frame = 2
Query:  224 ISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDD--VREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAI------GNNTIPDHPENGEIDQRTWRYAT-KECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKT--------------------------------DTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELIAPEG 1024
            + +++  ILNKVT ENF++ + ++LN+GI SS++++++V L+++KA NEPKFTALY++LCL+LC   PNFEP  S  +TFR  LL  C+ EF+        DD   R++ LGN+RFIAELG+ G + EKILH+CV+ +LS R++ +        +T+ D         R    AT  ECLC FL ++G  MD + KA  L++QYF+R++++   A+EA +                                  +N   LP+RIRFM++D+LDLR   W+P++AGQR   ++P+ L  IR E+    G
Sbjct:  226 VRKEVLSILNKVTAENFEQQAKNILNVGIHSSSILNVIVRLIFQKAINEPKFTALYAQLCLKLCSSAPNFEPKGSPKSTFRIFLLKLCEDEFKAR---NGADDPVARQRSLGNVRFIAELGQLGFIPEKILHQCVRAMLSGRTQPVQSVTSSSGSTVEDTTGRSGAKIREESLATDMECLCLFLKVVGKSMD-TPKAHNLMNQYFQRLQRIQARAMEASSLHGESEDGSNCSGGRPRTGSAHEVINSPKSSGVKSNVEVLPARIRFMIDDILDLRSNGWVPRRAGQRGETNKPRYLRDIRMEVFKDSG 529          

HSP 2 Score: 96.2857 bits (238), Expect = 4.070e-16
Identity = 63/207 (30.43%), Postives = 111/207 (53.62%), Query Frame = 2
Query: 2375 KESGLSIYSTIPDEIKTNADIITLFLDPNLSYLVPEYALKQTLDQIPKNFDIFSSSPNSDSDKLLNWILENI--GSEKQAMEF--TVIWLL-EFVLAQLFQSSDSGKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYL 2980
            ++SG+ +   +PD  + N  ++    +  LS+LVP   L + L+++  +  + + + +      L+  L+      ++Q+ +F  TV+ ++ E++     + S     T +L+  E++ W  L P  E    +  S   QL  L  LQ FW +  +PKG LLRCFI  Y+ +L+ EN +  WK ++N + P KG+ALFEVN+WL +L
Sbjct: 1087 RDSGILMSQMLPDGNQWNERLLETLEERGLSFLVPNLCLSRELNKLLTSGPLSTKTDDEHMTLTLSECLKKCVRPEDQQSPDFIHTVMLVVYEYIYRTGLELSPQSSPT-ELMSRERAAWTRLVPA-ELAGVLIGSSSRQLDALHALQIFWMSRNKPKGFLLRCFINLYNCDLVDENTFLTWKEELNPDYPAKGEALFEVNRWLTWL 1291          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. TrEMBL
Match: A0A075A4S2 (W2 domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_00778 PE=4 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 2.171e-51
Identity = 120/308 (38.96%), Postives = 182/308 (59.09%), Query Frame = 2
Query:  224 ISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDD--VREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAI------GNNTIPDHPENGEIDQRTWRYAT-KECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKT--------------------------------DTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELIAPEG 1024
            + +++  ILNKVT ENF++ + ++LN+GI SS++++++V L+++KA NEPKFTALY++LCL+LC   PNFEP  S  +TFR  LL  C+ EF+        DD   R++ LGN+RFIAELG+ G + EKILH+CV+ +LS R++ +        +T+ D         R    AT  ECLC FL ++G  MD + KA  L++QYF+R++++   A+EA +                                  +N   LP+RIRFM++D+LDLR   W+P++AGQR   ++P+ L  IR E+    G
Sbjct:  226 VRKEVLSILNKVTAENFEQQAKNILNVGIHSSSILNVIVRLIFQKAINEPKFTALYAQLCLKLCSSAPNFEPKGSPKSTFRIFLLKLCEDEFKAR---NGADDPVARQRSLGNVRFIAELGQLGFIPEKILHQCVRAMLSGRTQPVQSVTSSSGSTVEDTTGRSGAKIREESLATDMECLCLFLKVVGKSMD-TPKAHNLMNQYFQRLQRIQARAMEASSLHGESEDGSNCSGGRPRTGSAHEVINSPKSSGVKSNVEVLPARIRFMIDDILDLRSNGWVPRRAGQRGETNKPRYLRDIRMEVFKDSG 529          

HSP 2 Score: 95.9005 bits (237), Expect = 4.506e-16
Identity = 63/207 (30.43%), Postives = 111/207 (53.62%), Query Frame = 2
Query: 2375 KESGLSIYSTIPDEIKTNADIITLFLDPNLSYLVPEYALKQTLDQIPKNFDIFSSSPNSDSDKLLNWILENI--GSEKQAMEF--TVIWLL-EFVLAQLFQSSDSGKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYL 2980
            ++SG+ +   +PD  + N  ++    +  LS+LVP   L + L+++  +  + + + +      L+  L+      ++Q+ +F  TV+ ++ E++     + S     T +L+  E++ W  L P  E    +  S   QL  L  LQ FW +  +PKG LLRCFI  Y+ +L+ EN +  WK ++N + P KG+ALFEVN+WL +L
Sbjct: 1087 RDSGILMSQMLPDGNQWNERLLETLEERGLSFLVPNLCLSRELNKLLTSGPLSTKTDDEHMTLTLSECLKKCVRPEDQQSPDFIHTVMLVVYEYIYRTGLELSPQSSPT-ELMSRERAAWTRLVPA-ELAGVLIGSSSRQLDALHALQIFWMSKNKPKGFLLRCFINLYNCDLVDENTFLTWKEELNPDYPAKGEALFEVNRWLTWL 1291          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Cavefish
Match: eif4g2b (eukaryotic translation initiation factor 4, gamma 2b [Source:ZFIN;Acc:ZDB-GENE-030131-6550])

HSP 1 Score: 184.111 bits (466), Expect = 3.070e-47
Identity = 115/292 (39.38%), Postives = 169/292 (57.88%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNF------EPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDVRE----------------KCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDE-PKLLSQIREELI 1012
            K+    I RK+RGILNK+TPE FDKL L++LN+G++S  V+  ++ L+  KA  EPK+++LY++LCLRL +D PNF      + +   STTFR  L+ K Q EFE       I + +E                K LGN++FI ELG+  L+ E ILH+C+K LL  + +      + D  E+             ECLCQ +  +G  +D  EKAK L+DQYF RM+ L+          NNK  LP+RIRF+++D ++LR+ NW+P+KA     +D  PK ++QIR++ +
Sbjct:   60 KEHHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVDSKLVLKGVILLIVDKALEEPKYSSLYAQLCLRLAEDAPNFDSPPEIQSNQKQSTTFRRLLITKLQDEFENRTKNVEIYEKKESPLTSEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKKRI----QLKDMGED------------LECLCQIMRTVGPRLD-HEKAKSLMDQYFGRMRSLM----------NNK-DLPARIRFLLQDTVELRENNWVPRKAF----IDNGPKTINQIRQDAV 319          

HSP 2 Score: 85.8853 bits (211), Expect = 1.635e-16
Identity = 49/143 (34.27%), Postives = 80/143 (55.94%), Query Frame = 2
Query: 2573 WILENIG----SEKQAMEFTVIWLLEFVLAQLFQSSDS---GKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYL 2980
            WI +NI     ++K  +   +   L+F+ A+L  S         +K+ ++ EK +     P+++ +L   +  + Q++ L  LQ   NT   PKG+LLR F+ FYD+E+I E  +  WK D+ +  P KGKALF+VN+WL +L
Sbjct:  701 WIKDNISPKLHTDKGFINILMTSFLQFISAELCLSESEENLSAPSKEQLDQEKQLLLAFKPVMQKFLH--DHTDLQVSALYALQVHCNTYAFPKGMLLRYFVNFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWL 841          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Cavefish
Match: eif4g2a (eukaryotic translation initiation factor 4, gamma 2a [Source:ZFIN;Acc:ZDB-GENE-030131-2173])

HSP 1 Score: 180.259 bits (456), Expect = 5.635e-46
Identity = 112/293 (38.23%), Postives = 168/293 (57.34%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNF-------EPSSSNSTTFRNALLIKCQYEFE---KNLPFCYIDD-------------VREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDE-PKLLSQIREELI 1012
            K++   I RK+RGILNK+TPE FDKL L++LN+G++S  ++  ++ L+  KA  EPK+++LY++LCLRL +D PNF       + S   STTFR  L+ K Q EFE   +N+      D              + K LGN++FI ELG+  L+ E ILH+C+K LL  + +      + D  E+             ECLCQ +  +G  +D  EKAK L+DQYF RM+ L+           N   LP+RIRF+++D ++LR+  W+P+KA     +D  PK ++QIR++ +
Sbjct:   66 KERHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVDSKLILKGVILLIVDKALEEPKYSSLYAQLCLRLAEDAPNFDSQSPEIQSSQKQSTTFRRLLISKLQDEFENRARNVEIYEKTDGPLTSEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKKRI----QLKDMGED------------LECLCQIMRTVGPRLD-HEKAKSLMDQYFGRMRSLM-----------NTKDLPARIRFLLQDTVELRENKWVPRKA----FIDNGPKTINQIRQDAV 326          

HSP 2 Score: 87.4261 bits (215), Expect = 5.193e-17
Identity = 64/220 (29.09%), Postives = 112/220 (50.91%), Query Frame = 2
Query: 2348 DSQLTNQLVKESGLSIYSTIPDEIKTNAD-IITLFLDPNLSYLVPEYAL-KQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIG----SEKQAMEFTVIWLLEFVLAQLFQSSDS---GKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYL 2980
            D +    L ++S +++   +P EI  N D ++ +     LS+L P   L K+ L QI  +      SP S    +  WI +NI     ++K  +   +   L+++  +++           +K+ ++ EK +     P+++ +L   +  + Q++ L  LQ   N    PKG+LLR F+ FYD+E+I E  +  WK D+ +  P KGKALF+VN+WL +L
Sbjct:  639 DKEWLTDLFQQSKVNMQKMLP-EIDQNKDRMLEILEGKGLSFLFPLMKLEKELLKQIKAD-----PSPQS----IYKWIKDNISPKLHTDKGFVNILMTSFLQYISHEVYTPETEEQLSAPSKEQLDQEKQLLLAFKPVMQKFLH--DHVDLQVSALYALQVHCNAKAFPKGMLLRYFVNFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWL 846          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Cavefish
Match: eif4g3b (eukaryotic translation initiation factor 4 gamma 3 [Source:NCBI gene;Acc:103031287])

HSP 1 Score: 139.813 bits (351), Expect = 8.157e-33
Identity = 94/295 (31.86%), Postives = 147/295 (49.83%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNSTTFRNALLIKCQYEFEKN----------------------------LPFCYIDDVREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREE 1006
            K QE+   RK+R ILNK+TP+ F++L   V ++ I++   +  ++DL+++KA +EP F+  Y  +C  L           +++  FR  LL +CQ EFEK+                                  D  R + +GN++FI EL +  ++ E I+H+CV +LL             +H E            + ECLC+ LT IG  +D  EKAKP +DQYF +M++++    E KT         SRIRFM++D++DLR  NW+ ++A Q      PK + QI +E
Sbjct:  936 KTQELF--RKVRSILNKLTPQMFNQLMKQVTDLTIDTEERLKGVIDLVFEKAIDEPSFSVAYGNMCSCLATLKVPMADKPTSTVNFRKLLLNRCQKEFEKDKMDDDVFEKKQRELEAASSATERERLQEELEEAKDKARRRSIGNIKFIGELFKLRMLTEAIMHDCVVKLLK------------NHDEE-----------SLECLCRLLTTIGKDLD-FEKAKPRMDQYFNQMEKIVK---ERKTS--------SRIRFMLQDVIDLRLHNWVSRRADQ-----GPKTIEQIHKE 1188          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Cavefish
Match: eif4g3b (eukaryotic translation initiation factor 4 gamma 3 [Source:NCBI gene;Acc:103031287])

HSP 1 Score: 139.428 bits (350), Expect = 1.179e-32
Identity = 94/295 (31.86%), Postives = 147/295 (49.83%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNSTTFRNALLIKCQYEFEKN----------------------------LPFCYIDDVREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREE 1006
            K QE+   RK+R ILNK+TP+ F++L   V ++ I++   +  ++DL+++KA +EP F+  Y  +C  L           +++  FR  LL +CQ EFEK+                                  D  R + +GN++FI EL +  ++ E I+H+CV +LL             +H E            + ECLC+ LT IG  +D  EKAKP +DQYF +M++++    E KT         SRIRFM++D++DLR  NW+ ++A Q      PK + QI +E
Sbjct:  920 KTQELF--RKVRSILNKLTPQMFNQLMKQVTDLTIDTEERLKGVIDLVFEKAIDEPSFSVAYGNMCSCLATLKVPMADKPTSTVNFRKLLLNRCQKEFEKDKMDDDVFEKKQRELEAASSATERERLQEELEEAKDKARRRSIGNIKFIGELFKLRMLTEAIMHDCVVKLLK------------NHDEE-----------SLECLCRLLTTIGKDLD-FEKAKPRMDQYFNQMEKIVK---ERKTS--------SRIRFMLQDVIDLRLHNWVSRRADQ-----GPKTIEQIHKE 1172          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Cavefish
Match: eif4g3b (eukaryotic translation initiation factor 4 gamma 3 [Source:NCBI gene;Acc:103031287])

HSP 1 Score: 139.043 bits (349), Expect = 1.378e-32
Identity = 94/295 (31.86%), Postives = 147/295 (49.83%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNSTTFRNALLIKCQYEFEKN----------------------------LPFCYIDDVREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREE 1006
            K QE+   RK+R ILNK+TP+ F++L   V ++ I++   +  ++DL+++KA +EP F+  Y  +C  L           +++  FR  LL +CQ EFEK+                                  D  R + +GN++FI EL +  ++ E I+H+CV +LL             +H E            + ECLC+ LT IG  +D  EKAKP +DQYF +M++++    E KT         SRIRFM++D++DLR  NW+ ++A Q      PK + QI +E
Sbjct:  902 KTQELF--RKVRSILNKLTPQMFNQLMKQVTDLTIDTEERLKGVIDLVFEKAIDEPSFSVAYGNMCSCLATLKVPMADKPTSTVNFRKLLLNRCQKEFEKDKMDDDVFEKKQRELEAASSATERERLQEELEEAKDKARRRSIGNIKFIGELFKLRMLTEAIMHDCVVKLLK------------NHDEE-----------SLECLCRLLTTIGKDLD-FEKAKPRMDQYFNQMEKIVK---ERKTS--------SRIRFMLQDVIDLRLHNWVSRRADQ-----GPKTIEQIHKE 1154          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Sea Lamprey
Match: eif4g2a (eukaryotic translation initiation factor 4, gamma 2a [Source:ZFIN;Acc:ZDB-GENE-030131-2173])

HSP 1 Score: 171.785 bits (434), Expect = 8.229e-44
Identity = 111/313 (35.46%), Postives = 174/313 (55.59%), Query Frame = 2
Query:  203 SKDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSS-------SNSTTFRNALLIKCQYEFE-----------KNLPFCYIDD-----VREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELIAPEGDGRLFVCEFHEVKKYE 1072
            + D+   I RK+RGILNK+TPE FDKL L++LN+GI+S  ++  ++ L+++KA  EPK+++LYS+LC RL +D PNF+           ++++FR  L+ K Q EFE           ++ P    +D      + K LGN++FI ELG+  L+ E ILH C+K LL  + +    +   D                 ECLCQ +  +G  +D  +KA+ L+DQYF RM+ L+     A  D      LP+RIRF+++D ++LR   W+P+KA    + + PK +SQIR++ I  +  G     + H + + E
Sbjct:   64 TPDRNEAIFRKVRGILNKLTPEKFDKLCLELLNVGIDSKLILKGIILLIFEKALEEPKYSSLYSQLCQRLAEDAPNFDGPPLEGPGRHKHNSSFRRLLIAKLQDEFENRTKKLEGFDNRDSPLSPEEDEQRTIAKLKMLGNIKFIGELGKLDLLHESILHRCIKTLLEKKKRVALKDMAEDL----------------ECLCQIMRTVGPRLDH-DKARSLMDQYFLRMQSLM-----ANKD------LPARIRFLLQDTVELRLNKWVPRKA---FSDNGPKPISQIRQDAI--KDLGVFIPSQLHGIGRSE 343          

HSP 2 Score: 88.5817 bits (218), Expect = 5.736e-18
Identity = 61/216 (28.24%), Postives = 104/216 (48.15%), Query Frame = 2
Query: 2366 QLVKESGLSIYSTIPDEIKTNADIITLFLDPNLSYLVP----EYALKQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIGSEKQA----MEFTVIWLLEFVLAQLFQSSD---SGKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYL 2980
            +L + S +++   +P+  ++   ++ +     LSYL P    E  L + ++Q P        SP +    +  WI EN+ +        +    +  L+++      +     S    +D++E EK +  +  P+++ +L    S   Q+  L  LQ   +T   PKG+LLR F+  YDLE+I E  +  WK DV    P KGKALF+VN+WL +L
Sbjct:  692 ELFQSSRINMQKMLPECDQSKERMLEILEGKGLSYLFPLLHLEKELSKQIEQDP--------SPQA----IYKWIKENVPARLHTDSSFVNILTVSFLQYITGATTLAPGLDPSVAPVRDVMEAEKQLLASFKPVLQKFLHSQTSL--QVAALYALQVHCHTQSFPKGMLLRFFMNLYDLEIIEEEAFMAWKEDVTEEFPGKGKALFQVNQWLTWL 893          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Yeast
Match: TIF4632 (Translation initiation factor eIF4G; subunit of the mRNA cap-binding protein complex (eIF4F) that also contains eIF4E (Cdc33p); associates with the poly(A)-binding protein Pab1p, also interacts with eIF4A (Tif1p); TIF4632 has a paralog, TIF4631, that arose from the whole genome duplication [Source:SGD;Acc:S000003017])

HSP 1 Score: 73.559 bits (179), Expect = 1.615e-13
Identity = 73/302 (24.17%), Postives = 135/302 (44.70%), Query Frame = 2
Query:  224 ISRKIRGILNKVTPENFDKLSLDVLNIGIES-----SAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDI-PNF---EPSSSNSTTF-RNALLIKCQYEFEKN----LP----------------FCYIDDVREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKP--------LIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKI-NWIPQK--AGQRINVDEPKLLSQIREE 1006
            + RK++ +LNK+T E FD +S ++L+I  +S        + I+++ ++ KA +EP ++++Y++LC ++ KD+ PN    E    N      + L+ +C  EFEK     LP                +      + + LG +RFI  L    L+  K++ EC ++L+    K + N+   +               T E + + L  +G   +  +   P        L+D  F  ++ ++D              + +RI+F + D+ +LR+I +W   K  AG       PK + QI +E
Sbjct:  566 VERKMKSLLNKLTLEMFDSISSEILDIANQSKWEDDGETLKIVIEQIFHKACDEPHWSSMYAQLCGKVVKDLDPNIKDKENEGKNGPKLVLHYLVARCHEEFEKGWADKLPAGEDGNPLEPEMMSDEYYIAAAAKRRGLGLVRFIGYLYCLNLLTGKMMFECFRRLM----KDLNNDPSEE---------------TLESVIELLNTVGEQFEHDKFVTPQATLEGSVLLDNLFMLLQHIIDGGT-----------ISNRIKFKLIDVKELREIKHWNSAKKDAG-------PKTIQQIHQE 830          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Yeast
Match: TIF4631 (Translation initiation factor eIF4G; subunit of the mRNA cap-binding protein complex (eIF4F) that also contains eIF4E (Cdc33p); interacts with Pab1p and with eIF4A (Tif1p); also has a role in biogenesis of the large ribosomal subunit; TIF4631 has a paralog, TIF4632, that arose from the whole genome duplication [Source:SGD;Acc:S000003394])

HSP 1 Score: 65.4698 bits (158), Expect = 4.012e-11
Identity = 66/300 (22.00%), Postives = 129/300 (43.00%), Query Frame = 2
Query:  224 ISRKIRGILNKVTPENFDKLSLDVL---NIGI--ESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDI-PNFEPSSSNSTT----FRNALLIKCQYEFEKN----LP----------------FCYIDDVREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSE--------KAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRK-INWIPQKAGQRINVDEPKLLSQIREE 1006
            + RK++ +LNK+T E FD +S ++L   NI +   +   +  +++ ++ KA +EP ++++Y++LC ++ K++ P+    ++   T      + L+ +C  EF+K     LP                +      + + LG +RFI  L R  L+  K++ EC ++L+   + +    T+                   E + + L  +G   +           +   L+D  F  +  ++  A            + SRI+F + D+ +LR   NW   K       + PK + QI EE
Sbjct:  606 VERKMKSLLNKLTLEMFDAISSEILAIANISVWETNGETLKAVIEQIFLKACDEPHWSSMYAQLCGKVVKELNPDITDETNEGKTGPKLVLHYLVARCHAEFDKGWTDKLPTNEDGTPLEPEMMSEEYYAAASAKRRGLGLVRFIGFLYRLNLLTGKMMFECFRRLMKDLTDSPSEETL-------------------ESVVELLNTVGEQFETDSFRTGQATLEGSQLLDSLFGILDNIIQTA-----------KISSRIKFKLIDIKELRHDKNWNSDKKD-----NGPKTIQQIHEE 870          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Nematostella
Match: EDO31711 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX49])

HSP 1 Score: 192.2 bits (487), Expect = 3.832e-50
Identity = 109/291 (37.46%), Postives = 176/291 (60.48%), Query Frame = 2
Query:  182 NQNQLYISKDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNF-EPSSSNSTTFRNALLIKCQYEF----EKNLPFCYIDDV-----------REKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREE 1006
            N+  LY  +D+  L+ R++RGILNK+TP+ FDKL  ++L++G+E+  ++  ++ L+++KA +EP ++++Y++LCLRL ++ PNF +P  + ++TFR  LL +C+ EF    + +  F   DD+           + K LGN+RFI EL +  ++ E ILH+C+KQLL  + +A   +T  D                 ECLC  +  +GS +D   KAKPL+DQYF+R+ Q     I +++D      LPSRIRFM+E + +LR   WIP+K  + +    PK ++QIR+E
Sbjct:   56 NRTNLY--RDENELVFRRVRGILNKLTPDKFDKLFYELLHVGVETKYILKGVILLVFEKALDEPAYSSMYAQLCLRLSEEAPNFDDPGKTGNSTFRRLLLKQCEEEFNNRSKASQAFDKKDDLTQEEEEERGSTKRKMLGNIRFIGELAKLDMLHETILHKCIKQLLDKKKRASVADTSEDM----------------ECLCHLMKTVGSRID-GPKAKPLVDQYFERIYQ-----IRSRSD------LPSRIRFMLEGIEELRTNKWIPRKVARDVG---PKPINQIRQE 313          

HSP 2 Score: 100.138 bits (248), Expect = 2.357e-21
Identity = 67/214 (31.31%), Postives = 107/214 (50.00%), Query Frame = 2
Query: 2378 ESGLSIYSTIPDEIKTNADIITLFLDPNLSYLVPEYALKQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIGSEKQAMEFTVIWLLEFVLAQLFQSSDSGKST-------KDLIEIEKSVWKNLSPIIEHYL--SIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYLKNEE 2992
            E+ + + ST+P+  + +  ++ +  + +LS+L P   ++  L      +      PNS +  +  WI +N+ +        +  +   +L    Q S  GK         KDL+E E    K L P+++ +L   ID     Q+  L  LQ F +TN  PKG+LLR F+  YDLE++ E  +  WK DVN   P KGKALF+VN WL +L+  +
Sbjct:  665 EAKIDLLSTLPESSRNSCKMMVILEEQSLSFLFPLLRIQAEL------YKKIEEDPNSSA--IYKWIKDNVDASLHDQPEFINAITTCILRYATQQSTLGKGVDISLPPDKDLVEKEIHAIKKLKPLLDKFLLEKIDL----QVCALYALQVFCHTNNHPKGLLLRMFMLLYDLEVVDEEAFVKWKEDVNEKYPGKGKALFQVNTWLTWLETAD 866          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Nematostella
Match: EDO33172 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST03])

HSP 1 Score: 134.42 bits (337), Expect = 5.985e-32
Identity = 96/302 (31.79%), Postives = 149/302 (49.34%), Query Frame = 2
Query:  224 ISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNSTTFRNALLIKCQYEFEK-----NLPFCYIDDV------------------------REKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELIAPEGDGRLFV 1042
            + RK RGILNK+TP+ F KL+  V+ + I++S  +  ++D++++KA +EP F+  Y+ LC  L   +P    + +    FR  LL KCQ EFEK     N     ID +                        + + LGN+RFI EL +  ++ E I+H CV +L+ S                  +D+ +      EC C+ L+ IG  +D  E AKP +DQYF +M +++     A   T+      SR+RFM++DL DLR  NW+P     R + + PK + QI +E    E   +L +
Sbjct:    2 VMRKFRGILNKLTPQKFKKLTEQVMELEIDTSEKLEGIIDIIFEKAISEPGFSVAYANLCRCL---LPIKVSTGNKELVFRTILLNKCQKEFEKEKTDENRIHEKIDQLVNEGLSEEDYKIKKAELEEEEMFGKRRTLGNIRFIGELFKLKILTENIMHTCVMKLIKS------------------MDEESL-----ECFCKLLSTIGKDLD-HEVAKPRMDQYFSQMDKII-----ASKKTS------SRVRFMLQDLRDLRLSNWVP-----RRDDNNPKTIDQIHKEAADEEKKTQLLL 260          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Nematostella
Match: EDO32341 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVB3])

HSP 1 Score: 110.153 bits (274), Expect = 6.597e-27
Identity = 81/272 (29.78%), Postives = 132/272 (48.53%), Query Frame = 2
Query:  224 ISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDV-----------------------------REKCLGNLRFIAELG-RNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQK 949
            + RK RGILNK+TP+NF KL   V+N+ I+++  +  ++D++++KA  EP++  +Y+ LC  L     +FE   +    F+  LL KCQ +F+K       ++                              R + LGN+ FI EL     ++ E I+H CV +L+         N   D               + ECLC+ L+ +G  +D  + AKP +DQYF++  +++D     KT         S +RFM++DL DLR  NW+P++
Sbjct:    2 VMRKFRGILNKITPQNFKKLVEQVMNLEIDTAEKLEGIIDIVFEKAIREPRYCVVYANLCHCLLPIKVSFE---NKELVFKTILLNKCQKKFDKTYEHKTHNNTDQLVNEGLSPMFSRKKKHPSEQEEYEMWERRRTLGNIIFIGELFILKKILTENIMHTCVWKLI---------NRTDDE--------------SLECLCELLSTVGKDLD-HDIAKPRMDQYFRQFNKIID---SKKTS--------SCVRFMIQDLRDLRLSNWVPRQ 235          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Medaka
Match: eif4g2b (eukaryotic translation initiation factor 4 gamma 2 [Source:NCBI gene;Acc:101156233])

HSP 1 Score: 186.422 bits (472), Expect = 8.042e-48
Identity = 115/292 (39.38%), Postives = 169/292 (57.88%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSS-------NSTTFRNALLIKCQYEFEKNLPFCYIDD----------------VREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELI 1012
            K++   I RK+RGILNK+TPE FDKL L++LN+G++S  V+  ++ L+  KA  EPK+++LY++LCLRL +D PNF+  S+        STTFR  L+ K Q EFE       I D                 + K LGN++FI ELG+  L+ E ILH+C+K LL  + +      + D  E+             ECLCQ +  +G  +D  EKAK L+DQYF RM+ L+          NNK  LP+RIRF+++D ++LR+ NW+P+KA      + PK ++QIR++ +
Sbjct:   49 KERHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVDSKLVLKGVILLIVDKALEEPKYSSLYAQLCLRLAEDAPNFDGPSTEIQTSQKQSTTFRRLLISKLQDEFENRARNVEIYDKHDNPLTSEEEEQHAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKKRV----QLKDMGED------------LECLCQIMRTVGPRLD-HEKAKSLMDQYFGRMRSLM----------NNK-ELPARIRFLLQDTVELRENNWVPRKA---FIDNGPKTINQIRQDAV 309          

HSP 2 Score: 86.2705 bits (212), Expect = 1.449e-16
Identity = 66/221 (29.86%), Postives = 116/221 (52.49%), Query Frame = 2
Query: 2348 DSQLTNQLVKESGLSIYSTIPDEIKTNAD-IITLFLDPNLSYLVPEYALKQTLD-QIPKNFDIFSSSPNSDSDKLLNWILENIG----SEKQAMEFTVIWLLEFVLAQLFQSSDSGKST---KDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYLK 2983
            D +    L ++S +++   +P EI  N D ++ +     LS+L P   L++ L  QI       ++ P+  S  +  WI +NI     ++K  +   +   L+++  +L  +      T   K+ +E EK++     P+++ +L   +  E Q++ L  LQ   N +  PKG+LLR F+ FYD+E+I E  +  WK D+ +  P KGKALF+VN+WL +L+
Sbjct:  660 DREWLTDLFQQSKVNMQRMLP-EIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQI-------TADPSPQS--IYKWIKDNISPKLHTDKGFVNILMTSFLQYIHQELCMAEGDDPLTAPSKEQLEQEKNLLLAFKPVMQKFLH--DHTELQVSALYALQVHCNASGFPKGMLLRYFVHFYDMEIIEEEAFLAWKEDIAQEFPGKGKALFQVNQWLTWLE 868          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Medaka
Match: eif4g2b (eukaryotic translation initiation factor 4 gamma 2 [Source:NCBI gene;Acc:101156233])

HSP 1 Score: 186.422 bits (472), Expect = 9.451e-48
Identity = 116/293 (39.59%), Postives = 170/293 (58.02%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSS-------NSTTFRNALLIKCQYEFEKNLPFCYIDD----------------VREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDE-PKLLSQIREELI 1012
            K++   I RK+RGILNK+TPE FDKL L++LN+G++S  V+  ++ L+  KA  EPK+++LY++LCLRL +D PNF+  S+        STTFR  L+ K Q EFE       I D                 + K LGN++FI ELG+  L+ E ILH+C+K LL  + +      + D  E+             ECLCQ +  +G  +D  EKAK L+DQYF RM+ L+          NNK  LP+RIRF+++D ++LR+ NW+P+KA     +D  PK ++QIR++ +
Sbjct:   96 KERHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVDSKLVLKGVILLIVDKALEEPKYSSLYAQLCLRLAEDAPNFDGPSTEIQTSQKQSTTFRRLLISKLQDEFENRARNVEIYDKHDNPLTSEEEEQHAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKKRV----QLKDMGED------------LECLCQIMRTVGPRLD-HEKAKSLMDQYFGRMRSLM----------NNK-ELPARIRFLLQDTVELRENNWVPRKA----FIDNGPKTINQIRQDAV 356          

HSP 2 Score: 86.2705 bits (212), Expect = 1.521e-16
Identity = 66/221 (29.86%), Postives = 116/221 (52.49%), Query Frame = 2
Query: 2348 DSQLTNQLVKESGLSIYSTIPDEIKTNAD-IITLFLDPNLSYLVPEYALKQTLD-QIPKNFDIFSSSPNSDSDKLLNWILENIG----SEKQAMEFTVIWLLEFVLAQLFQSSDSGKST---KDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYLK 2983
            D +    L ++S +++   +P EI  N D ++ +     LS+L P   L++ L  QI       ++ P+  S  +  WI +NI     ++K  +   +   L+++  +L  +      T   K+ +E EK++     P+++ +L   +  E Q++ L  LQ   N +  PKG+LLR F+ FYD+E+I E  +  WK D+ +  P KGKALF+VN+WL +L+
Sbjct:  713 DREWLTDLFQQSKVNMQRMLP-EIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQI-------TADPSPQS--IYKWIKDNISPKLHTDKGFVNILMTSFLQYIHQELCMAEGDDPLTAPSKEQLEQEKNLLLAFKPVMQKFLH--DHTELQVSALYALQVHCNASGFPKGMLLRYFVHFYDMEIIEEEAFLAWKEDIAQEFPGKGKALFQVNQWLTWLE 921          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Medaka
Match: eif4g2a (eukaryotic translation initiation factor 4 gamma 2 [Source:NCBI gene;Acc:101163400])

HSP 1 Score: 184.111 bits (466), Expect = 2.778e-47
Identity = 121/312 (38.78%), Postives = 176/312 (56.41%), Query Frame = 2
Query:  224 ISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNS-------TTFRNALLIKCQYEFE---KNL--------PFCYIDD-----VREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDE-PKLLSQIREELIAPEGDGRLFVCEFHEVKKYEKIMKN 1087
            I RK+RGILNK+TPE FDKL L++LN+G++S  V+  ++ L+  KA  EPK++ LY++LCLRL +D PNFE  S  S       TTFR  L+ K Q EFE   +N+        P    ++      + K LGN++FI ELG+  L+ E ILH C+K LL  + +      + D  E+             ECLCQ +  +G  +D  EKAK L+DQYF RMK L          +NNK  LP+RIRF++++  +LR  NW+P+KA     VD  PK ++Q+R++ +   G   +F+   ++  + E  M N
Sbjct:   53 IFRKVRGILNKLTPEKFDKLCLELLNVGVDSKLVLKGIILLIVDKALEEPKYSQLYAQLCLRLSEDAPNFEDPSEESQSTQKQNTTFRRLLISKLQDEFENRSRNVDLFDKHDNPLTSEEEEQRSVAKLKMLGNIKFIGELGKLDLIHESILHRCIKTLLEKKKRV----QLKDMGED------------LECLCQIMKTVGPKLD-HEKAKSLVDQYFGRMKSL----------SNNK-ELPARIRFLLQNTAELRDNNWVPRKA----YVDNGPKTINQVRQDAVKDLG---VFIPPSNDAMRNEFFMDN 329          

HSP 2 Score: 83.9593 bits (206), Expect = 6.757e-16
Identity = 64/220 (29.09%), Postives = 110/220 (50.00%), Query Frame = 2
Query: 2348 DSQLTNQLVKESGLSIYSTIPDEIKTNAD-IITLFLDPNLSYLVPEYAL-KQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIG----SEKQAMEFTVIWLLEFVLAQLFQSSDS---GKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYL 2980
            D +   +L ++S +++   +P EI  N D ++ +     LS+L P   L K+ L QI         SP S    +  WI +NI     +++  +   +   L+++  ++    D       +K+ ++ EK       P+++ +L   +    Q++ L  LQ   NT   PKG+LLR F+  YD+E+I E  +  WK D+ +  P KGKALF+VN+WL +L
Sbjct:  615 DREWLTELFQQSTVNMLKMLP-EIDQNKDRMLEILEGKGLSFLFPLMKLEKELLKQIQ-----VDPSPQS----IYKWIKDNISPKLHTDRGFVNILITSFLQYIAYEINPDDDEEQFASPSKEQLDEEKQKLLAFKPVMQKFLH--DHINLQVSALYALQVHCNTKGFPKGMLLRYFVNLYDMEIIEEEAFLSWKEDLTQEYPGKGKALFQVNQWLTWL 822          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Medaka
Match: eif4g3a (eukaryotic translation initiation factor 4 gamma 3 [Source:NCBI gene;Acc:105354159])

HSP 1 Score: 140.969 bits (354), Expect = 3.454e-33
Identity = 94/299 (31.44%), Postives = 150/299 (50.17%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDV--------------------------------REKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREE 1006
            + QE+   R++R ILNK+TP+ F++L   V ++ I++   +  ++DL+++KA +EP F+  Y  +C  L           +++  FR  LL +CQ EFEK+     +DDV                                R + +GN++FI EL +  ++ E I+H+CV +LL             +H E            + ECLC+ LT IG  +D  EKAKP +DQYF +M++++    E KT         SRIRFM++D++DLR  NW+ ++A Q      PK + QI +E
Sbjct:  897 RTQELF--RRVRSILNKLTPQKFNQLMKQVTDLTIDTEERLKGVIDLVFEKAIDEPGFSVAYGNMCRCLATLKVQMTDKPNSTVNFRKLLLNRCQKEFEKD----KVDDVVFERKQKELDSAASTTERERLQEELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLK------------NHDEE-----------SLECLCRLLTTIGKDLD-FEKAKPRMDQYFNQMEKIVK---ERKTS--------SRIRFMLQDVIDLRLHNWVSRRADQ-----GPKTIEQIHKE 1149          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Medaka
Match: eif4g3a (eukaryotic translation initiation factor 4 gamma 3 [Source:NCBI gene;Acc:105354159])

HSP 1 Score: 140.969 bits (354), Expect = 3.619e-33
Identity = 94/299 (31.44%), Postives = 150/299 (50.17%), Query Frame = 2
Query:  206 KDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDV--------------------------------REKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREE 1006
            + QE+   R++R ILNK+TP+ F++L   V ++ I++   +  ++DL+++KA +EP F+  Y  +C  L           +++  FR  LL +CQ EFEK+     +DDV                                R + +GN++FI EL +  ++ E I+H+CV +LL             +H E            + ECLC+ LT IG  +D  EKAKP +DQYF +M++++    E KT         SRIRFM++D++DLR  NW+ ++A Q      PK + QI +E
Sbjct:  858 RTQELF--RRVRSILNKLTPQKFNQLMKQVTDLTIDTEERLKGVIDLVFEKAIDEPGFSVAYGNMCRCLATLKVQMTDKPNSTVNFRKLLLNRCQKEFEKD----KVDDVVFERKQKELDSAASTTERERLQEELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLK------------NHDEE-----------SLECLCRLLTTIGKDLD-FEKAKPRMDQYFNQMEKIVK---ERKTS--------SRIRFMLQDVIDLRLHNWVSRRADQ-----GPKTIEQIHKE 1110          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Planmine SMEST
Match: SMESG000061587.1 (SMESG000061587.1)

HSP 1 Score: 1622.45 bits (4200), Expect = 0.000e+0
Identity = 931/933 (99.79%), Postives = 933/933 (100.00%), Query Frame = 2
Query:  194 LYISKDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDVREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELIAPEGDGRLFVCEFHEVKKYEKIMKNYDYKQQMGNGESKNYGVSASNKGSFNRVEEFNSNGFNHGXXXXXXXXXXXXXXADDDMDWRNNRIDGCWRTXXXXXXXXXXXXXXXXXXXXXXXTADDVWRKDGQQGXXXXXXXXXXXXXXXXXXXENQDKSHQNDSVNEDCVHXXXXXXXXXXXXXXXXXNINEIFALKKPKTLFEPDYIKETSNNEVYLGPVDKFKRPIIQINNNSLKNSAKCTVPTRQTEPAIKVSSTKSEKVTINKSQLAEYISEWLNSTEVISNISYTTVEAMLISILNACCYSNKFIENYFLPKLDEELISRIITNCCCGCXXXXXXXXXXXXXXXXXXXRLCQWIDRLINENLIPKEMMXXXXXXXXXXXXNEKKFSELTRENKSFEKNLVKIVANLMVHKHRFIDLSLLSRLVNDKNXXXXXXXXXXXXXXXDSQLTNQLVKESGLSIYSTIPDEIKTNADIITLFLDPNLSYLVPEYALKQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIGSEKQAMEFTVIWLLEFVLAQLFQSSDSGKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYLKNEE 2992
            LYISKDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDVREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELIAPEGDGRLFVCEFHEVKKYEKIMKNYDYKQQMGNGESKNYGVSASNKGSFNRVEEFNSNGFNHGNKYSLKNNYKSNNSADDDMDWRNNRIDGCWRTKSSNCGAANNNNNKIKKSPNGKPTADDVWRKDGQQGSNNSNPMMNLPPRMMRRLLENQDKSHQNDSVNEDCVHSTSSSSNSSTELSKFTSNINEIFALKKPKTLFEPDYIKETSNNEVYLGPVDKFKRPIIQINNNSLKNSAKCTVPTRQTEPAIKVSSTKSEKVTINKSQLAEYISEWLNSTEVISNISYTTVEAMLISILNACCYSNKFIENYFLPKLDEELISRIITNCCCGCSSTDDEDDDYNDNSSRSIDRLCQWIDRLINENLIPKEMMKLSVKSFL+SSLNEKKFSELTRENKSFEKNLVKIVANLMVHKHRFIDLSLLSRLVNDKNRFIIFLLILKRISIIDSQLTNQLVKESGLSIYSTIPDEIKTNADIITLFLDPNLSYLVPEYALKQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIGSEKQAMEFTVIWLLEFVLAQLFQSSDSGKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKW+QYLKNEE
Sbjct:   48 LYISKDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNSTTFRNALLIKCQYEFEKNLPFCYIDDVREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREELIAPEGDGRLFVCEFHEVKKYEKIMKNYDYKQQMGNGESKNYGVSASNKGSFNRVEEFNSNGFNHGNKYSLKNNYKSNNSADDDMDWRNNRIDGCWRTKSSNCGAANNNNNKIKKSPNGKPTADDVWRKDGQQGSNNSNPMMNLPPRMMRRLLENQDKSHQNDSVNEDCVHSTSSSSNSSTELSKFTSNINEIFALKKPKTLFEPDYIKETSNNEVYLGPVDKFKRPIIQINNNSLKNSAKCTVPTRQTEPAIKVSSTKSEKVTINKSQLAEYISEWLNSTEVISNISYTTVEAMLISILNACCYSNKFIENYFLPKLDEELISRIITNCCCGCSSTDDEDDDYNDNSSRSIDRLCQWIDRLINENLIPKEMMKLSVKSFLLSSLNEKKFSELTRENKSFEKNLVKIVANLMVHKHRFIDLSLLSRLVNDKNRFIIFLLILKRISIIDSQLTNQLVKESGLSIYSTIPDEIKTNADIITLFLDPNLSYLVPEYALKQTLDQIPKNFDIFSSSPNSDSDKLLNWILENIGSEKQAMEFTVIWLLEFVLAQLFQSSDSGKSTKDLIEIEKSVWKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFYDLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWIQYLKNEE 980          

HSP 2 Score: 92.4337 bits (228), Expect = 1.534e-18
Identity = 46/56 (82.14%), Postives = 51/56 (91.07%), Query Frame = 3
Query:    9 ARIGINSSPINSIAKIWTISLTFTKEIVARQLQLNAFLIRNFLLTVTI*INQYVLL 176
             RIGINSSPINSIAKIWTISLTF+KEIVARQLQLNAFLIRNFLLT+ I  +Q +L+
Sbjct:    3 CRIGINSSPINSIAKIWTISLTFSKEIVARQLQLNAFLIRNFLLTLYISKDQEILI 58          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Planmine SMEST
Match: SMESG000045452.1 (SMESG000045452.1)

HSP 1 Score: 91.2781 bits (225), Expect = 3.572e-18
Identity = 73/299 (24.41%), Postives = 140/299 (46.82%), Query Frame = 2
Query:  200 ISKDQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCK---DIPNFEPSSSNSTTFRNALLIKCQYEFEKNL-------------------PFC----------YIDDVREKCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIR 1000
            +S+ +E++  R+I+GILN++ P+NFD+   D++ + I +   ++ LV+ L+ KA  E  ++  ++++C  L     D+ + E       TFR+ LL KCQ  F   L                   P             I   +++  GN+RFI EL   G++  KI+  C+  LL+  ++A                       +  CLC+ L   G+ ++  +K K  ++  FK+++QL           +   ++ +R+RF + D++++R+  W  +K  Q   + +PK L++I+
Sbjct:  518 LSETEELI--RQIKGILNRIVPQNFDQCLDDLVLLKIGTHEGMTCLVNELFFKAVKEEAYSVTFAKICSYLASIKADVSDHE-----IVTFRSVLLQKCQAMFTTPLEEQLEKVRQDWLLKASNEKPKTKALMESDVDEQIKKAKDRYYGNIRFIGELYLKGVLITKIICFCIDNLLTKENEA----------------------DSLICLCKLLETCGAKLETEDKGKKKLNDSFKKLRQL-----------SESLFIETRVRFRILDIMEMRQKKWCLRKIQQDQKI-QPKTLAEIK 775          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Planmine SMEST
Match: SMESG000045255.1 (SMESG000045255.1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.636e-16
Identity = 76/296 (25.68%), Postives = 132/296 (44.59%), Query Frame = 2
Query:  221 LISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNSTTFRNALLIKCQYEFEKNLPF-----------------------CYIDDVRE-------KCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKR-MKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWI---PQKAGQRINVDEPKLLSQIREE 1006
            L+ R I+ ILNK+TPENF+    D++N+ I+    +  L+D ++ KA  E  ++++Y+R C  +         +   + +F+  LL  CQ  F+K L                          Y  D+ E       K  GN+RF +EL  +  +  KI+  C ++LL     +  NN++                   E  C+ + + G  ++K EK +   D+ F R M Q + L+            +  R+RF ++D++D+R+ NW     QKA + +    PK L +I+E+
Sbjct: 1033 LLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSN-------ARVGNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMF---SKDNNSL-------------------EAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVD--------IEQRLRFKLKDVVDMRERNWELRDIQKAMKSV----PKTLDEIKED 1287          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Planmine SMEST
Match: SMESG000040422.1 (SMESG000040422.1)

HSP 1 Score: 79.7221 bits (195), Expect = 8.957e-15
Identity = 73/297 (24.58%), Postives = 129/297 (43.43%), Query Frame = 2
Query:  209 DQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNSTTFRNALLIKCQYEFEKNLPF-----------------------CYIDDVRE-------KCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLD-LAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREE 1006
            D E  + R I+  LNK+TPENFD    ++    + S   ++IL D+++ KA  E  ++ +YS   +R+ K           ++ +++ LL KC+  F+K L                          Y  D  E       K  GN+RFI+EL   G++  +I+  CV  LL+     I                      + E +C+ L + G         K L +Q+   +K+ LD ++I +K+D      L  + +F ++D+LD++  +W   +  Q      PK L+++++E
Sbjct:  284 DLEANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSVRMVK-------PGEKTSDYKSMLLQKCKAMFDKPLKTQMEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQI----------------------SMEGVCKILQVTG---------KKLEEQHAVEVKKALDKMSILSKSDN-----LDLKTKFKLKDILDMKNRDW-EMREVQIAKSSVPKTLNELKKE 536          
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Planmine SMEST
Match: SMESG000005574.1 (SMESG000005574.1)

HSP 1 Score: 79.7221 bits (195), Expect = 9.870e-15
Identity = 73/297 (24.58%), Postives = 129/297 (43.43%), Query Frame = 2
Query:  209 DQEILISRKIRGILNKVTPENFDKLSLDVLNIGIESSAVISILVDLLYKKATNEPKFTALYSRLCLRLCKDIPNFEPSSSNSTTFRNALLIKCQYEFEKNLPF-----------------------CYIDDVRE-------KCLGNLRFIAELGRNGLVQEKILHECVKQLLSSRSKAIGNNTIPDHPENGEIDQRTWRYATKECLCQFLTLIGSYMDKSEKAKPLIDQYFKRMKQLLD-LAIEAKTDTNNKYYLPSRIRFMMEDLLDLRKINWIPQKAGQRINVDEPKLLSQIREE 1006
            D E  + R I+  LNK+TPENFD    ++ +  + S   ++IL D+++ KA  E  ++ +YS    R+ K           ++ +++ LL KC+  F+K L                          Y  D  E       K  GN+RFI+EL   G++  +I+  CV  LL+     I                      + E +C+ L + G         K L +Q+   +K+ LD ++I +K+D      L  + +F ++D+LD++  +W   +  Q      PK L+++++E
Sbjct:  278 DLEANLKRNIKATLNKMTPENFDLCFNEISSYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMVK-------PGEKTSDYKSMLLQKCKAMFDKPLKTQMEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQI----------------------SMEGVCKILQVTG---------KKLEEQHAVEVKKALDKMSILSKSDN-----LDLKTKFKLKDILDMKNRDW-EMREVQIAKSSVPKTLNELKKE 530          
The following BLAST results are available for this feature:
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EIF4G29.681e-5038.70eukaryotic translation initiation factor 4 gamma 2... [more]
EIF4G21.570e-4638.70eukaryotic translation initiation factor 4 gamma 2... [more]
EIF4G21.715e-4638.70eukaryotic translation initiation factor 4 gamma 2... [more]
EIF4G21.715e-4638.70eukaryotic translation initiation factor 4 gamma 2... [more]
EIF4G21.715e-4638.70eukaryotic translation initiation factor 4 gamma 2... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ifg-11.492e-1825.95Initiation Factor 4G (eIF4G) family [Source:UniPr... [more]
ifg-15.869e-1825.95Initiation Factor 4G (eIF4G) family [Source:UniPr... [more]
ifg-16.075e-1825.95Initiation Factor 4G (eIF4G) family [Source:UniPr... [more]
ifg-16.523e-1825.95Initiation Factor 4G (eIF4G) family [Source:UniPr... [more]
ifg-16.523e-1825.95Initiation Factor 4G (eIF4G) family [Source:UniPr... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NAT14.600e-3531.05gene:FBgn0010488 transcript:FBtr0334772[more]
eIF4G11.063e-2628.96gene:FBgn0023213 transcript:FBtr0289951[more]
eIF4G11.063e-2628.96gene:FBgn0023213 transcript:FBtr0089243[more]
eIF4G11.922e-2628.06gene:FBgn0023213 transcript:FBtr0112904[more]
NAT13.510e-2028.57gene:FBgn0010488 transcript:FBtr0087786[more]
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4g2b1.016e-4739.93eukaryotic translation initiation factor 4, gamma ... [more]
eif4g2b1.089e-4739.73eukaryotic translation initiation factor 4, gamma ... [more]
eif4g2a1.212e-4739.59eukaryotic translation initiation factor 4, gamma ... [more]
eif4g2b1.359e-4739.93eukaryotic translation initiation factor 4, gamma ... [more]
eif4g3b3.200e-3231.53eukaryotic translation initiation factor 4 gamma, ... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
safb5.636e-4636.83scaffold attachment factor B [Source:Xenbase;Acc:X... [more]
safb6.010e-4636.62scaffold attachment factor B [Source:Xenbase;Acc:X... [more]
safb6.554e-4636.62scaffold attachment factor B [Source:Xenbase;Acc:X... [more]
safb6.706e-4636.83scaffold attachment factor B [Source:Xenbase;Acc:X... [more]
safb7.412e-4636.62scaffold attachment factor B [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eif4g24.578e-4738.11eukaryotic translation initiation factor 4, gamma ... [more]
Eif4g24.677e-4738.11eukaryotic translation initiation factor 4, gamma ... [more]
Eif4g12.708e-3330.59eukaryotic translation initiation factor 4, gamma ... [more]
Eif4g12.897e-3330.59eukaryotic translation initiation factor 4, gamma ... [more]
Eif4g12.981e-3330.59eukaryotic translation initiation factor 4, gamma ... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q62448|IF4G2_MOUSE3.021e-4638.11Eukaryotic translation initiation factor 4 gamma 2... [more]
sp|Q5R7J9|IF4G2_PONAB7.541e-4638.70Eukaryotic translation initiation factor 4 gamma 2... [more]
sp|P78344|IF4G2_HUMAN7.541e-4638.70Eukaryotic translation initiation factor 4 gamma 2... [more]
sp|Q95L46|IF4G2_BOVIN7.541e-4638.70Eukaryotic translation initiation factor 4 gamma 2... [more]
sp|P79398|IF4G2_RABIT8.021e-4638.70Eukaryotic translation initiation factor 4 gamma 2... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DXK03.851e-5239.80Eukaryotic translation initiation factor 4 gamma 2... [more]
A0A1S3IAI07.034e-5241.82eukaryotic translation initiation factor 4 gamma 2... [more]
A0A293LZ711.923e-5137.93Eukaryotic translation initiation factor 4 gamma (... [more]
A0A1S8WJI61.991e-5138.96MIF4G domain protein OS=Opisthorchis viverrini OX=... [more]
A0A075A4S22.171e-5138.96W2 domain-containing protein OS=Opisthorchis viver... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4g2b3.070e-4739.38eukaryotic translation initiation factor 4, gamma ... [more]
eif4g2a5.635e-4638.23eukaryotic translation initiation factor 4, gamma ... [more]
eif4g3b8.157e-3331.86eukaryotic translation initiation factor 4 gamma 3... [more]
eif4g3b1.179e-3231.86eukaryotic translation initiation factor 4 gamma 3... [more]
eif4g3b1.378e-3231.86eukaryotic translation initiation factor 4 gamma 3... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eif4g2a8.229e-4435.46eukaryotic translation initiation factor 4, gamma ... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
TIF46321.615e-1324.17Translation initiation factor eIF4G; subunit of th... [more]
TIF46314.012e-1122.00Translation initiation factor eIF4G; subunit of th... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO317113.832e-5037.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331725.985e-3231.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO323416.597e-2729.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4g2b8.042e-4839.38eukaryotic translation initiation factor 4 gamma 2... [more]
eif4g2b9.451e-4839.59eukaryotic translation initiation factor 4 gamma 2... [more]
eif4g2a2.778e-4738.78eukaryotic translation initiation factor 4 gamma 2... [more]
eif4g3a3.454e-3331.44eukaryotic translation initiation factor 4 gamma 3... [more]
eif4g3a3.619e-3331.44eukaryotic translation initiation factor 4 gamma 3... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061587.11.534e-1899.79SMESG000061587.1[more]
SMESG000045452.13.572e-1824.41SMESG000045452.1[more]
SMESG000045255.11.636e-1625.68SMESG000045255.1[more]
SMESG000040422.18.957e-1524.58SMESG000040422.1[more]
SMESG000005574.19.870e-1524.58SMESG000005574.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001960 ID=SMED30001960|Name=Eukaryotic translation initiation factor 4 gamma 2|organism=Schmidtea mediterranea sexual|type=transcript|length=3697bp
GACATATTGCTAGAATTGGTATCAATTCTTCTCCAATAAATAGCATAGCT
AAAATCTGGACAATAAGTTTGACATTTACAAAAGAAATTGTAGCGAGGCA
ACTTCAATTAAATGCCTTTCTGATTCGCAATTTTCTTTTGACCGTAACCA
TTTAAATAAATCAATATGTACTGCTACTTCAAATCAAAATCAGTTATATA
TCAGCAAAGACCAAGAAATTTTAATTTCTAGAAAAATTAGAGGAATTTTG
AATAAAGTTACACCAGAAAATTTTGATAAATTATCTTTAGATGTACTTAA
CATTGGTATAGAGTCAAGTGCTGTTATTTCTATTTTAGTAGATTTACTGT
ATAAGAAAGCAACAAATGAACCAAAATTTACTGCACTTTATTCCCGATTA
TGCCTAAGATTGTGTAAAGATATTCCAAATTTTGAACCCTCATCTAGTAA
TAGTACTACATTTAGAAATGCTCTTTTAATTAAATGTCAATATGAATTCG
AAAAAAATTTACCTTTTTGCTATATTGATGATGTGCGTGAAAAATGTTTG
GGTAACTTGCGTTTTATCGCCGAGTTGGGTCGAAATGGATTGGTGCAAGA
GAAAATTCTGCATGAATGCGTCAAACAACTTCTATCCAGTCGCAGCAAAG
CGATTGGAAATAATACAATTCCAGATCATCCAGAAAATGGAGAAATTGAT
CAAAGAACTTGGAGGTATGCTACCAAAGAGTGTCTATGTCAATTCTTGAC
ACTCATTGGTAGCTATATGGATAAGAGTGAAAAAGCAAAGCCTTTAATCG
ATCAATACTTTAAACGAATGAAGCAGTTGCTGGATTTGGCTATAGAAGCC
AAAACGGATACGAATAATAAATATTATCTACCATCAAGGATACGGTTTAT
GATGGAAGATTTACTGGATTTAAGAAAAATCAACTGGATTCCTCAAAAAG
CTGGGCAAAGAATCAATGTCGACGAGCCAAAATTATTGAGTCAAATTCGT
GAAGAGTTAATAGCACCAGAAGGTGATGGGCGATTGTTTGTCTGTGAATT
CCATGAAGTGAAAAAATATGAGAAAATTATGAAAAATTATGACTATAAAC
AACAAATGGGTAACGGTGAATCAAAGAATTACGGTGTTTCAGCATCCAAT
AAGGGATCATTTAACAGAGTAGAAGAATTTAATTCAAACGGTTTTAACCA
CGGGAATAAATATTCGTTGAAGAACAATTACAAAAGTAATAATAGCGCAG
ATGACGATATGGATTGGAGAAATAATAGAATAGACGGATGTTGGAGAACA
AAATCTTCAAATTGCGGAGCGGCTAATAATAATAATAATAAAATTAAAAA
ATCTCCGAATGGAAAGCCAACAGCCGATGATGTATGGCGTAAAGACGGAC
AACAGGGATCAAACAATTCTAATCCAATGATGAATTTGCCTCCAAGAATG
ATGCGGAGACTTCTTGAAAATCAGGACAAATCTCATCAAAATGATTCCGT
CAATGAAGACTGTGTTCATTCAACAAGTTCTTCGTCAAACAGTTCAACAG
AACTGTCCAAATTTACCAGCAATATTAATGAAATATTTGCACTGAAAAAA
CCAAAAACATTATTTGAGCCTGATTATATAAAGGAAACCTCCAACAATGA
AGTCTACTTAGGTCCCGTTGACAAATTTAAACGTCCAATCATTCAGATAA
ACAATAATTCCTTGAAAAATTCTGCAAAATGCACCGTACCAACAAGACAA
ACAGAACCTGCTATCAAGGTTTCTTCCACAAAATCGGAAAAAGTGACGAT
TAATAAATCTCAATTGGCAGAATATATATCGGAATGGTTGAACTCGACGG
AAGTCATCAGCAATATCTCTTATACGACTGTTGAAGCAATGCTAATATCA
ATACTAAATGCCTGTTGCTATAGCAATAAATTCATAGAAAATTATTTTCT
GCCAAAACTCGATGAAGAATTGATATCTAGAATAATCACTAATTGCTGCT
GCGGCTGCTCCAGCACAGATGATGAAGATGATGATTATAATGATAATAGT
AGTAGATCTATTGATCGTCTGTGTCAATGGATTGACAGATTAATTAATGA
AAATCTCATTCCCAAGGAGATGATGAAATTATCTGTGAAATCTTTCTTGG
TATCATCTTTAAATGAGAAAAAGTTTTCCGAGTTGACAAGAGAAAATAAA
TCATTTGAAAAGAATTTAGTTAAAATTGTGGCTAATTTAATGGTTCATAA
ACATAGATTTATTGATTTATCACTACTTTCCCGCTTGGTGAATGATAAAA
ATCGTTTTATCATTTTTCTATTGATCCTGAAGCGCATAAGCATTATCGAT
AGCCAATTGACCAATCAGCTGGTAAAGGAATCCGGATTATCGATCTATTC
GACAATTCCTGACGAAATAAAAACAAATGCAGATATAATAACGTTATTTC
TGGATCCAAATTTGAGCTATCTCGTTCCAGAGTATGCTTTGAAACAGACC
CTCGATCAGATCCCTAAAAATTTTGATATTTTTTCTTCATCTCCAAATAG
TGATAGTGACAAGCTTTTGAATTGGATTTTGGAAAATATTGGCTCAGAAA
AACAGGCTATGGAATTCACTGTAATATGGCTGCTCGAATTTGTTCTTGCC
CAATTGTTTCAGTCGTCTGACTCTGGTAAATCTACAAAAGATTTAATTGA
AATAGAAAAATCGGTTTGGAAAAATCTGTCACCAATAATCGAACATTATT
TATCCATTGATAATTCCGAGGAAGATCAATTGACAATTCTCTGCACTCTG
CAACAATTCTGGAATACCAACAAGCAACCTAAAGGTGTCCTTCTCAGATG
CTTTATTTGTTTCTATGATCTGGAGTTGATTGCGGAAAATGTTTATTTCT
TATGGAAGAATGACGTGAACCGAAACATTCCAGAAAAGGGAAAAGCGTTA
TTTGAGGTTAATAAATGGTTACAATATCTTAAAAACGAAGAATAAAGCAG
AATGAAAGAAAATTATTCGAAAATTTAATTTGGAAACATCAAAATTTAGT
TCTTTATGAACTTCATAATCTTTGGCACAATCGATATTTTAATTGAATAT
TTTATTAATAGTTTAGCATTCACATTTTTCTATCTTTATGTTTGAATTTT
CCTAGTCATTTTGAGTGTTATTTCCTTCTATTCGTATGTCTCATTTTGAT
TGGTTATGCGATATTGTGGCGCATCGGGTGTGATTCCTCATTATATATAT
ATATCCCTCATTACTATTGCTATTAATAACAATATTATTATCATTATCAT
CGATATAATCGCCATCATTTGTGCTATCTAACAGCATTATTATTTTTATT
ATTTTTTATTATTTTCACGTGACAAAGTCGACGACATTGCTAATAATGAG
ACTTGCTAAATTTGTCTTGTAAATTTTCTGATTTATTGCTAATAATGCAA
AATTGTTAAAAATTTAATGATTATTCTTATTTGTTTTTTATAGGTAATTA
TAAATTTTACATTTTGTATCACAATAAACGTTTTGATTGATCGGTTGTTT
CAGTGAAATTGCAGGATTTTATTGCGCATTGTTATGATTTAATTATTTTC
TTGGGACACTTGGAGAAATAGAATGGTTGCTAATGTGATCTGGCTCCAAG
TGTGTTTTAATAACAAGGACTATTGATCACTACAAATACAATCTAGC
back to top

protein sequence of SMED30001960-orf-1

>SMED30001960-orf-1 ID=SMED30001960-orf-1|Name=SMED30001960-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=743bp
MDKSEKAKPLIDQYFKRMKQLLDLAIEAKTDTNNKYYLPSRIRFMMEDLL
DLRKINWIPQKAGQRINVDEPKLLSQIREELIAPEGDGRLFVCEFHEVKK
YEKIMKNYDYKQQMGNGESKNYGVSASNKGSFNRVEEFNSNGFNHGNKYS
LKNNYKSNNSADDDMDWRNNRIDGCWRTKSSNCGAANNNNNKIKKSPNGK
PTADDVWRKDGQQGSNNSNPMMNLPPRMMRRLLENQDKSHQNDSVNEDCV
HSTSSSSNSSTELSKFTSNINEIFALKKPKTLFEPDYIKETSNNEVYLGP
VDKFKRPIIQINNNSLKNSAKCTVPTRQTEPAIKVSSTKSEKVTINKSQL
AEYISEWLNSTEVISNISYTTVEAMLISILNACCYSNKFIENYFLPKLDE
ELISRIITNCCCGCSSTDDEDDDYNDNSSRSIDRLCQWIDRLINENLIPK
EMMKLSVKSFLVSSLNEKKFSELTRENKSFEKNLVKIVANLMVHKHRFID
LSLLSRLVNDKNRFIIFLLILKRISIIDSQLTNQLVKESGLSIYSTIPDE
IKTNADIITLFLDPNLSYLVPEYALKQTLDQIPKNFDIFSSSPNSDSDKL
LNWILENIGSEKQAMEFTVIWLLEFVLAQLFQSSDSGKSTKDLIEIEKSV
WKNLSPIIEHYLSIDNSEEDQLTILCTLQQFWNTNKQPKGVLLRCFICFY
DLELIAENVYFLWKNDVNRNIPEKGKALFEVNKWLQYLKNEE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR003307W2_domain
IPR003890MIF4G-like_typ-3
IPR016021MIF4-like_sf
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003723RNA binding
GO:0005488binding
GO:0003743translation initiation factor activity
Vocabulary: biological process
TermDefinition
GO:0006413translational initiation
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003307W2 domainSMARTSM00515542_3coord: 659..742
e-value: 3.0E-5
score: 33.4
IPR003307W2 domainPFAMPF02020W2coord: 670..742
e-value: 2.6E-9
score: 37.1
IPR003307W2 domainPROSITEPS51363W2coord: 590..742
score: 17.182
IPR016021MIF4G-like domain superfamilyGENE3DG3DSA:1.25.40.180coord: 588..740
e-value: 1.2E-28
score: 102.2
IPR016021MIF4G-like domain superfamilyGENE3DG3DSA:1.25.40.180coord: 1..67
e-value: 2.6E-10
score: 41.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 236..262
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 246..262
NoneNo IPR availablePANTHERPTHR23253EUKARYOTIC TRANSLATION INITIATION FACTOR 4 GAMMAcoord: 4..738
NoneNo IPR availablePANTHERPTHR23253:SF30EUKARYOTIC TRANSLATION INITIATION FACTOR 4 GAMMA 2coord: 4..738
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 6..63
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 597..742