Protocadherin-9

Overview
NameProtocadherin-9
Smed IDSMED30001935
Length (bp)3244
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin-9 (SMED30001935) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin-9 (SMED30001935) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin-9 (SMED30001935) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin-9 (SMED30001935) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001935

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30001935SMESG000048913.1 SmedASXL_010092SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30001935SMESG000048913.1 dd_Smed_v4_14523_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001935SMESG000048913.1 dd_Smed_v4_14523_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30001935SMESG000048913.1 dd_Smed_v4_14523_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30001935SMESG000048913.1 dd_Smed_v6_14523_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDHA11 (protocadherin alpha 11 [Source:HGNC Symbol;Acc:HGNC:8665])

HSP 1 Score: 208.764 bits (530), Expect = 2.412e-55
Identity = 184/678 (27.14%), Postives = 315/678 (46.46%), Query Frame = 1
Query:  244 NLKKYELIQ---------HYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDP-IQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPN-YLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVH-----SSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFS--------IPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLF 2184
             L+  EL+Q         H ++  ++   G L     IDRE LC  S  C        LE+ +        ++P +  +  + ++DINDN P F    Q + I E     +   L  A D D  + A++ Y  + S+N +   FS+      K   ++ LI+ +++     P +   LTA D      + ++RL+V+V D+ND+ PE+  S+Y + + EN   ++++    ATD D  V G+V+YS+  I      K    +LFT+D   G++++NG LD+EE   + Y + + A D GTP ++   T  ++I D NDN P + +    + V E+  P+  +   +V D D   NG++ C +      F L  +  N    Y + L   LD E      L++  +DGG P+L +  R++V V DVNDN   F Q    + + EN P G  I  +S  D D +  + V++S+V       +  S+V++   +G +   +  D E  +   F+V   +      +  V + + + D NDN P   A  + S        +P +      + +VRA+D D G N  +SY         R  F V  Y GEI     LD      H++ ++ +D G P +++++ TV +++++S   P    +   A   S +   +D N++
Sbjct:   53 GLELAELVQRLFRVASKTHGDLLEVNLQNGILFVNSRIDREELCGQSAECSIH-----LEVIV--------DRPLQVFHVNVEVKDINDNPPVFSLREQKLLIAESKQSDSRFPLEGASDADIEENALLTY--RLSKNEY---FSLDSPTNGKQIKRLSLILKKSLDREKTPELNLLLTATDGGKPELTGTVRLLVQVLDVNDNDPEFDKSEYKVSLMENAAKETLVLKLNATDRDEGVNGEVTYSLMSI------KPNGRHLFTLDQNNGEVRVNGTLDYEE--NKFYKIEVQATDKGTPPMAGHCTVWVEILDTNDNSPEVAVTSLSLPVREDAQPSTVIALISVSDRDSGVNGQVTCSLTPHVP-FKLVSTFKNY---YSLVLDSALDRENVWAYELVVTARDGGSPSLWATARVSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSARDADAQENALVSYSLVERRLGDRALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLSSNVTLQVFVLDENDNAPALLATQAGSAGGAVNKLVPRSVGAGHVVAKVRAVDADSGYNAWLSYELQPAAGGSRIPFRVGLYTGEISTTRALDEADSPRHRLLVLVKDHGEP-ALTATATVLVSLVESGQAPKASSR-TLAGAASPEAALVDVNVY 698          

HSP 2 Score: 62.003 bits (149), Expect = 5.351e-9
Identity = 76/326 (23.31%), Postives = 148/326 (45.40%), Query Frame = 1
Query: 1507 IRISIPENIPIGSEIIRIS---TIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRE----TKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTV---SNYGEIRLFHM-----LDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTL----SCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQI 2424
            +  S+ E    G+ + RI+    ++L +  +  F +   ++   + ++  NG L  N   DRE       E +  ++V+    +       V + + DINDN PVF        I E+   D       A D D+ EN  ++Y    ++S    YF++   +N  +I+   +     LD +K     + + A D G+P  ++ +  + + VLD N++ PEF+K  + ++L    + +T  +  N   +TD+D+   N ++ Y L +IKP   + LF +D+  G + +       +++ N   K+E++ +  D   P   G   + +
Sbjct:   31 LHYSVSEEAKHGTFVGRIAQDLGLELAELVQRLFRVASKTHGDLLEVNLQNGILFVNSRIDREELCGQSAECSIHLEVIVDRPLQ---VFHVNVEVKDINDNPPVFSLREQKLLIAESKQSDSRFPLEGASDADIEENALLTY----RLSKNE-YFSLDSPTNGKQIKRLSLILKKSLDREKTPELNLLLTATDGGKP-ELTGTVRLLVQVLDVNDNDPEFDKSEYKVSLMENAAKETLVLKLN---ATDRDEG-VNGEVTYSLMSIKP-NGRHLFTLDQNNGEVRVN---GTLDYEENKFYKIEVQAT--DKGTPPMAGHCTVWV 337          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDHA11 (protocadherin alpha 11 [Source:HGNC Symbol;Acc:HGNC:8665])

HSP 1 Score: 209.534 bits (532), Expect = 4.366e-55
Identity = 184/678 (27.14%), Postives = 315/678 (46.46%), Query Frame = 1
Query:  244 NLKKYELIQ---------HYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDP-IQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPN-YLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVH-----SSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFS--------IPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLF 2184
             L+  EL+Q         H ++  ++   G L     IDRE LC  S  C        LE+ +        ++P +  +  + ++DINDN P F    Q + I E     +   L  A D D  + A++ Y  + S+N +   FS+      K   ++ LI+ +++     P +   LTA D      + ++RL+V+V D+ND+ PE+  S+Y + + EN   ++++    ATD D  V G+V+YS+  I      K    +LFT+D   G++++NG LD+EE   + Y + + A D GTP ++   T  ++I D NDN P + +    + V E+  P+  +   +V D D   NG++ C +      F L  +  N    Y + L   LD E      L++  +DGG P+L +  R++V V DVNDN   F Q    + + EN P G  I  +S  D D +  + V++S+V       +  S+V++   +G +   +  D E  +   F+V   +      +  V + + + D NDN P   A  + S        +P +      + +VRA+D D G N  +SY         R  F V  Y GEI     LD      H++ ++ +D G P +++++ TV +++++S   P    +   A   S +   +D N++
Sbjct:   53 GLELAELVQRLFRVASKTHGDLLEVNLQNGILFVNSRIDREELCGQSAECSIH-----LEVIV--------DRPLQVFHVNVEVKDINDNPPVFSLREQKLLIAESKQSDSRFPLEGASDADIEENALLTY--RLSKNEY---FSLDSPTNGKQIKRLSLILKKSLDREKTPELNLLLTATDGGKPELTGTVRLLVQVLDVNDNDPEFDKSEYKVSLMENAAKETLVLKLNATDRDEGVNGEVTYSLMSI------KPNGRHLFTLDQNNGEVRVNGTLDYEE--NKFYKIEVQATDKGTPPMAGHCTVWVEILDTNDNSPEVAVTSLSLPVREDAQPSTVIALISVSDRDSGVNGQVTCSLTP-HVPFKLVSTFKNY---YSLVLDSALDRENVWAYELVVTARDGGSPSLWATARVSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSARDADAQENALVSYSLVERRLGDRALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLSSNVTLQVFVLDENDNAPALLATQAGSAGGAVNKLVPRSVGAGHVVAKVRAVDADSGYNAWLSYELQPAAGGSRIPFRVGLYTGEISTTRALDEADSPRHRLLVLVKDHGEP-ALTATATVLVSLVESGQAPKASSR-TLAGAASPEAALVDVNVY 698          

HSP 2 Score: 61.6178 bits (148), Expect = 7.420e-9
Identity = 71/308 (23.05%), Postives = 142/308 (46.10%), Query Frame = 1
Query: 1507 IRISIPENIPIGSEIIRIS---TIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRE----TKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYF--TVSNYGEIRLFHM-----LDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTL----SCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVS 2373
            +  S+ E    G+ + RI+    ++L +  +  F +   ++   + ++  NG L  N   DRE       E +  ++V+    +       V + + DINDN PVF        I E+   D       A D D+ EN  ++Y    ++S   ++   + +N  +I+   +     LD +K     + + A D G+P  ++ +  + + VLD N++ PEF+K  + ++L    + +T  +  N   +TD+D+   N ++ Y L +IKP   + LF +D+  G + +       +++ N   K+E++ +
Sbjct:   31 LHYSVSEEAKHGTFVGRIAQDLGLELAELVQRLFRVASKTHGDLLEVNLQNGILFVNSRIDREELCGQSAECSIHLEVIVDRPLQ---VFHVNVEVKDINDNPPVFSLREQKLLIAESKQSDSRFPLEGASDADIEENALLTY----RLSKNEYFSLDSPTNGKQIKRLSLILKKSLDREKTPELNLLLTATDGGKP-ELTGTVRLLVQVLDVNDNDPEFDKSEYKVSLMENAAKETLVLKLN---ATDRDEG-VNGEVTYSLMSIKP-NGRHLFTLDQNNGEVRVN---GTLDYEENKFYKIEVQAT 322          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDHA12 (protocadherin alpha 12 [Source:HGNC Symbol;Acc:HGNC:8666])

HSP 1 Score: 195.667 bits (496), Expect = 6.399e-51
Identity = 163/633 (25.75%), Postives = 294/633 (46.45%), Query Frame = 1
Query:  268 QHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-PNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHS-----SNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFS--------IPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHP 2112
            +H ++  ++   G L     IDRE LC  S  C        LE+ +        ++P +  +  + ++DINDN P F E  Q + ++E +P+ +   L  A D D    +++ Y +  +EN F L     +DK       ++ ++ R  + + + +   +       + S+++ + V D+ND+ P +    Y + + EN+  D+ +    A+D D  + G++SY I  I+           +F+I+  TG++++ G LDFEE     Y + + A D G PS++  +  ++++ D NDN P + +    + V+E+      +   +V D D  ANG++ C +      F L  +  N    Y + L   LD E  S   L++  +DGG P+L +  R++V V DVNDN   F Q    + + EN P G  I  +S  D D  K + V++S+V       +  S+V++   +G +   +  D E  +   F+V   +         V + + + D NDN P   A  + S        +P +      + +VRA+D D G N  +SY            F V  Y GEI    +LD      H++ ++ +D G P +++S+ TV ++++++   P
Sbjct:   70 RHGDLLEVNLQNGILFVNSRIDREKLCGRSAECSIH-----LEVIV--------DRPLQVFHVDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEGASDADIGVNSLLTYALSLNEN-FELKIKTKKDKSILPELVLRKLLDREQTPKLNLLLMVIDGGKPELTGSVQIQITVLDVNDNGPAFDKPSYKVVLSENVQNDTRVIQLNASDPDEGLNGEISYGIKMIL-----PVSEKCMFSINPDTGEIRIYGELDFEE--NNAYEIQVNAIDKGIPSMAGHSMVLVEVLDVNDNVPEVMVTSLSLPVQEDAQVGTVIALISVSDRDSGANGQVICSLTPHVP-FKLVSTYKNY---YSLVLDSALDRESVSAYELVVTARDGGSPSLWATARVSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSAWDADAQKNALVSYSLVERRVGEHALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLGSNVTLQVFVLDENDNAPALLATPAGSAGGAVSELVPRSVGAGHVVAKVRAVDADSGYNAWLSYELQPAAVGAHIPFHVGLYTGEISTTRILDEADAPRHRLLVLVKDHGEP-ALTSTATVLVSLVENGQAP 676          

HSP 2 Score: 73.1738 bits (178), Expect = 2.261e-12
Identity = 72/288 (25.00%), Postives = 131/288 (45.49%), Query Frame = 1
Query: 1597 FSIVHSSNCSFVNIDTNNGYLTTNEMFDRET----KDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTV------SNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNL-FPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQI 2424
            F +    +   + ++  NG L  N   DRE       E +  ++V+    +       V + + DINDN PVF +      + E+  +D       A D D+G N  ++Y       N+ F   +      S   E+ L  +LD ++     + ++  D G+P  ++ S  + ITVLD N++ P F+KP + + LS   Q   + +   ++D D+   N +++Y +  I P+  K +F I+  TG I +     + +F+ NN    EI+V+  D   P   G +++ +
Sbjct:   64 FRVASKRHGDLLEVNLQNGILFVNSRIDREKLCGRSAECSIHLEVIVDRPLQ---VFHVDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEGASDADIGVNSLLTYALS---LNENFELKIKTKKDKSILPELVLRKLLDREQTPKLNLLLMVIDGGKP-ELTGSVQIQITVLDVNDNGPAFDKPSYKVVLSENVQNDTRVIQLNASDPDEG-LNGEISYGIKMILPVSEKCMFSINPDTGEIRIY---GELDFEENN--AYEIQVNAIDKGIPSMAGHSMVLV 338          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDHA12 (protocadherin alpha 12 [Source:HGNC Symbol;Acc:HGNC:8666])

HSP 1 Score: 195.282 bits (495), Expect = 6.945e-51
Identity = 163/633 (25.75%), Postives = 294/633 (46.45%), Query Frame = 1
Query:  268 QHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-PNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHS-----SNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFS--------IPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHP 2112
            +H ++  ++   G L     IDRE LC  S  C        LE+ +        ++P +  +  + ++DINDN P F E  Q + ++E +P+ +   L  A D D    +++ Y +  +EN F L     +DK       ++ ++ R  + + + +   +       + S+++ + V D+ND+ P +    Y + + EN+  D+ +    A+D D  + G++SY I  I+           +F+I+  TG++++ G LDFEE     Y + + A D G PS++  +  ++++ D NDN P + +    + V+E+      +   +V D D  ANG++ C +      F L  +  N    Y + L   LD E  S   L++  +DGG P+L +  R++V V DVNDN   F Q    + + EN P G  I  +S  D D  K + V++S+V       +  S+V++   +G +   +  D E  +   F+V   +         V + + + D NDN P   A  + S        +P +      + +VRA+D D G N  +SY            F V  Y GEI    +LD      H++ ++ +D G P +++S+ TV ++++++   P
Sbjct:   70 RHGDLLEVNLQNGILFVNSRIDREKLCGRSAECSIH-----LEVIV--------DRPLQVFHVDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEGASDADIGVNSLLTYALSLNEN-FELKIKTKKDKSILPELVLRKLLDREQTPKLNLLLMVIDGGKPELTGSVQIQITVLDVNDNGPAFDKPSYKVVLSENVQNDTRVIQLNASDPDEGLNGEISYGIKMIL-----PVSEKCMFSINPDTGEIRIYGELDFEE--NNAYEIQVNAIDKGIPSMAGHSMVLVEVLDVNDNVPEVMVTSLSLPVQEDAQVGTVIALISVSDRDSGANGQVICSLTPHVP-FKLVSTYKNY---YSLVLDSALDRESVSAYELVVTARDGGSPSLWATARVSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSAWDADAQKNALVSYSLVERRVGEHALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLGSNVTLQVFVLDENDNAPALLATPAGSAGGAVSELVPRSVGAGHVVAKVRAVDADSGYNAWLSYELQPAAVGAHIPFHVGLYTGEISTTRILDEADAPRHRLLVLVKDHGEP-ALTSTATVLVSLVENGQAP 676          

HSP 2 Score: 72.7886 bits (177), Expect = 2.889e-12
Identity = 72/288 (25.00%), Postives = 131/288 (45.49%), Query Frame = 1
Query: 1597 FSIVHSSNCSFVNIDTNNGYLTTNEMFDRET----KDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTV------SNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNL-FPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQI 2424
            F +    +   + ++  NG L  N   DRE       E +  ++V+    +       V + + DINDN PVF +      + E+  +D       A D D+G N  ++Y       N+ F   +      S   E+ L  +LD ++     + ++  D G+P  ++ S  + ITVLD N++ P F+KP + + LS   Q   + +   ++D D+   N +++Y +  I P+  K +F I+  TG I +     + +F+ NN    EI+V+  D   P   G +++ +
Sbjct:   64 FRVASKRHGDLLEVNLQNGILFVNSRIDREKLCGRSAECSIHLEVIVDRPLQ---VFHVDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEGASDADIGVNSLLTYALS---LNENFELKIKTKKDKSILPELVLRKLLDREQTPKLNLLLMVIDGGKP-ELTGSVQIQITVLDVNDNGPAFDKPSYKVVLSENVQNDTRVIQLNASDPDEG-LNGEISYGIKMILPVSEKCMFSINPDTGEIRIY---GELDFEENN--AYEIQVNAIDKGIPSMAGHSMVLV 338          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDHA12 (protocadherin alpha 12 [Source:HGNC Symbol;Acc:HGNC:8666])

HSP 1 Score: 196.052 bits (497), Expect = 1.137e-50
Identity = 163/633 (25.75%), Postives = 294/633 (46.45%), Query Frame = 1
Query:  268 QHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-PNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHS-----SNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFS--------IPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHP 2112
            +H ++  ++   G L     IDRE LC  S  C        LE+ +        ++P +  +  + ++DINDN P F E  Q + ++E +P+ +   L  A D D    +++ Y +  +EN F L     +DK       ++ ++ R  + + + +   +       + S+++ + V D+ND+ P +    Y + + EN+  D+ +    A+D D  + G++SY I  I+           +F+I+  TG++++ G LDFEE     Y + + A D G PS++  +  ++++ D NDN P + +    + V+E+      +   +V D D  ANG++ C +      F L  +  N    Y + L   LD E  S   L++  +DGG P+L +  R++V V DVNDN   F Q    + + EN P G  I  +S  D D  K + V++S+V       +  S+V++   +G +   +  D E  +   F+V   +         V + + + D NDN P   A  + S        +P +      + +VRA+D D G N  +SY            F V  Y GEI    +LD      H++ ++ +D G P +++S+ TV ++++++   P
Sbjct:   70 RHGDLLEVNLQNGILFVNSRIDREKLCGRSAECSIH-----LEVIV--------DRPLQVFHVDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEGASDADIGVNSLLTYALSLNEN-FELKIKTKKDKSILPELVLRKLLDREQTPKLNLLLMVIDGGKPELTGSVQIQITVLDVNDNGPAFDKPSYKVVLSENVQNDTRVIQLNASDPDEGLNGEISYGIKMIL-----PVSEKCMFSINPDTGEIRIYGELDFEE--NNAYEIQVNAIDKGIPSMAGHSMVLVEVLDVNDNVPEVMVTSLSLPVQEDAQVGTVIALISVSDRDSGANGQVICSLTPHVP-FKLVSTYKNY---YSLVLDSALDRESVSAYELVVTARDGGSPSLWATARVSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSAWDADAQKNALVSYSLVERRVGEHALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLGSNVTLQVFVLDENDNAPALLATPAGSAGGAVSELVPRSVGAGHVVAKVRAVDADSGYNAWLSYELQPAAVGAHIPFHVGLYTGEISTTRILDEADAPRHRLLVLVKDHGEP-ALTSTATVLVSLVENGQAP 676          

HSP 2 Score: 72.7886 bits (177), Expect = 3.011e-12
Identity = 72/288 (25.00%), Postives = 131/288 (45.49%), Query Frame = 1
Query: 1597 FSIVHSSNCSFVNIDTNNGYLTTNEMFDRET----KDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTV------SNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNL-FPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQI 2424
            F +    +   + ++  NG L  N   DRE       E +  ++V+    +       V + + DINDN PVF +      + E+  +D       A D D+G N  ++Y       N+ F   +      S   E+ L  +LD ++     + ++  D G+P  ++ S  + ITVLD N++ P F+KP + + LS   Q   + +   ++D D+   N +++Y +  I P+  K +F I+  TG I +     + +F+ NN    EI+V+  D   P   G +++ +
Sbjct:   64 FRVASKRHGDLLEVNLQNGILFVNSRIDREKLCGRSAECSIHLEVIVDRPLQ---VFHVDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEGASDADIGVNSLLTYALS---LNENFELKIKTKKDKSILPELVLRKLLDREQTPKLNLLLMVIDGGKP-ELTGSVQIQITVLDVNDNGPAFDKPSYKVVLSENVQNDTRVIQLNASDPDEG-LNGEISYGIKMILPVSEKCMFSINPDTGEIRIY---GELDFEENN--AYEIQVNAIDKGIPSMAGHSMVLV 338          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 151.754 bits (382), Expect = 1.083e-36
Identity = 183/710 (25.77%), Postives = 323/710 (45.49%), Query Frame = 1
Query:  277 NIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTIC--------IEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSS--------SSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-PNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSN--CSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLS---------CQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVK 2316
            N+F +   +G ++  +S+DRE L            K +L++T +           ER+  TI         + D+ DNSP F + +   EI E +PIGT +    A+D DS +   I+Y +    N  NL           +N +  +I T   +   D    +L   D+ +S        S+  + + V D+ND++P + +  Y + I EN+ + ++I T +ATD D    GKV YS+          +  G L TID  TG++ L   +D +          I AKD   P+LSS     I++ D ND+ P +   + +I +EEN      +      D D   NG I+   +E  E F + + +  I  T      ++LD E  +  +L +  +D G P+L +   IAV + D+NDN   F +K   ++I E +P GS+II +  +D D+  ++ + I  +     S ++I      L+ +    R+   ++   V++   D         V + I D+N + P F+ H +S  IPE++ +   +  ++A D+D G+N  + Y     I + +F+    + G+I +   LD + +    V + A D   P  +++ST + + + D N++ P+F    +A T+S          Q   ID ++ P         N  ++Y L+         LF++D+ +GT+ ++ K
Sbjct:  211 NLFTLDTMSGEIRLAKSMDREVL-----------DKHILKVTAY-----------ERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLG-EGNGKNL---------LAINAKSGVIQT---AAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMAS-------SSGIGGL-TIDYSTGEVTLRERIDAK---NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYS-MEGSEDFIIDEDSGLIKTT------KLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQ---DHKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVY----SIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASP-PLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGP---------NGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSK 849          

HSP 2 Score: 139.043 bits (349), Expect = 7.454e-33
Identity = 175/644 (27.17%), Postives = 294/644 (45.65%), Query Frame = 1
Query:  277 NIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTR-NISFRYDPIQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTV-YGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-PNYLDYFTVFDNDEDA--NGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNV-IDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDN----VNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQ---RFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLS 2151
            N+ AI+  +G +QT   +DRE L              ++ L + ASD     +    + + I + D+NDN+P F   +  + I E   I   +    A D D      + Y M  S  I  L+          +++    +  R  I  +  PI   + A D      SS++ L + V DINDH+P    ++  I ++EN+ +   +    A D D+   G + YS+                F ID  +G +K    LD E   +  Y + + A+D GTPSL++ TT  + ++D NDN P  +     + + E  P  + +      DNDED     +IE    E     ++    A + ++ E+   +  D++ +  I+   Q   GG      + R  VNV ID  ++  YF      + IPE+ PIG  +I +   D D+   + + +SI  S    F  ID ++G ++ +   DRE  D   F V V   D+    +N +  ++VIL   DINDN P F  + Y+ +I E+  V     +V AID D+G NG V Y  +N+ S+    + +      G +R+   LD ++  +  + I ARD+G P S+S+++ + +T+ D N++ P FE+  + L ++
Sbjct:  316 NLLAINAKSGVIQTAAPLDRETLS-------------LIRLDVIASDKGTPKRESTAMVE-ITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLT----------IDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME-----------GSEDFIIDEDSGLIKTTKLLDRETTAR--YSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGEL---KRQDHKVRVEISATDQ---GGL-----QGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS---QFFRIDPSSGDISVSSDLDRE--DRATFSVIVTASDHASPPLNTSTQIEVIL--DDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYF-LNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTP-SLSAASEITLTLSDVNDNAPTFEQLSYDLYIA 902          

HSP 3 Score: 132.88 bits (333), Expect = 6.683e-31
Identity = 125/443 (28.22%), Postives = 222/443 (50.11%), Query Frame = 1
Query:  838 KYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDA--NGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKP-VFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLS 2151
            KY   + E+  +++II + +A+ A +    + YS+  +  +D   + S NLFT+D+++G+++L  ++D E  +  ++I+ + A +   P++S+ TT V+ + D  DN PI   +    ++ E+ P       +VF  D D+  NG+IE  + E G   NL    A   +   I  +  LD E  S+I L +   D G P   S   + + V+DVNDN   F   +  ++I ENI I + I  +   D D     +V +S+  SS    + ID + G +T  E  D +     A  ++  +      + TV + + + DIND+ P +  A    ++ EN ++   +GRV AID D G NG + Y     +     +    + G I+   +LD +    + + + ARD G P S+++STT+ + + D N++ P F+K  + +T+S
Sbjct:  169 KYVKELPEDTPIETIIASVKASHASS--QPLYYSM--VAPQD---SRSQNLFTLDTMSGEIRLAKSMDRE--VLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIG-TTVLSVFARDLDSGENGEIEYSLGE-GNGKNLLAINAKSGV---IQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKY----SMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTP-SLNTSTTIAVVLKDINDNAPTFDKKEYNVTIS 591          

HSP 4 Score: 105.916 bits (263), Expect = 1.218e-22
Identity = 143/563 (25.40%), Postives = 255/563 (45.29%), Query Frame = 1
Query:  283 FAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICI--EDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLI-VKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTV-YGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP--PNYLDYFTVFDNDEDANGKIECEILEWG-----EYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCSFVNIDTN---NGY--LTTNEMFDRETK-DEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSY 1911
            F I   +G ++T + +DRE     S             L + A D+     P      TI +  +DINDN+P+F +    + I+E+ P G+++    A D D         D K +  I      +F       +    L V+  +  +   ++  ++A D        ++ V ++D+N  +P + +  + ++I E+  +   + T +A D D     ++ YSI            S   F ID  +GD+ ++ +LD E+R     IVT  A D+ +P L++ T   + ++D NDN P    +     + E+ P   ++L   +  D D   NG ++  + E       + F L +++  + +      S  LD E+ ++I L I  +D G P+L++   I + + DVNDN   F Q +  + I EN P+GS +  I   D D+   ++++F I   ++    +I+ +   NG   + T   FD E K +++ FE+Q     +   + TV V + +SD+NDNKP   D     +  +N  +   IG + A D D  +N T+ Y
Sbjct:  524 FIIDEDSGLIKTTKLLDRETTARYS-------------LKVTARDM---GTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE--------DQKITYRIEEADREVFSILDIG-DQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSID-----------SSQFFRIDPSSGDISVSSDLDREDRATFSVIVT--ASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQ-VSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRV------SSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQA---SSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPD--QNATLEY 1035          

HSP 5 Score: 57.7658 bits (138), Expect = 5.750e-8
Identity = 61/231 (26.41%), Postives = 99/231 (42.86%), Query Frame = 1
Query:  235 RGKNLKKYELIQHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTI--CIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD 912
            RG N +    I     F I PS+G +     +DRE              +    + + ASD      PP      I   ++DINDNSP F   +    I+E  P+GT     SA D D     I+ Y +  +E+  + S  +FR  +     +V   + R    ++  I   + A D  +   S++  + + ++D+ND++P +    Y + I EN  + S + T  A DAD
Sbjct:  711 RGDNARIVYSIDSSQFFRIDPSSGDISVSSDLDRE-------------DRATFSVIVTASD---HASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFL--NESSSSPSIQLFRLDRTSGTLRVSSKLDRE---QFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDAD 920          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 134.806 bits (338), Expect = 1.736e-31
Identity = 138/523 (26.39%), Postives = 247/523 (47.23%), Query Frame = 1
Query:  790 VKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-PNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSN--CSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLS---------CQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVK 2316
            + V D+ND++P + +  Y + I EN+ + ++I T +ATD D    GKV YS+          +  G L TID  TG++ L   +D +          I AKD   P+LSS     I++ D ND+ P +   + +I +EEN      +      D D   NG I+   +E  E F + + +  I  T      ++LD E  +  +L +  +D G P+L +   IAV + D+NDN   F +K   ++I E +P GS+II +  +D D+  ++ + I  +     S ++I      L+ +    R+   ++   V++   D         V + I D+N + P F+ H +S  IPE++ +   +  ++A D+D G+N  + Y     I + +F+    + G+I +   LD + +    V + A D   P  +++ST + + + D N++ P+F    +A T+S          Q   ID ++ P         N  ++Y L+         LF++D+ +GT+ ++ K
Sbjct:    4 ITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMAS-------SSGIGGL-TIDYSTGEVTLRERIDAK---NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYS-MEGSEDFIIDEDSGLIKTT------KLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQ---DHKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVY----SIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASP-PLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGP---------NGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSK 490          

HSP 2 Score: 127.872 bits (320), Expect = 2.078e-29
Identity = 161/583 (27.62%), Postives = 269/583 (46.14%), Query Frame = 1
Query:  460 ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTR-NISFRYDPIQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTV-YGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-PNYLDYFTVFDNDEDA--NGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNV-IDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDN----VNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQ---RFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLS 2151
            I + D+NDN+P F   +  + I E   I   +    A D D      + Y M  S  I  L+          +++    +  R  I  +  PI   + A D      SS++ L + V DINDH+P    ++  I ++EN+ +   +    A D D+   G + YS+                F ID  +G +K    LD E   +  Y + + A+D GTPSL++ TT  + ++D NDN P  +     + + E  P  + +      DNDED     +IE    E     ++    A + ++ E+   +  D++ +  I+   Q   GG      + R  VNV ID  ++  YF      + IPE+ PIG  +I +   D D+   + + +SI  S    F  ID ++G ++ +   DRE  D   F V V   D+    +N +  ++VIL   DINDN P F  + Y+ +I E+  V     +V AID D+G NG V Y  +N+ S+    + +      G +R+   LD ++  +  + I ARD+G P S+S+++ + +T+ D N++ P FE+  + L ++
Sbjct:    4 ITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLT----------IDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME-----------GSEDFIIDEDSGLIKTTKLLDRETTAR--YSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGEL---KRQDHKVRVEISATDQ---GGL-----QGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS---QFFRIDPSSGDISVSSDLDRE--DRATFSVIVTASDHASPPLNTSTQIEVIL--DDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYF-LNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTP-SLSAASEITLTLSDVNDNAPTFEQLSYDLYIA 543          

HSP 3 Score: 122.865 bits (307), Expect = 8.282e-28
Identity = 170/650 (26.15%), Postives = 283/650 (43.54%), Query Frame = 1
Query:  457 TICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWD-----LNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFS----GNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNY-LDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNC---SFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDA-HYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFT--VSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDK-NLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMT--VKEN-DCNFKT 2340
            TI + DIND++P+     + I + E   IG E+    A D DS    IIKY M+ SE+     F I  D+   L    KL+  R  + RY      +TA D     LN+S+++ +++K  DIND++P +   +Y + I E +   S I T +A D D    K++Y   RI   D  + FS    G+   I S++G++K         R   +  V I A D G          V    D  ++ P  N +   + + E++P  Y +      D+D   N +I   I +  ++F +  S+ +I ++ +      LD E ++  ++I+   D   P L +  +I V + D+NDN   F   +   +I E+IP+G+  +++S ID D      V + +  SS+        +D  +G L  +   DRE        +   ++   + +   ++ L +SD+NDN P F+   Y   I EN+ V   +G + A D D G+N  +S+        + F         G +R+    + D +           Q     +SS+  V I V D N++ P  +     +      Q   +    P+ D D   +N  + Y       LE   L + +K TG I +    K N D +FKT
Sbjct:  107 TINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED-----FII--DEDSGLIKTTKLL-DRETTARY---SLKVTARDMGTPSLNTSTTIAVVLK--DINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ-KITY---RIEEAD-REVFSILDIGDQGAILSVSGELK---------RQDHKVRVEISATDQGG---LQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI-DSSQFFRIDPSSGDISVSSD------LDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYE-AKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPD---QNATLEYF------LEENDLIEAEKYTGKILVKQEWKRNMDVSFKT 709          

HSP 4 Score: 105.531 bits (262), Expect = 1.466e-22
Identity = 143/563 (25.40%), Postives = 255/563 (45.29%), Query Frame = 1
Query:  283 FAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICI--EDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLI-VKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTV-YGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP--PNYLDYFTVFDNDEDANGKIECEILEWG-----EYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCSFVNIDTN---NGY--LTTNEMFDRETK-DEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSY 1911
            F I   +G ++T + +DRE     S             L + A D+     P      TI +  +DINDN+P+F +    + I+E+ P G+++    A D D         D K +  I      +F       +    L V+  +  +   ++  ++A D        ++ V ++D+N  +P + +  + ++I E+  +   + T +A D D     ++ YSI            S   F ID  +GD+ ++ +LD E+R     IVT  A D+ +P L++ T   + ++D NDN P    +     + E+ P   ++L   +  D D   NG ++  + E       + F L +++  + +      S  LD E+ ++I L I  +D G P+L++   I + + DVNDN   F Q +  + I EN P+GS +  I   D D+   ++++F I   ++    +I+ +   NG   + T   FD E K +++ FE+Q     +   + TV V + +SD+NDNKP   D     +  +N  +   IG + A D D  +N T+ Y
Sbjct:  165 FIIDEDSGLIKTTKLLDRETTARYS-------------LKVTARDM---GTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE--------DQKITYRIEEADREVFSILDIG-DQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSID-----------SSQFFRIDPSSGDISVSSDLDREDRATFSVIVT--ASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQ-VSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRV------SSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQA---SSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPD--QNATLEY 676          

HSP 5 Score: 94.7449 bits (234), Expect = 2.844e-19
Identity = 67/237 (28.27%), Postives = 118/237 (49.79%), Query Frame = 1
Query: 1450 IAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKP-VFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLS 2151
            + + V+DVNDN   F   +  ++I ENI I + I  +   D D     +V +S+  SS    + ID + G +T  E  D +     A  ++  +      + TV + + + DIND+ P +  A    ++ EN ++   +GRV AID D G NG + Y     +     +    + G I+   +LD +    + + + ARD G P S+++STT+ + + D N++ P F+K  + +T+S
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKY----SMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTP-SLNTSTTIAVVLKDINDNAPTFDKKEYNVTIS 232          

HSP 6 Score: 57.7658 bits (138), Expect = 5.335e-8
Identity = 61/231 (26.41%), Postives = 99/231 (42.86%), Query Frame = 1
Query:  235 RGKNLKKYELIQHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTI--CIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD 912
            RG N +    I     F I PS+G +     +DRE              +    + + ASD      PP      I   ++DINDNSP F   +    I+E  P+GT     SA D D     I+ Y +  +E+  + S  +FR  +     +V   + R    ++  I   + A D  +   S++  + + ++D+ND++P +    Y + I EN  + S + T  A DAD
Sbjct:  352 RGDNARIVYSIDSSQFFRIDPSSGDISVSSDLDRE-------------DRATFSVIVTASD---HASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFL--NESSSSPSIQLFRLDRTSGTLRVSSKLDRE---QFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDAD 561          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 125.946 bits (315), Expect = 9.840e-29
Identity = 167/644 (25.93%), Postives = 279/644 (43.32%), Query Frame = 1
Query:  373 LKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYD--PIQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTV-YGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPN-YLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNR--VYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVA-----FSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFT-----DTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVS--YVQVNQISNQRFYFT--VSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPSTDKDKSPENTKMNY 2232
            L R   L L  + +      K P +    I  E  N +SP F    + +E+ E +PIGT +    A D D+     I+Y +    +I   S  +    +      V   +++ +  + +   +Q  ++A D  +   SS   + +++ D+N+HSP++    YY+RI EN      I    A D D    GK+ +S+G    +        ++ +ID+ TG +KL  +LD E+  Q  +   IIA D G P   S T   I +ED NDNPP   +      + E+ P   ++     FD D   N K++  +      F +   +  I I    Y    LDY K     L I+  D G P L++   + V ++D+  N   + F       S+ EN  IG+E+I I   +   + +V      + I+        +ID   G + T  + DRETK  Y   V+  +     +      D + V +RI D ND++PV     Y  S+ EN+  +  I +V A D D  +N   +    ++ +   Q F+     S Y        LD +KQ+ H++ +   D G P  + S+  V + VLD N++ P F +     ++  +       +F + D D+  EN ++ Y
Sbjct:  571 LSRMSALNLMFYKN----GTKIPAKPKPIIIQESENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVI---HDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEK-------SSVISIDAKTGIVKLLKSLDRED--QDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSEKVPFRIDHHSGCIFIHAPEYP---LDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSID-QKGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDLTSGYITTSGIRRLDREKQSEHELWVSICDGGEP-QLCSNVIVIVNVLDENDNSPTFTQAIHHYSVRSKFAGKLCRIF-AVDADEG-ENARLTY 1191          

HSP 2 Score: 95.1301 bits (235), Expect = 2.381e-19
Identity = 184/758 (24.27%), Postives = 313/758 (41.29%), Query Frame = 1
Query:  283 FAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDM-------KCSENIFNLSFSIFRDKQYKLNHQVKLIV--TRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKI---ECEILEWGEYFNLKKSTANIPIT------YEIYLSQILDYEKQSMIAL-IIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSE----IIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSY-VQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVE---IKVSVFDPTKPLFRGSTILQIILENERYHKNVNEEIN 2472
            F++  STG +    S+DRE             RK   ++TI A     +         T+ I D+NDN+P+F    +   I+E + +GT + + SA DRD S    I++ +         +EN   L+ +   D++ K++H  KLI   T    F  D                +   + V+D+ND  P++   ++ I +  +L   S I  F   D D     VS          IPK     +F IDS   D+ L      E ++Q  Y + + A D            V +           + +  I   E N         TV   +    G +   E  +L     F L  +  N+ +        ++  S  +DYEK   +    +  QD  +     K+ I V + ++NDNR    +K +++SI EN+P   +    I RI   D D   E+ F +V      F  ID  NG +T  +  D E      F + VV  D   F D   +++ + D NDN P F+ + YS  + E+ S+   +   RA   D  +N T+ Y ++ + +++  F    +  G + L   LD +  +  ++T+VA+D G P  + +   V I+V+D N++ P+FEK  +   +   +++ +K L        S     ++Y       LE  S    D      A+    +    ++ + EK++   +KV   D  +P  R   +L+I +E+E  H    ++ N
Sbjct: 2657 FSVERSTGKIIVKSSLDRE-------------RKNQWKMTIRAD---AAGGVHAITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENPYFDLNENSGWLTVASQLDRE-KIDH-YKLIARATDEGGFNTD----------------LPFTIVVSDVNDSPPQFEKEEFNIDL--HLPSTSPILHFSIKDDDLSPNNVSQFF-------IPKGNEEGVFWIDS-NNDLLLKRPEIVENKMQ--YQLKVTAFD-----------GVFETSTKVKINLKSSKDSDIRCPEANK--------TVILAENSKKGTVVLGESSLLGPNVTFKLSDNDGNVFVVNFRNGIVKVKESDQIDYEKNQQLEFHRLTIQDNSE---VCKELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADF-DEIKFRMVDDFGGLF-QIDDINGVVTVVKPLDSEILG--FFNLTVVASDG-EFEDKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGD--QNETIEYYLKPSDVTS--FVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVP-PLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSY------ELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCN 3330          

HSP 3 Score: 80.8777 bits (198), Expect = 4.930e-15
Identity = 72/296 (24.32%), Postives = 143/296 (48.31%), Query Frame = 1
Query: 1339 TYEIYLSQILDY--EKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVS-NYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQT-IDKNLFPSTDKDKSP 2211
            T  I++S++L+Y  +K+  I L+++   G +   T    + ++VID+ND   +F       SI E+   G  ++ +S  D D+   + +S++  S   F ++    G +T  +  + +     +  ++  +  N     T  V + I+  +   P F ++HY FS+ E+  V   IGRV+ ++ ++ E    + V  ++ S+    F+V  + G+I +   LD +++N  ++TI A   G    + + TTV + + D N++ P F   +   T+S          +F + D+D SP
Sbjct: 2456 TGRIHVSRVLNYHRDKRYQIPLVVEDATGRRAFST----LTLSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDDENDTIEYSLLDGSESQFFSVHPRQGTITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMEDADVGNVIGRVQQMETEIDEI-RFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRADAAG---GVHAITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSP 2743          

HSP 4 Score: 75.485 bits (184), Expect = 2.690e-13
Identity = 134/567 (23.63%), Postives = 239/567 (42.15%), Query Frame = 1
Query:  421 IQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQ-DRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTV--FDNDEDANGKI--ECEILEWGEYFNLKKSTANIPI-------TYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDK-KSEVAFSI-VHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDND-LGENGTVSY-----------VQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARD 2040
            IQ N    +   T+ IE++NDN P   E    + I+E  P   +   +  +   + +DF  IK+ M    + F   F I  D    +   VK + +  + F       T+ A D        ++V V D ND++P +  S Y +++ E+  +   +  F+A+  D     + Y +        P   + +   +++ TG + L   LDFE     +  +T++AKD+G P L +     I + D NDN P     + +  V+EN+        TV   D D +  G +  E EI+         ++T + P+         ++ +SQ +DYEK     L +  +DGG+P L S+  + ++V D ND+   F    +   + E   IG  +++ S  DLD  K+   F++ +         ++     LT  ++  R+ KD+Y   + V+ KD    T    + + I   + + P         +  +N   +G IGR++A D D   +NG + +            QV +  +   +    N G+I   H +    Q +H   +   D
Sbjct: 2986 IQDNSEVCKELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADFDEIKFRMV---DDFGGLFQI--DDINGVVTVVKPLDSEILGF----FNLTVVASDGEFEDKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQ-NETIEYYLK-------PSDVT-SFVNLNAQTGILTLAKPLDFETLSALK--LTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGE-KVLTVKALDVDSEHFGAVSYELEIV--------SETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRLLKFSVSDLDGPKNGAPFTVEIQGDGAKSFKVNEKLELLTAKKLEYRK-KDKYL--LTVIAKDVKGKTTDCPLTIFIRQTSRHAPTMKPMKIQINTLQNELPEGIIGRLKASDEDEEDQNGLLRFGLVEGSIQSPRAQVQESRSTHLFRVDPNTGDIWSDHSI---TQGLHTFNVTVTD 3517          

HSP 5 Score: 75.0998 bits (183), Expect = 3.494e-13
Identity = 118/567 (20.81%), Postives = 237/567 (41.80%), Query Frame = 1
Query:  514 TIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIF---NLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLI-VKVNDINDHSP----EWPNSKYYIRIKENLLLDSIIHTFQATDADTVY-GKVSYSI------------GRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWG----EYFNLKKSTANIPITYEIYLSQILDYEKQSM-IALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHS-SNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKP-VFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHM----LDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLD-SNNH 2109
            T++ +E +PIG  L   +    +  D ++I+Y ++ S++      L F+I        N  +++    N S R    +   +   +N   + + + +++ D NDH+P    +W      +  K   +L  +     ATD D    GK+ Y              G I + ++PK   GN +       D+ L         L R   + ++   NGT   + P   +I   +   +P   +    +   E+      +      D D   NG I   I +      E   + + +  I +  +  LS+++  + + + + L +   D G P  +S K + + + DVN++   F + +  + I EN   G +I +++  D D     ++ FS+ ++    S ++ID   G +   +  DRE +D + F +   ++          + + + D+NDN P     H    IPE+     F+  + A D D+G+N  + ++    +++++  F + ++      H     LD  K     ++I   D G PI +S+S  + + ++D ++NH
Sbjct:  389 TLKTDEMAPIGRILYRMNVNVENPDDVSLIRYSLEYSKSDLPNATLPFAIGSK-----NGILRVSAKINRSERVYNFKVIASLHGINEKLAEKDVSIEILDSNDHAPVFSAKWMRQTPIVIGKPGDVLVKV----DATDQDEGENGKIVYKFTSELPLEINANTGEITLVEVPK--KGNSWPATVWAIDLGLP--------LSRMSALNLMFYKNGTKIPAKPKPIIIQESENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASD--LSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFL----LNSEKVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPI-LSTSCHLHVELVDIAHNH 929          

HSP 6 Score: 68.1662 bits (165), Expect = 4.462e-11
Identity = 104/445 (23.37%), Postives = 190/445 (42.70%), Query Frame = 1
Query:  772 SSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVY-GKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQRE--YIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYL----DYFTVFDNDEDAN---GKIEC-----EILEWG-------EYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEI--IRISTIDLDKKSEV--AFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFS-IPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTV-SNYGEIRLFHMLDIDKQNIHQV 2022
            S++ +IV V D ND+SP +  + ++  ++       +   F A DAD     +++Y+I     R          F+ID+       NGN+   E +  +  Y +T+ A D+GTP      T V+   +     P  +         +N+PP       DY     + +      GK+E      + L W          F++++ T       ++ L++ ++  K+  + L I   DG   + ++   + + V      R  F     +  + E + +G++I  ++ S   L  K  V   FS+   +    + ++ ++G +   E  D E        VQV + +  +F       + I+D NDN P F  H +F+ + E+ +VD  +  V A D D GENG V+Y  V+   N+   F + +  GE+RL   LD + Q++  +
Sbjct: 1138 SNVIVIVNVLDENDNSPTFTQAIHHYSVRSKFA-GKLCRIF-AVDADEGENARLTYNITEGDAR----------FSIDN-------NGNIIASEAIHGDESYALTVQATDHGTPGQQFAATRVVLTANSAGQKPRKS---------KNSPPEISGKKSDYVIPISDADQVGLTVGKLEASDADGDELWWSISSGDPDSVFDVRQDTG------QLLLAKKVELLKRGELRLNISVTDGQAWDHST---VIIQVSRQISQRPKFSASHYQTDVSERVAVGTQIYTLKASGESLGTKPLVFNLFSVDDVAMEDKIRVEPSSGNVIVMEPLDYEAARRIRAVVQVQQANMKSFA---TFSVNINDENDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVS--GNEESLFKIDAKSGEVRLAKPLDPELQHVESI 1540          

HSP 7 Score: 66.2402 bits (160), Expect = 1.381e-10
Identity = 104/477 (21.80%), Postives = 196/477 (41.09%), Query Frame = 1
Query:  751 AWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKL-----NGNLDFEERLQREYI--VTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGE--YFNLKKSTANIPITYEIYLSQILDYEKQSMIALI-IQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGR-------VRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMS-SSTTVFITVLDSNNHPPEF 2121
            AWD ++     +I++V+      P++  S Y   + E + + + I+T +A+           S+G        K    NLF++D +  + K+     +GN+   E L  E    +  + +       S  T +V   ++ +++P  +         E +T  + L   T FD D   NG +   I+   E   F +   +       E+ L++ LD E Q + +++ I+  D    +L  +  + +   +       F +K  + ++ ++   G+ ++ ++ +       V++ +    NC+F  + T +G +       +  K   + E   + +      D  KVI +I   N + P+F    Y  +I EN      +         V AID D G NG V Y  ++    Q   F+V  Y G IR     D +K   +   + A D G+P   S   + + +TV+D N+ PP F
Sbjct: 1343 AWDHST-----VIIQVSRQISQRPKFSASHYQTDVSERVAVGTQIYTLKAS---------GESLGT-------KPLVFNLFSVDDVAMEDKIRVEPSSGNVIVMEPLDYEAARRIRAVVQVQQANMKSFATFSVNINDENDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEESLFKIDAKSG------EVRLAKPLDPELQHVESILRIRAIDSAANSLKDEMSLHIRNSNEAPETAKFDRKVYQTTLYDSTRPGTPVLVLNAL---HHGTVSYKL--EPNCTFFEVHTLSGAVHLATWLTK-LKHRKSVECTAIVESTEGQQDIAKVIAKIIRTNQHSPIFRRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRMLSPKDEQ--MFSVDQYSGAIRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPPRF 1784          

HSP 8 Score: 65.0846 bits (157), Expect = 3.863e-10
Identity = 77/327 (23.55%), Postives = 141/327 (43.12%), Query Frame = 1
Query: 1513 ISIPENIPIGSEIIRISTIDLDKK--SEVAFSI--VHSSNCSFVNIDTNNGYLTTNEMFDRETKD-----EYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEF-----------EKPFFALTLSCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIIL 2430
            + + E+ PIG+ + ++   D D      + + I  +  S+   + +D  +G +T      +  K+     +   +V  ++      +    + LRI D+N++ P FD   Y   I EN      I +V A D D G NG + +   N           +  G ++L   LD + Q++H   I+A D+G P+ + S T + I+V D N++PP+            + P  A  +SC           + D+D   +N+K+ +LL++      K  F+ID  +G I +   E   ++       + I+V+  D   P+   S  L + L
Sbjct:  615 VEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRV-SVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAF-VSCMA---------AFDEDIG-QNSKLKFLLNS-----EKVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVA--DHGDPILSTSCHLHVEL 922          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 117.472 bits (293), Expect = 3.855e-26
Identity = 140/569 (24.60%), Postives = 249/569 (43.76%), Query Frame = 1
Query:  472 DINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSE---NIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLI-VKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSL-SSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDY--------FTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQ-DGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTV-SNYGEIRLFHMLDIDKQNIHQV--TIVARDQGRPISMSSSTTVFITVLDSNNHPP 2115
            D     P F +    +EI E +PIGT L    A +    +   I+Y ++  +    +  +S ++   K +    Q                Q T+ A + NS +S  LI +++ D+ND+ P +  ++Y++ ++E    +  +    A+D D+  +G+VSY I              + F+I+ +TG++     L      +  + + + AKD G  S  +S    +  I+     P        I   E+  P   +          ++++  D+D N             F++ + T       +IY+++ LD +    + L IQ     G+ N T   ++ + + D NDN   F    + ISI E++ +      +   D DKK   EV +SI+ S   S + ID   G L+T  + D E    Y   V+  +      +  + + + + D+NDN P F+ + Y+  + EN+     +G+V A D D  ENG + Y    +I+N   YF +    G +  +    ID++ I  V  +IVA D+G P   SS+ +  I+VLD N++PP
Sbjct:  532 DTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSY-------------QTTVIATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHI----------LSESSSFSINPVTGEVFAQKPL-----ARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSKVKYSIYSGDQDHN-------------FSIDEDTG------KIYVTRYLDADVHDTVLLNIQATLPSGESNQT---QVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVY----RITNGSEYFGIDEKLGNV--YTKRSIDREVISHVDISIVAEDKGVP-PRSSTASARISVLDVNDNPP 1043          

HSP 2 Score: 95.9005 bits (237), Expect = 1.190e-19
Identity = 138/588 (23.47%), Postives = 251/588 (42.69%), Query Frame = 1
Query:  466 IEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVK--LIVTRNISFRY-DPIQCTLTAWDLNSSS---SMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVY-GKVSYSIGRIMVRDIPKTF--SGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDN------DEDANGKIECEILEWGEY----FNLKKSTANIPI------TYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTL 2148
            ++D NDN+PSF +    +EI+E + +GT   L +  D D   F + ++ +    N+ N    +F+    K+N Q++  L+V   +   + D  +  + A D    +    +R  +++ D ND++P +  S+Y   +  N+ + S + T QATDAD     ++SY        DI KT   S + F I S +G +    +L         + V ++A D+G+PSLSS     I +                     ++PP  LD   + ++      +    G I   +    +Y      L  S+A  P        Y + L  ILD E  S   L    +  G+  +   + + +   D+NDN   +    I IS+      GS  +     DL +   + +S++   +   V+ID   G +      D     E  F V+  +  +   +  ++V+  + D     P F+ A +   IPE+T +   + +V A ++  G +  + Y     + NQ  + TV    G + +    D +KQ  +Q T++A +     S +S++ + I + D N++ P F    + LT+
Sbjct:  112 VDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRF-VILQGNVNN----VFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISY--------DIKKTSAPSNSNFAI-SQSGVITTTASL----LPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTL----------------SSPP--LDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQLLTIG--DINDNAPQWHSSQIHISL-NRTQGGSRTLTAKDPDLGQNGWIRYSVL---DTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRY----SLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNAN---SETSTSLISIRLKDVNDNWPIFYPNEYHLTV 650          

HSP 3 Score: 90.8929 bits (224), Expect = 4.220e-18
Identity = 123/558 (22.04%), Postives = 218/558 (39.07%), Query Frame = 1
Query:  457 TICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNL---SFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNL---FTIDSITGDMKLNGNLDFE----------------ERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEW--GEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRP 2052
            +I ++D+NDN P F      + + E       L + SA D DS  F  + Y +    + F++   +  +F  K                  R+  +         +S +S  + + V D +  +P++  SKY IR  E++L    I +  A        KV YSI           +SG+    F+ID  TG + +   LD +                E  Q + ++ I   ++  P  SS    +   ED   +                  P Y+      D D+  NG++   I+    G    + + T       ++    +LDYE      L ++  D G P  +S   + ++V+DVNDN   F +    + + EN P  + + ++   D D  +  ++ + I + S   +  ID   G + T    DRE        +   +K     + T    + + D+NDN P   +     +P  + +   IG + A+D D G NG+V Y    +   Q   F V + G++ L   L+   +   +++++  DQG P
Sbjct:  628 SIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPVTGEVFAQKPLARG-------------RFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGA------MSKVKYSI-----------YSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHE-----------------PFYV--VQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTG------QLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSE--YFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLY----RAQLQSSLFVVKSNGDVYLRRQLNASDERHQRLSVIVSDQGVP 1124          

HSP 4 Score: 84.7297 bits (208), Expect = 3.599e-16
Identity = 141/624 (22.60%), Postives = 257/624 (41.19%), Query Frame = 1
Query:  460 ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSE--NIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGK-VSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHY-SFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTL--SCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTI 2301
            + I DINDN+P +      I +N        L   +A+D D      I+Y +  +E  +I   +  IF       N      +   I FR       + A D  S   S+ ++++  + D     P++  + + + I E+  + + +    A ++     K + YS+                 T+D+++G + +    DFE+  Q+ Y  T+IA  N     S+   ++   +  ++ P        +   E   P   L   +  D D    G++   IL     F++       P+T E++  + L    +    L++  +DGG  +  +   I + VID +     F +    I   E+I  G  I  +  +     S+V +SI         +ID + G +      D +  D     +Q         ++  +V++ I D NDN P F +     SI E+  +      V+A D D  +NG V Y  ++  S+      +  + G++    +LD +    +++ + A D G P   SS+ T+FI VLD N++ PEFEK ++ + +  +   +TI   +  + DKD S EN ++ Y + N         F ID+  G +
Sbjct:  429 LTIGDINDNAPQWHSSQIHISLNRTQGGSRTL---TAKDPDLGQNGWIRYSVLDTELVSIDKETGRIFVPNTIDCN------IGSEIKFR-------VRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQN----------QDEHLTVDTMSGTVCIQKTFDFEK--QKSYQTTVIAT-NANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSIN------PVTGEVFAQKPL---ARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAM-----SKVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGE--SNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIIS--SHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIP-PRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVV-ARDKD-SLENGQIVYRITN-----GSEYFGIDEKLGNV 997          

HSP 5 Score: 77.411 bits (189), Expect = 5.440e-14
Identity = 101/402 (25.12%), Postives = 174/402 (43.28%), Query Frame = 1
Query:  976 FSGNL--FTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAV---NVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQR-FYFTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQT 2160
            F GN   F+I+S TG + +   L  +    +E+++ II  D G+ + S      +  ++ N      +    +   E +   + L  F   D D   NGK   E+LE     +   S   +P T ++ L ++   +   +   ++   D G P L  +K + +   N        + F ++T   +I E +P G  I ++      + + + +SIV  +  S  ++D+  G + TN   DRE  + Y+ +V          T   +V +R++++NDN P F       +PEN  V  ++  V A D D      + Y  V+  S Q   +F +  + G I L   LD +    H +TI A D     S  + T + I V D N++ P F KP +  T+S  T
Sbjct: 1666 FQGNAPKFSINSTTGSISV---LPLDREASQEHLLIIILTDGGSRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLE-----DSSGSLDLVPETGDLVLRRLSSLQSWKIKLRVV---DHGVPGLYVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQP----ELAGLTYSIVEGNIDSAFSVDSE-GVIRTNLELDREILERYSLKVIGTGSGQQIGT---RVDVRVNNLNDNVPSFPMSKPRRVPENLRVGSYVATVGAKDVD--NLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDG----SFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPAT 2042          

HSP 6 Score: 75.0998 bits (183), Expect = 2.617e-13
Identity = 113/442 (25.57%), Postives = 191/442 (43.21%), Query Frame = 1
Query:  781 RLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTV----YGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANI----PITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVN-DNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDT---VKVILRISDINDNKPVFDA-HYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVS-NYGEIRLFHM----LDIDKQNIHQVTIVARDQGRP 2052
            R+ V+VN++ND+ P +P SK   R+ ENL + S + T  A D D +    Y  VS S G+              F ID  TG + L   LDFE  +  E+ +TI A D    + ++ T  V DI D                V   T      +  +  +D DA G +          ++L + +++I    P +  +++  +    ++ ++   +   D G P+ ++   ++V + +    ++  F +   R  + EN  IG   ++I  +  ++  E  + I         +ID   G L      DRE +  + F+V++   DN   T      K  + + D NDN PVF +  Y  S+ ++ +    IG++ A D D GENG VSY  ++   N     T++ + G I+L       LD       Q+ + ARD G P
Sbjct: 1912 RVDVRVNNLNDNVPSFPMSKPR-RVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTH----------FNIDQFTGTIHLTAPLDFE--VLPEHTLTIKATDGSFDTFTNLTIFVSDINDNAPTFSKPLYQTT---VSPATFSPGQPFAKIEAHDLDARGALT---------YSLGQGSSSIFRVAPESGALFMKVLPPAGERYLVT--VTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIG---LQIGNLSGEESREFHYRIQDPEASKIFSID-KFGRLFVAGPIDREQRATHEFQVEI---DNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILS--GNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHP 2317          

HSP 7 Score: 63.929 bits (154), Expect = 8.026e-10
Identity = 115/516 (22.29%), Postives = 217/516 (42.05%), Query Frame = 1
Query:  787 IVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVY-GKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGK-IECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKS--EVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFT--DTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQIS-NQRFYFTV-SNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDK-NLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIA 2304
            ++ + DIND++P+W +S+ +I +           T  A D D    G + YS+    +  I K  +G +F  ++I  D  +   + F  R          A+D G+P+LS+    V D+ D    PP        +++ E+TP        V +N +  N K I   +    E+  +   +  + I       +  D+EKQ      +   +      TS   I++ + DVNDN   F      +++ E       ++ +S  D+D  +  EV++ I+  S+   +N         T E+F ++      F + V  KD    +  ++  + + + D +   P F  + Y     E+      IG V          G +S V+ +  S +Q   F++  + G+I +   LD D   +H   ++      P   S+ T V I + D N++PP+F      +++    +  +   +  ++DKDK  +N ++ Y + +  P    S  +ID+ TG ++
Sbjct:  428 LLTIGDINDNAPQWHSSQIHISLNRT---QGGSRTLTAKDPDLGQNGWIRYSVLDTELVSIDKE-TGRIFVPNTI--DCNIGSEIKFRVR----------AEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCI------QKTFDFEKQKSYQTTVIATNANSE--TSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSIN-------PVTGEVFAQKPLARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSV----------GAMSKVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDAD---VHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKK-KNGEVRYSIISSHP---GSSIEIDQFTGQLS 895          

HSP 8 Score: 63.1586 bits (152), Expect = 1.173e-9
Identity = 94/392 (23.98%), Postives = 166/392 (42.35%), Query Frame = 1
Query: 1303 FNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNCSFVN--IDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDIND--NKPVFDAHY-----SFSIPENTSVDGFIGRVRAI----DNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIILE 2433
            F L     N  +  ++ ++  LD E +    L+I+ QDGGKP    + R ++ +ID NDN   F +     S+  NI IGS +I +   D D  + S +++ I  +S  S  N  I  +    TT  +    T D     V VV  D+ + + +   ++ I+ +    + P  D  +     S  + EN+++   + RV       D  L   G+ S +   Q      Y        + L  +LD +  + H +  +    G+ I         +T+ D N++ P++      ++L+ +TQ   + L   T KD  P+  +  ++  ++   E   L  IDK TG I       DCN  +    +++ +V   D   P    ST LQ++ +
Sbjct:  170 FKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLPASTHD-----VIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGS-SALCPQQTDQAHVYL-------LLLCGILDRETASEHHLKFLLEKDGQIIIEHPQ---LLTIGDINDNAPQWHSSQIHISLN-RTQGGSRTL---TAKD--PDLGQNGWIRYSVLDTE---LVSIDKETGRI-FVPNTIDCNIGS----EIKFRVRAEDGGSPAL--STDLQVVAD 529          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 108.227 bits (269), Expect = 2.090e-23
Identity = 181/770 (23.51%), Postives = 309/770 (40.13%), Query Frame = 1
Query:  268 QHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKT-----ICIEDINDNSPSFP------ELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSM---RLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVY-GKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQR----------------EYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFN----LKKSTANIPIT------------------YEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRI---SIPENIPI--------GSEIIRISTIDLDK---KSEVAFSIVHSSN---CSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKD-------NVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLF-----------HMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLF--PSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAM 2307
            Q  N+F+I   TG ++         L H  +  D  + +  + LT+   D       P + + +     I IED+N+N P FP      ++ + +E   K+   T +++  A D DSS    I Y +  +++    +F I R     L     ++  R    R D    T+ A D      +   +  V+V DIND+SP++    Y   +     + + + T  A D D  +  +++YS+                  ID+  G+   N +LDF E + R                ++I  +IA DNG P     +  V                      +  T P+     TV +N E     + C  +  G+  N     K + +  P                     E+ + + LDYE+ +   L +   D     + S K   V V DVND     PQ T+ +   +I E +          G  I+ +  ID D    ++EV + IV  +N        ID   G +  NE FDRE  D Y   V+  ++        N    D VKV + I+D+NDN P F+               +IGRV+  + +  +  T+    +++ SN R++   +  G I                LD +  + + + ++A D GR    +++T V+I + D N++ P+FE+  +A T+  +   I K LF   +TD D+  +++++ Y L+     E   +F+I K +GTI +
Sbjct:  793 QKMNLFSIDEHTGLVK---------LRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVE-ATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGV-LTPSPHVVFDRETRPRED---VTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSL-----------------EIDTTAGEEHQN-DLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAP----------KWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATD-MTSRVASTKTFVVEVRDVND---VVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQK------------YIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASD-GR---HNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADE---VFRIGKYSGTIEL 1497          

HSP 2 Score: 90.1225 bits (222), Expect = 7.003e-18
Identity = 143/611 (23.40%), Postives = 251/611 (41.08%), Query Frame = 1
Query:  397 LTIFASD-----LIQSNKP-PERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRY-DPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIR-IKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERL---QREYIVTIIAKD-NGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLD--YFTV-----FDNDEDANGKIECEILEW----GE-YFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQ--DGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSE---VAFSIVHSSNCSFVNIDTNN-----GYLTTNEMFDRE---TKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPE 2118
            LT+ ASD     L  +N P  + +   I I D+NDN+PSF E      + E    G ++    A D D    + ++Y +        + F +  D          + V   + F   D     L A D   +++  + + + D+ND++P++   KY    I+E++ +  ++    ATDAD           RI+ R +    +  +F I   +G ++L   LD +         ++V  I  D NG    +     V       ++   I   R    +EEN  P + D  YF       FD+    N  IE  I+      GE  F + ++T       +I+  + LD E  S    II+ +  D G P+      + + V D+NDN  +F +     S+ E  PIG+ ++  S  D D++++     + +   S+  +V  D ++     G L   +  D E    +D +   ++V +           V + + D ND+ P         + E+      IGR  A D D G+    +  ++N+ S+ +  FT+   G +R+ H LD +   ++ + I A D    I       V + + D N++ PE
Sbjct: 1296 LTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDK--HSNLRYHL-IGAGGGRIPFGVRTDSG-------TIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQ-----DEKSSRIVYR-LEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYAD----VQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTG------KIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDG---RHDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGD---TARFRINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQ---MVAVYLQDVNDNGPE 1871          

HSP 3 Score: 86.2705 bits (212), Expect = 1.219e-16
Identity = 169/751 (22.50%), Postives = 310/751 (41.28%), Query Frame = 1
Query:  283 FAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKL----IVTRNISFRYDPIQCTLTAWD----LNSSSSMRLIVKVNDINDHSPEW-PNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIV--TIIAKDNGT----PSLSSPTTA-----VXXXXXXXXXXXXXXXXXXXXXVEENT----PPNYLDYFTVFDNDEDANGKIECEIL----EWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSI--------VHSSNCSFVN-IDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNV---NFTDTVKVILRISDINDNKPVF----DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSY----------------VQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFP----------------STDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTI 2301
            F I PSTG +   R +D +           L +   L++T       + +     +  TI I+D+NDN P+F     T ++ E  P+   +   +A D+D+ D + I Y      ++ N +FSI  +   +++ +V+L    +  R+  +R++     +TA D    ++ SSS  + ++  + ND S  + P S+Y   + E+    + +   QA DAD    +V+YS    M ++   T   NLF+ID  TG +KL   +   +  + E  +  T+I +D+G+    PS +  + A     + D+ +     P       I  + E T    PP  +      D+D  ANG I   +     E  + F + + T  +  +  +    + D E +    + ++  D G   L    + +V V+D+NDN   F + +   S+     +G+ +I +   D D    +E+ +S+         H ++  F   ++  +G +T  +    +T+    F   V+  DN        + +V L + D     P +    D     ++ EN  ++  I R RA+ +    N  V Y                 Q N+  N       + + E+ +   LD ++ N + +T+ A D    +  +S+ T  + V D N+  P+F    F       T TID+ + P                + D D      +++Y +      E    F+ID+LTG I
Sbjct:  585 FRIDPSTGIIHLTRLLDFDD--------PALPKLHKLKVTA------REDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITY------SVDNHNFSI--NSNGEISAKVRLDADQLNERHFVYRFN-----VTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADR--DEVTYS---FMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVK-VEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHV----VFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQ---KFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENG------NEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRV--ASTKTFVVEVRDVNDVVPQFTVDLF-------TGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEI 1280          

HSP 4 Score: 78.9518 bits (193), Expect = 2.236e-14
Identity = 157/683 (22.99%), Postives = 277/683 (40.56%), Query Frame = 1
Query:  457 TICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKC-----SENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNS-----SSSMRLIVKVNDINDHSPEW---PNSKYYIRIKENLLLDSIIHTFQAT------DADTVYGKVSYSIG-----RIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLD------YFTVFDNDEDANG---KIECEIL-----EWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGG-----KPNLTSKKRIAVNVI--DVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSF-VNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD--AHYSFSIPENTSVDGFIGRVRAIDNDLGENGT-VSYVQVNQISNQRFYFTVSNY-GEIRLFHMLDIDK----QNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALT--------------LSCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTI 2301
            ++ + DINDNSP F   +    ++    +GT +    A D D++  A I Y ++       E+  +L F    +++      +K I  +   F ++ I       D N       SS ++ + V D    +P+W   P+ K  I + EN+ L+ +I   +A       ++D +Y K++ S G         R   K  +GN +       ++ +   LD+E+     Y +T+ A D  +   S+ T  V   +  +  P            EE TP  +L+        TV   D D++G   ++   I+     E  ++F + +      +T EI+ ++  D EK  M  L ++  D         N  +K  + V ++  DVNDN   F ++     + E+   G ++I I   DLDK S + + ++ +        + T++G +   E  D E  D+Y     V+   +     T  V + I D+NDN P F+   + +  I E+  +   +  V A D D  E  + + Y    Q +++   F +  Y G I L   LD D      + + V     D G    +     V + V D N++ P F +  F                 +  Q +  D         D + EN  + Y +   K +  +S+F+ID+ TG I
Sbjct:  966 SVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIA------DDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIY-KLTASGGPGNKAESKFRQFNKFENGNEWV------EVVIMEGLDYEQ--VNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDE------LTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHL---VLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADE--VFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGN--GLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFD---------DPTTENANIEYGIVRNKLINGESVFRIDQNTGKI 1611          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0332722)

HSP 1 Score: 160.614 bits (405), Expect = 3.203e-39
Identity = 173/630 (27.46%), Postives = 304/630 (48.25%), Query Frame = 1
Query:  478 NDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSF-SIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-PNYLDYFTVFDNDEDANGKIECEILEWG---EYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVY--FPQKTIRISIPENIPIGSEIIRISTIDLDK---KSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTV-SNYGEIRLFHM-LDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFP--STDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMT 2310
            N + P F    Q + INE   +G  +    A+DRD      + Y+ K    I +  + S+FR    +   Q+   + R    R +     +T +DL +   S+S  L + + D+ND+ P    +    R+ E+  + +++H   ATDAD+ +  +V+Y++          +   + FT+++ TG ++LN  LD E+  Q  Y + I AKD G+P LSS     + ++D NDN P+  +   I  V E+ P    L      D D   N +I+  + E     E F + K T        I     LDYE + +  LI+   DGG P+LTS   I + +IDVN+NR    F        + EN P G+ ++ ++  D+D     S++ +SI          ++ + G +T+    D ETK+ Y   +   +   V  ++ V+V +++ + NDN P+ D   Y  ++ E +  +  I  ++A D D+    T++Y  V+   N   YF + S  G I+     LD + Q  H + +   D G P+ +SS++ + ++VLD N++ PEF++  + + +   + T+++++F   + D D S EN ++ Y   +IK  + K+ F+ID   G I + 
Sbjct:  766 NVHRPEFVNFPQELSINESVQLGETVAWIEAKDRD------LGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRE---RQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYAL----------SVECSDFTVNATTGCLRLNKPLDREK--QDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTG------AIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVN-DQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVS--GNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPV-LSSTSRIVVSVLDINDNSPEFDQRVYKVQVP-SSATVNQSIFQVHAIDSD-SGENGRITY---SIKSGKGKNKFRIDSQRGHIHIA 1359          

HSP 2 Score: 143.28 bits (360), Expect = 5.545e-34
Identity = 169/611 (27.66%), Postives = 273/611 (44.68%), Query Frame = 1
Query:  277 NIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDM--KCSENIFNLSFSIFR-----DKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTV-YGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXX--XXXXXXXVEENTPPN-YLDYFTVFDNDE-DANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTI--DLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEM-FDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRP 2052
            ++F I P  G LQ I  +DRE            + + VL +T++  DL    K   ++   I I D+NDN P   +   T  + E + IGT +    A D DS   A + Y +  +CS+   N +    R     D++ + N+ +                  +TA D  S   SS   + V V+D+ND++P +   +Y  +++E+L   +++   +A D D     ++ +S+         +T    LF ID  TG ++  G LD+E +     IV+ I  D G PSL+S  + VI I D N+N              V+EN P   ++   T  D D  D N KI   I   G+   +        IT    LSQ LD E ++   L +  QD     L++   + + V + NDN     +    +++ E      EII +     D+D    + ++IV  +   +  ID+  G + T E   DRE + E+  EV + +  +   + T ++++ + DINDN P FD   Y   +P + +V+  I +V AID+D GENG ++Y   +     +F    S  G I +   LD D  N  ++ I A D G P
Sbjct:  818 SVFRIDPDRGELQIIGYLDRER-----------QNEYVLNITVY--DLGNPTKSTSKMLP-ITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGCLRLNKPLDREKQDNYALH-----------------ITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKE-------ETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAI--DGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSI-TGGDGLGIFAVNDQGSIT---SLSQ-LDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRID-SQRGHIHIAKPLDSD--NEFEIHIKAEDNGIP 1380          

HSP 3 Score: 142.124 bits (357), Expect = 1.286e-33
Identity = 137/450 (30.44%), Postives = 221/450 (49.11%), Query Frame = 1
Query:  784 LIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTV-YGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTV--KVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEF 2121
            +++ V D ND+ P++ N+ Y   + EN      +    ATDADT   G + Y     +  D       N+F ID  +G + L  +LD E  +Q EY   +IA DNG P   +     I I D+NDN P+  +    + V EN  P      TV  N    +  IE + +++      K++   I  + E+++++ LD E+     L I   DG     T+K  + ++V D+NDN  Y  +    IS  E+I IG+ ++ +  ID D +S++ F +       F +I   +G L      DRET  +Y     V  +D  +FT     ++I+ ++DINDN P+F  A Y  S+PE+  ++  I +V A+D D G N  + Y  + +  N  ++    + G IRL   LD +  ++  +T+ A D G P  + S  TV + +LD N++PPEF
Sbjct: 2846 VLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRY----YLESDTENI--QNIFDIDIYSGWITLLTSLDRE--VQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPG-----TVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQIGKSGELFIAKPLDREQLMFYNLSIIATDG---KFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLRFYLSGKGADDF-SIGKESGILKVASALDRETTPKYKLVAHV--QDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGE--NHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVP-KLHSIATVAVNILDINDNPPEF 3273          

HSP 4 Score: 133.265 bits (334), Expect = 6.260e-31
Identity = 150/584 (25.68%), Postives = 252/584 (43.15%), Query Frame = 1
Query:  397 LTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSG---NLFTIDSITGDMKLNGNLDFEERLQREYI----VTIIAKDNGTPSLSS-PTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDK--KSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPP 2115
            L+I A+D     K   +    I ++DINDN+P   +    I  NE   IGT L    A D D           K +++     FSI ++       +V   + R  + +Y  +       D        +I+ VNDIND+ P +  ++Y + + E+  L+++I    A D D  +G         + R I  +  G   + F I   TG ++L+ +LD      RE I    +T+ A+D G P L S  T AV  ++  ++ P           +E  T    +        D   N  I   I+   E    K  +     T ++ L+  LDYE      L IQ  DGG P L++   + ++++D+NDN   F Q   RI++ E+I +GS+I+ +   D D      V ++I    N    +ID  NG ++ +   DRET   Y  E+Q  ++ +    ++V + + I D NDN P+F  ++YS  + EN  +       +  D D   N T  Y    +  N+   F +   G +R     + + Q+   + +   D G P  + S   V + +++ + +PP
Sbjct: 3038 LSIIATD----GKFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLRFYLSGKGADD-----FSIGKESGIL---KVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKD--FG---------VNRQIKYSLMGENHDYFKISKSTGIIRLHKSLD------RETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDST----TGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFKISDADETPN-TTPYTFDIRSGNEGGLFRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTP-PLYSDAWVVVKIIEESQYPP 3586          

HSP 5 Score: 123.25 bits (308), Expect = 7.872e-28
Identity = 137/536 (25.56%), Postives = 244/536 (45.52%), Query Frame = 1
Query:  742 TLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-PNYLDYFTVFDNDEDANGKIECEILEW--GEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRV----------RAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFIT--VLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTI 2301
            T++  D   ++   L+V+V DIND+ P++    Y++ I EN+  +S+I    ATD D    K+ Y    +     P + +  LF IDSI+G++ +   LDFE+  Q  +I+ +  KD G P   +    ++++ D ND+ P          V E+    + L      D D   N +I+  I+    G  F +  +   I +   + +++I +Y  Q      ++  D G P L+S+  + + V    ++   FP   I I I EN+PIG+ + +++       S + F+I+  +      I+ + G +  N   D E+     F + V   +    +    +I+ I D NDN P F    Y  ++PE+ ++  ++ +V          +  D D+G NG V Y  V+ ++ + F+   S  G I L   LD +    +   +   D G+P  + S+TT  +T  V++ N+ PP F +    +TL   T    +N+F      K  +N  + +   +I        F+I+K TG I
Sbjct: 1478 TISVTDGTFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDE-DKKLFY---HLHATQDPSSLA--LFRIDSISGNVIVTQRLDFEKTAQ--HILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQ------VKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTA---RSSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIK--VFNLTVKGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLA-KNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKP-KLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTF---ENVFVRQVSAKDADNDTLRF---DIVDGNTNECFQIEKYTGII 1986          

HSP 6 Score: 119.013 bits (297), Expect = 1.761e-26
Identity = 135/471 (28.66%), Postives = 215/471 (45.65%), Query Frame = 1
Query:  769 SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVY-GKVSYSIGRIMVRDIPKTFSG-NLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXX-----XXXXXXXXVEENTPPNYL-DYFTVFDNDED------ANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHS----SNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFS-IPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVS-NYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEF 2121
            SS+ R++V V DIND+SPE+    Y +++  +  ++  I    A D+D+   G+++YSI         K+  G N F IDS  G + +   LD +     E+ + I A+DNG P  S      I +   N N           +  ++D+ EN  P +L       D+D D      +NG  +         F + +   NI       LS+ LDYE Q    L I   DG     T+   + V VID+NDN   F +    ++I ENI   S I+++   D D+  ++ F  +H+    S+ +   ID+ +G +   +  D E   ++   V V ++      +  K+I+ + D ND+ P F A    S +PE+ ++   +  VRAID D G N  + Y  +    N    F +   +G I L   L+I+K   + + + A D G P  +SS   V I V  S N PP+F
Sbjct: 1280 SSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSI---------KSGKGKNKFRIDSQRGHIHIAKPLDSD----NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQLWYNISNGNDD-------NTFYIGQDNGNI------LLSKYLDYETQQSYNLTISVTDG---TFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKL-FYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIIT--GNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNP-PLSSQIPVHIIVTMSENDPPKF 1717          

HSP 7 Score: 116.701 bits (291), Expect = 8.082e-26
Identity = 174/723 (24.07%), Postives = 318/723 (43.98%), Query Frame = 1
Query:  214 GINLNLTRGKNLKKYELIQHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMK---CSENIFNLS--FSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDH--SPEWPNSKYYIRIKENLLLDSIIHTFQATDADTV--YGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNY-LDYFTVFDNDEDANGKIECEILEWG--EYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDN-----VNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVD--GF-IGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLS--CQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMT 2310
            GIN  +T       Y L    + F ++ +TG L+  + +DRE             ++    L I A D        E +   + ++D+NDN+P F       ++ E  P GT L +  A D D    A I++ +K     E +F +       R + Y L+++ K +        ++ I   +   D + +S M +++ + D+N++  +PE+ +  Y  ++KEN    + +    A D DTV    K++YSI             G+   I ++     +      +   +  Y +T+ A+D     LS+     I +E+ NDN P+ +     ++V E +  N  +     FD D D    I   I+      YF +   T  I  T      + LD E Q+   L +   D G P L+S  RI V+V+D+NDN   F Q+  ++ +P +  +   I ++  ID D  +   + +SI      +   ID+  G++   +  D + +    FE+ +  +DN             V++ ++  + N P+     S ++ + T  D  GF + ++ A+D+D   N  + Y   N   +  FY    N G I L   LD + Q  + +TI   D     + ++ T + + V+D N++PP+F K  + + +S   + +++   L  +TD+D   E+ K+ Y L   +     +LF+ID ++G + +T
Sbjct:  907 GINAQVT-------YALSVECSDFTVNATTGCLRLNKPLDRE-------------KQDNYALHITAKDGGSPVLSSEALVY-VLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGY-LDYENKQV--------HNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSIT-----------GGDGLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTT-----ERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSDNE----FEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDD---NDQLWYNISNGNDDNTFYIGQDN-GNILLSKYLDYETQQSYNLTISVTDG----TFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLH-ATDRD---EDKKLFYHLHATQDPSSLALFRIDSISGNVIVT 1567          

HSP 8 Score: 110.923 bits (276), Expect = 4.312e-24
Identity = 123/462 (26.62%), Postives = 199/462 (43.07%), Query Frame = 1
Query:  790 VKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGT----PSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKI-ECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIA-LIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIR--ISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNF--TDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSY--VQVNQISNQRFYFTVSNYGEIRLFHMLDID--KQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEK 2127
            +KV D ND SP +  ++Y + I E+      I    A DAD  + G++ YS+                F I   TG++ L   L + E    E  +T++A D G+     +  +  T V       +        +    V   + P       V D D   NG I   EI++           A     Y I L+Q     +Q  I  L +  +D G P   + K + + +   + N   F Q+   +SIPE  PI   +IR  +S  DL K + V   IV  +      I+ ++G L T +  D E K  Y   V  +++ NV      + KV + + D+NDN P+F+  +   SI EN     F+ ++ A D D GEN  +SY    +N +  +  +F+    G ++   +LD +  K+N +++ I A D G P    +   + I V D N++ P+FE+
Sbjct:  171 IKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSL----------LMDSEYFAIHPTTGEITLLQQLQYAENSHFE--LTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFS----GIVKTTSLLDFETMKRN-YELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFER 615          

HSP 9 Score: 87.0409 bits (214), Expect = 1.033e-16
Identity = 83/326 (25.46%), Postives = 149/326 (45.71%), Query Frame = 1
Query: 1354 LSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDA-HYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPST---DKDKSPENTKMNYLLD-NIKPLEFKSLFKIDKLTGTIAMT 2310
            ++  LD E      L+   QDG          I + V D+NDN   F     R+S+PE+  + + I ++  +D D     ++ +S++   N  +  I  + G +  ++  DRET   +   V+  +           V + I DINDN P F    YS  I EN +    + +V A   D+G N  + Y  ++     +F    S  G++ L   LD +    + +TI A D G P  +S++  V I++LD N++ P F +  + +        +++++F  +   D   + E++ +N L+  NI+  +    F ID   GTI+++
Sbjct: 3123 VASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLM-GENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMD-STTGDLVLNATLDYEMSKFYFLTIQAIDGGTP-PLSNNAYVNISILDINDNSPTFLQNLYRI-------NVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVS 3438          

HSP 10 Score: 80.4925 bits (197), Expect = 8.678e-15
Identity = 91/382 (23.82%), Postives = 164/382 (42.93%), Query Frame = 1
Query: 1336 ITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDA-HYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQIS---NQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEF-----------EKPFFALTLSCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIIL 2430
            I+  + ++Q LD+EK +   LI+  +D G P   +  +I VNV D ND+   F  K I+  +PE+  IGS++  +  ID D    +E+ +SI+  +  S   ID   G +T     +     EY  +V+ V+  N   +  + V + ++   ++ P F   + +  I EN  +  F+ +V A         + S +  N IS   N+ F    S  G I +   +D +   +  +T+   +     + SS   + I +LD+N++ P F                +  L     + D       D D         +++D++     K+ FKID  TG I +  +    +++TN     ++ VS  D  KP    +T   + +
Sbjct: 1560 ISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTA--------RSSSSIFFNIISGNINESFRINPST-GVIVINGNIDYESIKVFNLTVKGTNMA---AESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLA----KNFFKIDSTTGAIELLRQ---LDYETNAGYTFDVTVS--DMGKPKLHSTTTAHVTI 1920          

HSP 11 Score: 70.8626 bits (172), Expect = 7.914e-12
Identity = 141/620 (22.74%), Postives = 251/620 (40.48%), Query Frame = 1
Query:  253 KYELIQHYNIFAIHPSTGFLQTIRSI-DREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQV-KLIVTRNISFRYDPIQCTLTAWD---LNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEW-----GEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYF--PQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDN--KPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSS 2067
            +Y ++    +F I  S+G L+T   I DRE           L R  V E      D + SN         I + D+NDN P F  +     ++   P GT +    A D DS++   ++Y++K               + +KL+ +  +L + +++       + T+ A+D      SS   L VKV  I+   P +    Y + +KE++ + S         A +V  +    +GR ++  I        F ID  TG + +   LD+E+    +  V+I A D+ +   +    +V  ++  +  P I +    +   E  +    +      DND  AN K+   I         E F +  +  N+      YL   LDYE+     +++  +D G P+L+S+  + + V D+NDN   F  P    ++S+         + +    D+     + + IV+ +     +ID   G ++   M +   K      + V   D V+   T    L+IS + +N   P+FD + Y   +PEN      I  V+A D D G    + Y  V++   ++ +      G I      D +K++ + V +   D G     +S
Sbjct: 2067 EYRILNPTQLFDIGISSGALKTTGVIFDREV--------KDLYRLFV-EAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGNG-----------ELFKLDRKSGELSIKQHVEGHNRNYELTVAAYDGAITPCSSEAPLQVKV--IDRSMPVFEKQFYTVSVKEDVEMYS---------ALSVSIEAESPLGRSLIYTISS--ESQSFEIDYNTGSIFVVNELDYEKISSHD--VSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNL------YLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISV--SDGVH---TAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSE-EMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFAS 2639          

HSP 12 Score: 67.3958 bits (163), Expect = 7.647e-11
Identity = 68/272 (25.00%), Postives = 119/272 (43.75%), Query Frame = 1
Query: 1345 EIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNC----SFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHY-SFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALT 2145
            E+ L Q LD E+Q    LI+  +    P   +   + ++V D NDN   F       S+ EN      ++++S  D D            S+     +  +ID  +G++T     DRE + EY F+V   +  +      V V ++I D NDN PVF       S+ EN      +  +  ID D+ E   + +  V+   +++  F +   GE+ +   LD ++   + ++I+A D       ++   V I V D N++ P   KP + ++
Sbjct: 2811 ELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDI-EKQEMDFFIVS--GDKQAQFQIGKSGELFIAKPLDREQLMFYNLSIIATDG----KFTAKANVEIDVKDINDNTPYCLKPRYHIS 3075          

HSP 13 Score: 66.6254 bits (161), Expect = 1.661e-10
Identity = 100/396 (25.25%), Postives = 175/396 (44.19%), Query Frame = 1
Query: 1213 PNYLDYFTVFDNDEDA--NGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGG-----KPNLTSKKRIAVNVIDVNDNRVYFPQ---KTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEV-QVVEKDNVNFTDTVKVI----------------LRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISM-SSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPSTDKDK-SPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMT 2310
            P Y     V  +D D   NG+I   +L   EYF +       P T EI L Q L Y + S   L +   D G     + +  SK +++++V  VN    Y P+   KT     P + P+   I+R++    DK + +  +I        V+ + +  +L    +   ETKDEY  E+ Q    +  +F   + ++                ++I   + N P+F    Y  SIPE   ++  + R++  D DLG+N  V Y+++   +    +    + G +     LD +K++ + +T+ A DQ    S   SS  V I+V D N++ P FE     ++++ +       +   T KD+ S EN+ ++Y + N+  +     F+ID  +G +  T
Sbjct:  197 PKYQSILKVTADDADLGINGEIYYSLLMDSEYFAIH------PTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVN---FYAPEIFTKTFSSVTPTSNPLIYGIVRVN----DKDTGINGNI---GRLEIVDGNPDGTFL----LKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALV-YLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISIN-ENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVP----FEIDHFSGIVKTT 566          

HSP 14 Score: 62.7734 bits (151), Expect = 2.014e-9
Identity = 153/701 (21.83%), Postives = 279/701 (39.80%), Query Frame = 1
Query:  457 TICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKC------SENIF------NLSFSIFRD-KQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQA-----TDADTVYGKVSYSIGRIMVRDIPKTFSGN---LFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYL---DYFTVFDNDED----ANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGG-KPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNCSFVN----IDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNL-FPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVK-----ENDCNFKT----------NNKEKVEIKVSVFDPTKPLFR 2403
            ++ I D+ND  P        + I E +  GT++   +A D DS   A + Y ++       SE  +      NL      D +Q K +H     +  N+     P          + SS   + + V D+ND++P +    Y+ ++    +    +   +A     +D D++  K+ Y               GN    ++ID +TG + L   L+F ++      V  I+  +G        TA   ++       + +        E   P N L   +  TV  +D D    AN   E    E  + F + ++T    IT ++      D EK+    ++++  DGG K    S K I V+V D      YF  K  ++ +   +     I+ +   D D      V F IV  SN   V     I+   G +      +    + Y F V+  ++    F   V V + I + + N P F+ +     I E+T     + ++  I N         Y     I+  + +F +S+ GE+ L   LD ++Q  H + +VA     P+  + +  V I V D N++ P+F+  F++ +++  ++ +   +   +TD D  P      YL  + + ++  ++F ID  +G I +        +++ NFK           + K  V IK+  ++   P+F+
Sbjct: 2328 SVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHH-----IVVNVKDHGSP----------SLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVY---------------GNELQTYSIDKLTGVISLQNMLNFTDK---SSTVLNISVSDGV------HTAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTG--VITSKV----TFDREKKDEYVVLLKVSDGGGKFGFASLKVIVVDVNDNVP---YFLLKEYKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHMIGN---------YTFKFSIAADQDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYAD-VLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQ--NIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFK 2968          

HSP 15 Score: 59.3066 bits (142), Expect = 2.340e-8
Identity = 65/247 (26.32%), Postives = 112/247 (45.34%), Query Frame = 1
Query: 1492 FPQKTIRISIPENIPIGSEII------RISTIDLDKKSEVAFSIVHS-------------SNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQV---VEKDNVNFTDT-VKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPIS----MSSSTTVFITVLDSNNHPPE-FEKPFFALT 2145
            F      ++IPEN  +G          R++ + +   +EV + I+                + +F+ I T     T N + +RE  +EY   V+    +   NV+  +T   + +++ D ND  P+F    Y+  IPE+T     I +V A D DLG NG + Y   + + +  ++      GEI L   L   + +  ++T+VA D+G  ++     +S T V I+V   N + PE F K F ++T
Sbjct:   62 FSHSVYNVTIPEN-SLGKTYAKGVLHERLAGLRVGLNAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTR----TNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYY---SLLMDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVT 300          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0346077)

HSP 1 Score: 160.229 bits (404), Expect = 3.398e-39
Identity = 173/630 (27.46%), Postives = 304/630 (48.25%), Query Frame = 1
Query:  478 NDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSF-SIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-PNYLDYFTVFDNDEDANGKIECEILEWG---EYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVY--FPQKTIRISIPENIPIGSEIIRISTIDLDK---KSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTV-SNYGEIRLFHM-LDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFP--STDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMT 2310
            N + P F    Q + INE   +G  +    A+DRD      + Y+ K    I +  + S+FR    +   Q+   + R    R +     +T +DL +   S+S  L + + D+ND+ P    +    R+ E+  + +++H   ATDAD+ +  +V+Y++          +   + FT+++ TG ++LN  LD E+  Q  Y + I AKD G+P LSS     + ++D NDN P+  +   I  V E+ P    L      D D   N +I+  + E     E F + K T        I     LDYE + +  LI+   DGG P+LTS   I + +IDVN+NR    F        + EN P G+ ++ ++  D+D     S++ +SI          ++ + G +T+    D ETK+ Y   +   +   V  ++ V+V +++ + NDN P+ D   Y  ++ E +  +  I  ++A D D+    T++Y  V+   N   YF + S  G I+     LD + Q  H + +   D G P+ +SS++ + ++VLD N++ PEF++  + + +   + T+++++F   + D D S EN ++ Y   +IK  + K+ F+ID   G I + 
Sbjct:  766 NVHRPEFVNFPQELSINESVQLGETVAWIEAKDRD------LGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRE---RQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYAL----------SVECSDFTVNATTGCLRLNKPLDREK--QDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTG------AIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVN-DQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVS--GNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPV-LSSTSRIVVSVLDINDNSPEFDQRVYKVQVP-SSATVNQSIFQVHAIDSD-SGENGRITY---SIKSGKGKNKFRIDSQRGHIHIA 1359          

HSP 2 Score: 143.28 bits (360), Expect = 5.783e-34
Identity = 169/611 (27.66%), Postives = 273/611 (44.68%), Query Frame = 1
Query:  277 NIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDM--KCSENIFNLSFSIFR-----DKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTV-YGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXX--XXXXXXXVEENTPPN-YLDYFTVFDNDE-DANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTI--DLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEM-FDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRP 2052
            ++F I P  G LQ I  +DRE            + + VL +T++  DL    K   ++   I I D+NDN P   +   T  + E + IGT +    A D DS   A + Y +  +CS+   N +    R     D++ + N+ +                  +TA D  S   SS   + V V+D+ND++P +   +Y  +++E+L   +++   +A D D     ++ +S+         +T    LF ID  TG ++  G LD+E +     IV+ I  D G PSL+S  + VI I D N+N              V+EN P   ++   T  D D  D N KI   I   G+   +        IT    LSQ LD E ++   L +  QD     L++   + + V + NDN     +    +++ E      EII +     D+D    + ++IV  +   +  ID+  G + T E   DRE + E+  EV + +  +   + T ++++ + DINDN P FD   Y   +P + +V+  I +V AID+D GENG ++Y   +     +F    S  G I +   LD D  N  ++ I A D G P
Sbjct:  818 SVFRIDPDRGELQIIGYLDRER-----------QNEYVLNITVY--DLGNPTKSTSKMLP-ITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGCLRLNKPLDREKQDNYALH-----------------ITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKE-------ETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAI--DGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSI-TGGDGLGIFAVNDQGSIT---SLSQ-LDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRID-SQRGHIHIAKPLDSD--NEFEIHIKAEDNGIP 1380          

HSP 3 Score: 142.124 bits (357), Expect = 1.330e-33
Identity = 137/450 (30.44%), Postives = 221/450 (49.11%), Query Frame = 1
Query:  784 LIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTV-YGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTV--KVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEF 2121
            +++ V D ND+ P++ N+ Y   + EN      +    ATDADT   G + Y     +  D       N+F ID  +G + L  +LD E  +Q EY   +IA DNG P   +     I I D+NDN P+  +    + V EN  P      TV  N    +  IE + +++      K++   I  + E+++++ LD E+     L I   DG     T+K  + ++V D+NDN  Y  +    IS  E+I IG+ ++ +  ID D +S++ F +       F +I   +G L      DRET  +Y     V  +D  +FT     ++I+ ++DINDN P+F  A Y  S+PE+  ++  I +V A+D D G N  + Y  + +  N  ++    + G IRL   LD +  ++  +T+ A D G P  + S  TV + +LD N++PPEF
Sbjct: 2846 VLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRY----YLESDTENI--QNIFDIDIYSGWITLLTSLDRE--VQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPG-----TVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQIGKSGELFIAKPLDREQLMFYNLSIIATDG---KFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLRFYLSGKGADDF-SIGKESGILKVASALDRETTPKYKLVAHV--QDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGE--NHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVP-KLHSIATVAVNILDINDNPPEF 3273          

HSP 4 Score: 133.265 bits (334), Expect = 7.229e-31
Identity = 150/584 (25.68%), Postives = 252/584 (43.15%), Query Frame = 1
Query:  397 LTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSG---NLFTIDSITGDMKLNGNLDFEERLQREYI----VTIIAKDNGTPSLSS-PTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDK--KSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPP 2115
            L+I A+D     K   +    I ++DINDN+P   +    I  NE   IGT L    A D D           K +++     FSI ++       +V   + R  + +Y  +       D        +I+ VNDIND+ P +  ++Y + + E+  L+++I    A D D  +G         + R I  +  G   + F I   TG ++L+ +LD      RE I    +T+ A+D G P L S  T AV  ++  ++ P           +E  T    +        D   N  I   I+   E    K  +     T ++ L+  LDYE      L IQ  DGG P L++   + ++++D+NDN   F Q   RI++ E+I +GS+I+ +   D D      V ++I    N    +ID  NG ++ +   DRET   Y  E+Q  ++ +    ++V + + I D NDN P+F  ++YS  + EN  +       +  D D   N T  Y    +  N+   F +   G +R     + + Q+   + +   D G P  + S   V + +++ + +PP
Sbjct: 3038 LSIIATD----GKFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLRFYLSGKGADD-----FSIGKESGIL---KVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKD--FG---------VNRQIKYSLMGENHDYFKISKSTGIIRLHKSLD------RETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDST----TGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFKISDADETPN-TTPYTFDIRSGNEGGLFRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTP-PLYSDAWVVVKIIEESQYPP 3586          

HSP 5 Score: 123.25 bits (308), Expect = 8.422e-28
Identity = 137/536 (25.56%), Postives = 244/536 (45.52%), Query Frame = 1
Query:  742 TLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-PNYLDYFTVFDNDEDANGKIECEILEW--GEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRV----------RAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFIT--VLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTI 2301
            T++  D   ++   L+V+V DIND+ P++    Y++ I EN+  +S+I    ATD D    K+ Y    +     P + +  LF IDSI+G++ +   LDFE+  Q  +I+ +  KD G P   +    ++++ D ND+ P          V E+    + L      D D   N +I+  I+    G  F +  +   I +   + +++I +Y  Q      ++  D G P L+S+  + + V    ++   FP   I I I EN+PIG+ + +++       S + F+I+  +      I+ + G +  N   D E+     F + V   +    +    +I+ I D NDN P F    Y  ++PE+ ++  ++ +V          +  D D+G NG V Y  V+ ++ + F+   S  G I L   LD +    +   +   D G+P  + S+TT  +T  V++ N+ PP F +    +TL   T    +N+F      K  +N  + +   +I        F+I+K TG I
Sbjct: 1478 TISVTDGTFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDE-DKKLFY---HLHATQDPSSLA--LFRIDSISGNVIVTQRLDFEKTAQ--HILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQ------VKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTA---RSSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIK--VFNLTVKGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLA-KNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKP-KLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTF---ENVFVRQVSAKDADNDTLRF---DIVDGNTNECFQIEKYTGII 1986          

HSP 6 Score: 119.013 bits (297), Expect = 1.853e-26
Identity = 135/471 (28.66%), Postives = 215/471 (45.65%), Query Frame = 1
Query:  769 SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVY-GKVSYSIGRIMVRDIPKTFSG-NLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXX-----XXXXXXXXVEENTPPNYL-DYFTVFDNDED------ANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHS----SNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFS-IPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVS-NYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEF 2121
            SS+ R++V V DIND+SPE+    Y +++  +  ++  I    A D+D+   G+++YSI         K+  G N F IDS  G + +   LD +     E+ + I A+DNG P  S      I +   N N           +  ++D+ EN  P +L       D+D D      +NG  +         F + +   NI       LS+ LDYE Q    L I   DG     T+   + V VID+NDN   F +    ++I ENI   S I+++   D D+  ++ F  +H+    S+ +   ID+ +G +   +  D E   ++   V V ++      +  K+I+ + D ND+ P F A    S +PE+ ++   +  VRAID D G N  + Y  +    N    F +   +G I L   L+I+K   + + + A D G P  +SS   V I V  S N PP+F
Sbjct: 1280 SSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSI---------KSGKGKNKFRIDSQRGHIHIAKPLDSD----NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQLWYNISNGNDD-------NTFYIGQDNGNI------LLSKYLDYETQQSYNLTISVTDG---TFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKL-FYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIIT--GNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNP-PLSSQIPVHIIVTMSENDPPKF 1717          

HSP 7 Score: 116.701 bits (291), Expect = 8.501e-26
Identity = 174/723 (24.07%), Postives = 318/723 (43.98%), Query Frame = 1
Query:  214 GINLNLTRGKNLKKYELIQHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMK---CSENIFNLS--FSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDH--SPEWPNSKYYIRIKENLLLDSIIHTFQATDADTV--YGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNY-LDYFTVFDNDEDANGKIECEILEWG--EYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDN-----VNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVD--GF-IGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLS--CQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMT 2310
            GIN  +T       Y L    + F ++ +TG L+  + +DRE             ++    L I A D        E +   + ++D+NDN+P F       ++ E  P GT L +  A D D    A I++ +K     E +F +       R + Y L+++ K +        ++ I   +   D + +S M +++ + D+N++  +PE+ +  Y  ++KEN    + +    A D DTV    K++YSI             G+   I ++     +      +   +  Y +T+ A+D     LS+     I +E+ NDN P+ +     ++V E +  N  +     FD D D    I   I+      YF +   T  I  T      + LD E Q+   L +   D G P L+S  RI V+V+D+NDN   F Q+  ++ +P +  +   I ++  ID D  +   + +SI      +   ID+  G++   +  D + +    FE+ +  +DN             V++ ++  + N P+     S ++ + T  D  GF + ++ A+D+D   N  + Y   N   +  FY    N G I L   LD + Q  + +TI   D     + ++ T + + V+D N++PP+F K  + + +S   + +++   L  +TD+D   E+ K+ Y L   +     +LF+ID ++G + +T
Sbjct:  907 GINAQVT-------YALSVECSDFTVNATTGCLRLNKPLDRE-------------KQDNYALHITAKDGGSPVLSSEALVY-VLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGY-LDYENKQV--------HNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSIT-----------GGDGLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTT-----ERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSDNE----FEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDD---NDQLWYNISNGNDDNTFYIGQDN-GNILLSKYLDYETQQSYNLTISVTDG----TFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLH-ATDRD---EDKKLFYHLHATQDPSSLALFRIDSISGNVIVT 1567          

HSP 8 Score: 110.923 bits (276), Expect = 4.691e-24
Identity = 123/462 (26.62%), Postives = 199/462 (43.07%), Query Frame = 1
Query:  790 VKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGT----PSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKI-ECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIA-LIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIR--ISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNF--TDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSY--VQVNQISNQRFYFTVSNYGEIRLFHMLDID--KQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEK 2127
            +KV D ND SP +  ++Y + I E+      I    A DAD  + G++ YS+                F I   TG++ L   L + E    E  +T++A D G+     +  +  T V       +        +    V   + P       V D D   NG I   EI++           A     Y I L+Q     +Q  I  L +  +D G P   + K + + +   + N   F Q+   +SIPE  PI   +IR  +S  DL K + V   IV  +      I+ ++G L T +  D E K  Y   V  +++ NV      + KV + + D+NDN P+F+  +   SI EN     F+ ++ A D D GEN  +SY    +N +  +  +F+    G ++   +LD +  K+N +++ I A D G P    +   + I V D N++ P+FE+
Sbjct:  171 IKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSL----------LMDSEYFAIHPTTGEITLLQQLQYAENSHFE--LTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFS----GIVKTTSLLDFETMKRN-YELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFER 615          

HSP 9 Score: 86.6557 bits (213), Expect = 1.124e-16
Identity = 83/326 (25.46%), Postives = 149/326 (45.71%), Query Frame = 1
Query: 1354 LSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDA-HYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPST---DKDKSPENTKMNYLLD-NIKPLEFKSLFKIDKLTGTIAMT 2310
            ++  LD E      L+   QDG          I + V D+NDN   F     R+S+PE+  + + I ++  +D D     ++ +S++   N  +  I  + G +  ++  DRET   +   V+  +           V + I DINDN P F    YS  I EN +    + +V A   D+G N  + Y  ++     +F    S  G++ L   LD +    + +TI A D G P  +S++  V I++LD N++ P F +  + +        +++++F  +   D   + E++ +N L+  NI+  +    F ID   GTI+++
Sbjct: 3123 VASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLM-GENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMD-STTGDLVLNATLDYEMSKFYFLTIQAIDGGTP-PLSNNAYVNISILDINDNSPTFLQNLYRI-------NVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVS 3438          

HSP 10 Score: 80.4925 bits (197), Expect = 9.441e-15
Identity = 91/382 (23.82%), Postives = 164/382 (42.93%), Query Frame = 1
Query: 1336 ITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDA-HYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQIS---NQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEF-----------EKPFFALTLSCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIIL 2430
            I+  + ++Q LD+EK +   LI+  +D G P   +  +I VNV D ND+   F  K I+  +PE+  IGS++  +  ID D    +E+ +SI+  +  S   ID   G +T     +     EY  +V+ V+  N   +  + V + ++   ++ P F   + +  I EN  +  F+ +V A         + S +  N IS   N+ F    S  G I +   +D +   +  +T+   +     + SS   + I +LD+N++ P F                +  L     + D       D D         +++D++     K+ FKID  TG I +  +    +++TN     ++ VS  D  KP    +T   + +
Sbjct: 1560 ISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTA--------RSSSSIFFNIISGNINESFRINPST-GVIVINGNIDYESIKVFNLTVKGTNMA---AESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLA----KNFFKIDSTTGAIELLRQ---LDYETNAGYTFDVTVS--DMGKPKLHSTTTAHVTI 1920          

HSP 11 Score: 70.8626 bits (172), Expect = 8.254e-12
Identity = 141/620 (22.74%), Postives = 251/620 (40.48%), Query Frame = 1
Query:  253 KYELIQHYNIFAIHPSTGFLQTIRSI-DREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQV-KLIVTRNISFRYDPIQCTLTAWD---LNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEW-----GEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYF--PQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDN--KPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSS 2067
            +Y ++    +F I  S+G L+T   I DRE           L R  V E      D + SN         I + D+NDN P F  +     ++   P GT +    A D DS++   ++Y++K               + +KL+ +  +L + +++       + T+ A+D      SS   L VKV  I+   P +    Y + +KE++ + S         A +V  +    +GR ++  I        F ID  TG + +   LD+E+    +  V+I A D+ +   +    +V  ++  +  P I +    +   E  +    +      DND  AN K+   I         E F +  +  N+      YL   LDYE+     +++  +D G P+L+S+  + + V D+NDN   F  P    ++S+         + +    D+     + + IV+ +     +ID   G ++   M +   K      + V   D V+   T    L+IS + +N   P+FD + Y   +PEN      I  V+A D D G    + Y  V++   ++ +      G I      D +K++ + V +   D G     +S
Sbjct: 2067 EYRILNPTQLFDIGISSGALKTTGVIFDREV--------KDLYRLFV-EAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGNG-----------ELFKLDRKSGELSIKQHVEGHNRNYELTVAAYDGAITPCSSEAPLQVKV--IDRSMPVFEKQFYTVSVKEDVEMYS---------ALSVSIEAESPLGRSLIYTISS--ESQSFEIDYNTGSIFVVNELDYEKISSHD--VSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNL------YLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISV--SDGVH---TAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSE-EMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFAS 2639          

HSP 12 Score: 67.3958 bits (163), Expect = 8.110e-11
Identity = 68/272 (25.00%), Postives = 119/272 (43.75%), Query Frame = 1
Query: 1345 EIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNC----SFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHY-SFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALT 2145
            E+ L Q LD E+Q    LI+  +    P   +   + ++V D NDN   F       S+ EN      ++++S  D D            S+     +  +ID  +G++T     DRE + EY F+V   +  +      V V ++I D NDN PVF       S+ EN      +  +  ID D+ E   + +  V+   +++  F +   GE+ +   LD ++   + ++I+A D       ++   V I V D N++ P   KP + ++
Sbjct: 2811 ELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDI-EKQEMDFFIVS--GDKQAQFQIGKSGELFIAKPLDREQLMFYNLSIIATDG----KFTAKANVEIDVKDINDNTPYCLKPRYHIS 3075          

HSP 13 Score: 66.2402 bits (160), Expect = 1.747e-10
Identity = 100/396 (25.25%), Postives = 175/396 (44.19%), Query Frame = 1
Query: 1213 PNYLDYFTVFDNDEDA--NGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGG-----KPNLTSKKRIAVNVIDVNDNRVYFPQ---KTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEV-QVVEKDNVNFTDTVKVI----------------LRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISM-SSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPSTDKDK-SPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMT 2310
            P Y     V  +D D   NG+I   +L   EYF +       P T EI L Q L Y + S   L +   D G     + +  SK +++++V  VN    Y P+   KT     P + P+   I+R++    DK + +  +I        V+ + +  +L    +   ETKDEY  E+ Q    +  +F   + ++                ++I   + N P+F    Y  SIPE   ++  + R++  D DLG+N  V Y+++   +    +    + G +     LD +K++ + +T+ A DQ    S   SS  V I+V D N++ P FE     ++++ +       +   T KD+ S EN+ ++Y + N+  +     F+ID  +G +  T
Sbjct:  197 PKYQSILKVTADDADLGINGEIYYSLLMDSEYFAIH------PTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVN---FYAPEIFTKTFSSVTPTSNPLIYGIVRVN----DKDTGINGNI---GRLEIVDGNPDGTFL----LKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALV-YLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISIN-ENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVP----FEIDHFSGIVKTT 566          

HSP 14 Score: 62.7734 bits (151), Expect = 2.247e-9
Identity = 153/701 (21.83%), Postives = 279/701 (39.80%), Query Frame = 1
Query:  457 TICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKC------SENIF------NLSFSIFRD-KQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQA-----TDADTVYGKVSYSIGRIMVRDIPKTFSGN---LFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYL---DYFTVFDNDED----ANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGG-KPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNCSFVN----IDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNL-FPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVK-----ENDCNFKT----------NNKEKVEIKVSVFDPTKPLFR 2403
            ++ I D+ND  P        + I E +  GT++   +A D DS   A + Y ++       SE  +      NL      D +Q K +H     +  N+     P          + SS   + + V D+ND++P +    Y+ ++    +    +   +A     +D D++  K+ Y               GN    ++ID +TG + L   L+F ++      V  I+  +G        TA   ++       + +        E   P N L   +  TV  +D D    AN   E    E  + F + ++T    IT ++      D EK+    ++++  DGG K    S K I V+V D      YF  K  ++ +   +     I+ +   D D      V F IV  SN   V     I+   G +      +    + Y F V+  ++    F   V V + I + + N P F+ +     I E+T     + ++  I N         Y     I+  + +F +S+ GE+ L   LD ++Q  H + +VA     P+  + +  V I V D N++ P+F+  F++ +++  ++ +   +   +TD D  P      YL  + + ++  ++F ID  +G I +        +++ NFK           + K  V IK+  ++   P+F+
Sbjct: 2328 SVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHH-----IVVNVKDHGSP----------SLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVY---------------GNELQTYSIDKLTGVISLQNMLNFTDK---SSTVLNISVSDGV------HTAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTG--VITSKV----TFDREKKDEYVVLLKVSDGGGKFGFASLKVIVVDVNDNVP---YFLLKEYKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHMIGN---------YTFKFSIAADQDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYAD-VLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQ--NIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFK 2968          

HSP 15 Score: 59.3066 bits (142), Expect = 2.399e-8
Identity = 65/247 (26.32%), Postives = 112/247 (45.34%), Query Frame = 1
Query: 1492 FPQKTIRISIPENIPIGSEII------RISTIDLDKKSEVAFSIVHS-------------SNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQV---VEKDNVNFTDT-VKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPIS----MSSSTTVFITVLDSNNHPPE-FEKPFFALT 2145
            F      ++IPEN  +G          R++ + +   +EV + I+                + +F+ I T     T N + +RE  +EY   V+    +   NV+  +T   + +++ D ND  P+F    Y+  IPE+T     I +V A D DLG NG + Y   + + +  ++      GEI L   L   + +  ++T+VA D+G  ++     +S T V I+V   N + PE F K F ++T
Sbjct:   62 FSHSVYNVTIPEN-SLGKTYAKGVLHERLAGLRVGLNAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTR----TNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYY---SLLMDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVT 300          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0332721)

HSP 1 Score: 160.229 bits (404), Expect = 3.398e-39
Identity = 173/630 (27.46%), Postives = 304/630 (48.25%), Query Frame = 1
Query:  478 NDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSF-SIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-PNYLDYFTVFDNDEDANGKIECEILEWG---EYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVY--FPQKTIRISIPENIPIGSEIIRISTIDLDK---KSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTV-SNYGEIRLFHM-LDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFP--STDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMT 2310
            N + P F    Q + INE   +G  +    A+DRD      + Y+ K    I +  + S+FR    +   Q+   + R    R +     +T +DL +   S+S  L + + D+ND+ P    +    R+ E+  + +++H   ATDAD+ +  +V+Y++          +   + FT+++ TG ++LN  LD E+  Q  Y + I AKD G+P LSS     + ++D NDN P+  +   I  V E+ P    L      D D   N +I+  + E     E F + K T        I     LDYE + +  LI+   DGG P+LTS   I + +IDVN+NR    F        + EN P G+ ++ ++  D+D     S++ +SI          ++ + G +T+    D ETK+ Y   +   +   V  ++ V+V +++ + NDN P+ D   Y  ++ E +  +  I  ++A D D+    T++Y  V+   N   YF + S  G I+     LD + Q  H + +   D G P+ +SS++ + ++VLD N++ PEF++  + + +   + T+++++F   + D D S EN ++ Y   +IK  + K+ F+ID   G I + 
Sbjct:  766 NVHRPEFVNFPQELSINESVQLGETVAWIEAKDRD------LGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRE---RQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYAL----------SVECSDFTVNATTGCLRLNKPLDREK--QDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTG------AIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVN-DQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVS--GNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPV-LSSTSRIVVSVLDINDNSPEFDQRVYKVQVP-SSATVNQSIFQVHAIDSD-SGENGRITY---SIKSGKGKNKFRIDSQRGHIHIA 1359          

HSP 2 Score: 143.28 bits (360), Expect = 5.783e-34
Identity = 169/611 (27.66%), Postives = 273/611 (44.68%), Query Frame = 1
Query:  277 NIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDM--KCSENIFNLSFSIFR-----DKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTV-YGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXX--XXXXXXXVEENTPPN-YLDYFTVFDNDE-DANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTI--DLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEM-FDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRP 2052
            ++F I P  G LQ I  +DRE            + + VL +T++  DL    K   ++   I I D+NDN P   +   T  + E + IGT +    A D DS   A + Y +  +CS+   N +    R     D++ + N+ +                  +TA D  S   SS   + V V+D+ND++P +   +Y  +++E+L   +++   +A D D     ++ +S+         +T    LF ID  TG ++  G LD+E +     IV+ I  D G PSL+S  + VI I D N+N              V+EN P   ++   T  D D  D N KI   I   G+   +        IT    LSQ LD E ++   L +  QD     L++   + + V + NDN     +    +++ E      EII +     D+D    + ++IV  +   +  ID+  G + T E   DRE + E+  EV + +  +   + T ++++ + DINDN P FD   Y   +P + +V+  I +V AID+D GENG ++Y   +     +F    S  G I +   LD D  N  ++ I A D G P
Sbjct:  818 SVFRIDPDRGELQIIGYLDRER-----------QNEYVLNITVY--DLGNPTKSTSKMLP-ITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGCLRLNKPLDREKQDNYALH-----------------ITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKE-------ETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAI--DGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSI-TGGDGLGIFAVNDQGSIT---SLSQ-LDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRID-SQRGHIHIAKPLDSD--NEFEIHIKAEDNGIP 1380          

HSP 3 Score: 142.124 bits (357), Expect = 1.330e-33
Identity = 137/450 (30.44%), Postives = 221/450 (49.11%), Query Frame = 1
Query:  784 LIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTV-YGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTV--KVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEF 2121
            +++ V D ND+ P++ N+ Y   + EN      +    ATDADT   G + Y     +  D       N+F ID  +G + L  +LD E  +Q EY   +IA DNG P   +     I I D+NDN P+  +    + V EN  P      TV  N    +  IE + +++      K++   I  + E+++++ LD E+     L I   DG     T+K  + ++V D+NDN  Y  +    IS  E+I IG+ ++ +  ID D +S++ F +       F +I   +G L      DRET  +Y     V  +D  +FT     ++I+ ++DINDN P+F  A Y  S+PE+  ++  I +V A+D D G N  + Y  + +  N  ++    + G IRL   LD +  ++  +T+ A D G P  + S  TV + +LD N++PPEF
Sbjct: 2846 VLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRY----YLESDTENI--QNIFDIDIYSGWITLLTSLDRE--VQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPG-----TVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQIGKSGELFIAKPLDREQLMFYNLSIIATDG---KFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLRFYLSGKGADDF-SIGKESGILKVASALDRETTPKYKLVAHV--QDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGE--NHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVP-KLHSIATVAVNILDINDNPPEF 3273          

HSP 4 Score: 133.265 bits (334), Expect = 7.229e-31
Identity = 150/584 (25.68%), Postives = 252/584 (43.15%), Query Frame = 1
Query:  397 LTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSG---NLFTIDSITGDMKLNGNLDFEERLQREYI----VTIIAKDNGTPSLSS-PTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDK--KSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPP 2115
            L+I A+D     K   +    I ++DINDN+P   +    I  NE   IGT L    A D D           K +++     FSI ++       +V   + R  + +Y  +       D        +I+ VNDIND+ P +  ++Y + + E+  L+++I    A D D  +G         + R I  +  G   + F I   TG ++L+ +LD      RE I    +T+ A+D G P L S  T AV  ++  ++ P           +E  T    +        D   N  I   I+   E    K  +     T ++ L+  LDYE      L IQ  DGG P L++   + ++++D+NDN   F Q   RI++ E+I +GS+I+ +   D D      V ++I    N    +ID  NG ++ +   DRET   Y  E+Q  ++ +    ++V + + I D NDN P+F  ++YS  + EN  +       +  D D   N T  Y    +  N+   F +   G +R     + + Q+   + +   D G P  + S   V + +++ + +PP
Sbjct: 3038 LSIIATD----GKFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLRFYLSGKGADD-----FSIGKESGIL---KVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKD--FG---------VNRQIKYSLMGENHDYFKISKSTGIIRLHKSLD------RETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDST----TGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFKISDADETPN-TTPYTFDIRSGNEGGLFRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTP-PLYSDAWVVVKIIEESQYPP 3586          

HSP 5 Score: 123.25 bits (308), Expect = 8.422e-28
Identity = 137/536 (25.56%), Postives = 244/536 (45.52%), Query Frame = 1
Query:  742 TLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-PNYLDYFTVFDNDEDANGKIECEILEW--GEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRV----------RAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFIT--VLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTI 2301
            T++  D   ++   L+V+V DIND+ P++    Y++ I EN+  +S+I    ATD D    K+ Y    +     P + +  LF IDSI+G++ +   LDFE+  Q  +I+ +  KD G P   +    ++++ D ND+ P          V E+    + L      D D   N +I+  I+    G  F +  +   I +   + +++I +Y  Q      ++  D G P L+S+  + + V    ++   FP   I I I EN+PIG+ + +++       S + F+I+  +      I+ + G +  N   D E+     F + V   +    +    +I+ I D NDN P F    Y  ++PE+ ++  ++ +V          +  D D+G NG V Y  V+ ++ + F+   S  G I L   LD +    +   +   D G+P  + S+TT  +T  V++ N+ PP F +    +TL   T    +N+F      K  +N  + +   +I        F+I+K TG I
Sbjct: 1478 TISVTDGTFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDE-DKKLFY---HLHATQDPSSLA--LFRIDSISGNVIVTQRLDFEKTAQ--HILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQ------VKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTA---RSSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIK--VFNLTVKGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLA-KNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKP-KLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTF---ENVFVRQVSAKDADNDTLRF---DIVDGNTNECFQIEKYTGII 1986          

HSP 6 Score: 119.013 bits (297), Expect = 1.853e-26
Identity = 135/471 (28.66%), Postives = 215/471 (45.65%), Query Frame = 1
Query:  769 SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVY-GKVSYSIGRIMVRDIPKTFSG-NLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXX-----XXXXXXXXVEENTPPNYL-DYFTVFDNDED------ANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHS----SNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFS-IPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVS-NYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEF 2121
            SS+ R++V V DIND+SPE+    Y +++  +  ++  I    A D+D+   G+++YSI         K+  G N F IDS  G + +   LD +     E+ + I A+DNG P  S      I +   N N           +  ++D+ EN  P +L       D+D D      +NG  +         F + +   NI       LS+ LDYE Q    L I   DG     T+   + V VID+NDN   F +    ++I ENI   S I+++   D D+  ++ F  +H+    S+ +   ID+ +G +   +  D E   ++   V V ++      +  K+I+ + D ND+ P F A    S +PE+ ++   +  VRAID D G N  + Y  +    N    F +   +G I L   L+I+K   + + + A D G P  +SS   V I V  S N PP+F
Sbjct: 1280 SSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSI---------KSGKGKNKFRIDSQRGHIHIAKPLDSD----NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQLWYNISNGNDD-------NTFYIGQDNGNI------LLSKYLDYETQQSYNLTISVTDG---TFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKL-FYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIIT--GNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNP-PLSSQIPVHIIVTMSENDPPKF 1717          

HSP 7 Score: 116.701 bits (291), Expect = 8.501e-26
Identity = 174/723 (24.07%), Postives = 318/723 (43.98%), Query Frame = 1
Query:  214 GINLNLTRGKNLKKYELIQHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMK---CSENIFNLS--FSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDH--SPEWPNSKYYIRIKENLLLDSIIHTFQATDADTV--YGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNY-LDYFTVFDNDEDANGKIECEILEWG--EYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDN-----VNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVD--GF-IGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLS--CQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMT 2310
            GIN  +T       Y L    + F ++ +TG L+  + +DRE             ++    L I A D        E +   + ++D+NDN+P F       ++ E  P GT L +  A D D    A I++ +K     E +F +       R + Y L+++ K +        ++ I   +   D + +S M +++ + D+N++  +PE+ +  Y  ++KEN    + +    A D DTV    K++YSI             G+   I ++     +      +   +  Y +T+ A+D     LS+     I +E+ NDN P+ +     ++V E +  N  +     FD D D    I   I+      YF +   T  I  T      + LD E Q+   L +   D G P L+S  RI V+V+D+NDN   F Q+  ++ +P +  +   I ++  ID D  +   + +SI      +   ID+  G++   +  D + +    FE+ +  +DN             V++ ++  + N P+     S ++ + T  D  GF + ++ A+D+D   N  + Y   N   +  FY    N G I L   LD + Q  + +TI   D     + ++ T + + V+D N++PP+F K  + + +S   + +++   L  +TD+D   E+ K+ Y L   +     +LF+ID ++G + +T
Sbjct:  907 GINAQVT-------YALSVECSDFTVNATTGCLRLNKPLDRE-------------KQDNYALHITAKDGGSPVLSSEALVY-VLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGY-LDYENKQV--------HNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSIT-----------GGDGLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTT-----ERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSDNE----FEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDD---NDQLWYNISNGNDDNTFYIGQDN-GNILLSKYLDYETQQSYNLTISVTDG----TFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLH-ATDRD---EDKKLFYHLHATQDPSSLALFRIDSISGNVIVT 1567          

HSP 8 Score: 110.923 bits (276), Expect = 4.691e-24
Identity = 123/462 (26.62%), Postives = 199/462 (43.07%), Query Frame = 1
Query:  790 VKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGT----PSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKI-ECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIA-LIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIR--ISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNF--TDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSY--VQVNQISNQRFYFTVSNYGEIRLFHMLDID--KQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEK 2127
            +KV D ND SP +  ++Y + I E+      I    A DAD  + G++ YS+                F I   TG++ L   L + E    E  +T++A D G+     +  +  T V       +        +    V   + P       V D D   NG I   EI++           A     Y I L+Q     +Q  I  L +  +D G P   + K + + +   + N   F Q+   +SIPE  PI   +IR  +S  DL K + V   IV  +      I+ ++G L T +  D E K  Y   V  +++ NV      + KV + + D+NDN P+F+  +   SI EN     F+ ++ A D D GEN  +SY    +N +  +  +F+    G ++   +LD +  K+N +++ I A D G P    +   + I V D N++ P+FE+
Sbjct:  171 IKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSL----------LMDSEYFAIHPTTGEITLLQQLQYAENSHFE--LTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFS----GIVKTTSLLDFETMKRN-YELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFER 615          

HSP 9 Score: 86.6557 bits (213), Expect = 1.124e-16
Identity = 83/326 (25.46%), Postives = 149/326 (45.71%), Query Frame = 1
Query: 1354 LSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDA-HYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPST---DKDKSPENTKMNYLLD-NIKPLEFKSLFKIDKLTGTIAMT 2310
            ++  LD E      L+   QDG          I + V D+NDN   F     R+S+PE+  + + I ++  +D D     ++ +S++   N  +  I  + G +  ++  DRET   +   V+  +           V + I DINDN P F    YS  I EN +    + +V A   D+G N  + Y  ++     +F    S  G++ L   LD +    + +TI A D G P  +S++  V I++LD N++ P F +  + +        +++++F  +   D   + E++ +N L+  NI+  +    F ID   GTI+++
Sbjct: 3123 VASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLM-GENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMD-STTGDLVLNATLDYEMSKFYFLTIQAIDGGTP-PLSNNAYVNISILDINDNSPTFLQNLYRI-------NVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVS 3438          

HSP 10 Score: 80.4925 bits (197), Expect = 9.441e-15
Identity = 91/382 (23.82%), Postives = 164/382 (42.93%), Query Frame = 1
Query: 1336 ITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDA-HYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQIS---NQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEF-----------EKPFFALTLSCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIIL 2430
            I+  + ++Q LD+EK +   LI+  +D G P   +  +I VNV D ND+   F  K I+  +PE+  IGS++  +  ID D    +E+ +SI+  +  S   ID   G +T     +     EY  +V+ V+  N   +  + V + ++   ++ P F   + +  I EN  +  F+ +V A         + S +  N IS   N+ F    S  G I +   +D +   +  +T+   +     + SS   + I +LD+N++ P F                +  L     + D       D D         +++D++     K+ FKID  TG I +  +    +++TN     ++ VS  D  KP    +T   + +
Sbjct: 1560 ISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTA--------RSSSSIFFNIISGNINESFRINPST-GVIVINGNIDYESIKVFNLTVKGTNMA---AESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLA----KNFFKIDSTTGAIELLRQ---LDYETNAGYTFDVTVS--DMGKPKLHSTTTAHVTI 1920          

HSP 11 Score: 70.8626 bits (172), Expect = 8.254e-12
Identity = 141/620 (22.74%), Postives = 251/620 (40.48%), Query Frame = 1
Query:  253 KYELIQHYNIFAIHPSTGFLQTIRSI-DREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQV-KLIVTRNISFRYDPIQCTLTAWD---LNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEW-----GEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYF--PQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDN--KPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSS 2067
            +Y ++    +F I  S+G L+T   I DRE           L R  V E      D + SN         I + D+NDN P F  +     ++   P GT +    A D DS++   ++Y++K               + +KL+ +  +L + +++       + T+ A+D      SS   L VKV  I+   P +    Y + +KE++ + S         A +V  +    +GR ++  I        F ID  TG + +   LD+E+    +  V+I A D+ +   +    +V  ++  +  P I +    +   E  +    +      DND  AN K+   I         E F +  +  N+      YL   LDYE+     +++  +D G P+L+S+  + + V D+NDN   F  P    ++S+         + +    D+     + + IV+ +     +ID   G ++   M +   K      + V   D V+   T    L+IS + +N   P+FD + Y   +PEN      I  V+A D D G    + Y  V++   ++ +      G I      D +K++ + V +   D G     +S
Sbjct: 2067 EYRILNPTQLFDIGISSGALKTTGVIFDREV--------KDLYRLFV-EAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGNG-----------ELFKLDRKSGELSIKQHVEGHNRNYELTVAAYDGAITPCSSEAPLQVKV--IDRSMPVFEKQFYTVSVKEDVEMYS---------ALSVSIEAESPLGRSLIYTISS--ESQSFEIDYNTGSIFVVNELDYEKISSHD--VSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNL------YLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISV--SDGVH---TAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSE-EMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFAS 2639          

HSP 12 Score: 67.3958 bits (163), Expect = 8.110e-11
Identity = 68/272 (25.00%), Postives = 119/272 (43.75%), Query Frame = 1
Query: 1345 EIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNC----SFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHY-SFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALT 2145
            E+ L Q LD E+Q    LI+  +    P   +   + ++V D NDN   F       S+ EN      ++++S  D D            S+     +  +ID  +G++T     DRE + EY F+V   +  +      V V ++I D NDN PVF       S+ EN      +  +  ID D+ E   + +  V+   +++  F +   GE+ +   LD ++   + ++I+A D       ++   V I V D N++ P   KP + ++
Sbjct: 2811 ELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDI-EKQEMDFFIVS--GDKQAQFQIGKSGELFIAKPLDREQLMFYNLSIIATDG----KFTAKANVEIDVKDINDNTPYCLKPRYHIS 3075          

HSP 13 Score: 66.2402 bits (160), Expect = 1.747e-10
Identity = 100/396 (25.25%), Postives = 175/396 (44.19%), Query Frame = 1
Query: 1213 PNYLDYFTVFDNDEDA--NGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGG-----KPNLTSKKRIAVNVIDVNDNRVYFPQ---KTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEV-QVVEKDNVNFTDTVKVI----------------LRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISM-SSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPSTDKDK-SPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMT 2310
            P Y     V  +D D   NG+I   +L   EYF +       P T EI L Q L Y + S   L +   D G     + +  SK +++++V  VN    Y P+   KT     P + P+   I+R++    DK + +  +I        V+ + +  +L    +   ETKDEY  E+ Q    +  +F   + ++                ++I   + N P+F    Y  SIPE   ++  + R++  D DLG+N  V Y+++   +    +    + G +     LD +K++ + +T+ A DQ    S   SS  V I+V D N++ P FE     ++++ +       +   T KD+ S EN+ ++Y + N+  +     F+ID  +G +  T
Sbjct:  197 PKYQSILKVTADDADLGINGEIYYSLLMDSEYFAIH------PTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVN---FYAPEIFTKTFSSVTPTSNPLIYGIVRVN----DKDTGINGNI---GRLEIVDGNPDGTFL----LKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALV-YLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISIN-ENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVP----FEIDHFSGIVKTT 566          

HSP 14 Score: 62.7734 bits (151), Expect = 2.247e-9
Identity = 153/701 (21.83%), Postives = 279/701 (39.80%), Query Frame = 1
Query:  457 TICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKC------SENIF------NLSFSIFRD-KQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQA-----TDADTVYGKVSYSIGRIMVRDIPKTFSGN---LFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYL---DYFTVFDNDED----ANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGG-KPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNCSFVN----IDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNL-FPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVK-----ENDCNFKT----------NNKEKVEIKVSVFDPTKPLFR 2403
            ++ I D+ND  P        + I E +  GT++   +A D DS   A + Y ++       SE  +      NL      D +Q K +H     +  N+     P          + SS   + + V D+ND++P +    Y+ ++    +    +   +A     +D D++  K+ Y               GN    ++ID +TG + L   L+F ++      V  I+  +G        TA   ++       + +        E   P N L   +  TV  +D D    AN   E    E  + F + ++T    IT ++      D EK+    ++++  DGG K    S K I V+V D      YF  K  ++ +   +     I+ +   D D      V F IV  SN   V     I+   G +      +    + Y F V+  ++    F   V V + I + + N P F+ +     I E+T     + ++  I N         Y     I+  + +F +S+ GE+ L   LD ++Q  H + +VA     P+  + +  V I V D N++ P+F+  F++ +++  ++ +   +   +TD D  P      YL  + + ++  ++F ID  +G I +        +++ NFK           + K  V IK+  ++   P+F+
Sbjct: 2328 SVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHH-----IVVNVKDHGSP----------SLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVY---------------GNELQTYSIDKLTGVISLQNMLNFTDK---SSTVLNISVSDGV------HTAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTG--VITSKV----TFDREKKDEYVVLLKVSDGGGKFGFASLKVIVVDVNDNVP---YFLLKEYKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHMIGN---------YTFKFSIAADQDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYAD-VLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQ--NIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFK 2968          

HSP 15 Score: 59.3066 bits (142), Expect = 2.399e-8
Identity = 65/247 (26.32%), Postives = 112/247 (45.34%), Query Frame = 1
Query: 1492 FPQKTIRISIPENIPIGSEII------RISTIDLDKKSEVAFSIVHS-------------SNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQV---VEKDNVNFTDT-VKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPIS----MSSSTTVFITVLDSNNHPPE-FEKPFFALT 2145
            F      ++IPEN  +G          R++ + +   +EV + I+                + +F+ I T     T N + +RE  +EY   V+    +   NV+  +T   + +++ D ND  P+F    Y+  IPE+T     I +V A D DLG NG + Y   + + +  ++      GEI L   L   + +  ++T+VA D+G  ++     +S T V I+V   N + PE F K F ++T
Sbjct:   62 FSHSVYNVTIPEN-SLGKTYAKGVLHERLAGLRVGLNAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTR----TNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYY---SLLMDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVT 300          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 150.214 bits (378), Expect = 4.202e-36
Identity = 186/715 (26.01%), Postives = 319/715 (44.62%), Query Frame = 1
Query:  271 HYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTI--CIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLI-VKVNDINDHSPEWPNSKYYIRIKENLLLDS-----IIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGN---LFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGE---YFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKS--EVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDA-HYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSY----VQVNQISNQRFYFTVS-------NYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNL--------FPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIA 2304
            H   F I P TG + T   ID E              + V +LT+ A D      PP     T+   I D+NDN P F +    + + E  P+G  +   SA D D    A++ Y +   E   +L+    R    ++    +L   R  S+ + P+  T    D    S+  +I +++ D+ND+ P +   +Y + ++E+    S      I    ATD D   +G+VSY I            +GN   +F ID  TG++ +        R Q  +++ I A D G    ++     + I D    PPI    R    V+E+ P   +    +  + + A+       +  G+   YF+++ ++ NI I      ++ LD+E +S + L IQ    G+P +    ++ + V DVNDN   F    +RIS+PE+  +G+ +      D D  S  +V +S+V  S      ID  +G+L  ++  D E+   +   V   +    + +  + +++ + D+NDN PVF+   YS ++ E+ S++  I +V A D D G N  ++Y      V+ ++N      VS       N G I L   LD + ++ +Q+T++A D G P +  + T V + VLD+N++ P+F+K  +          I++NL          ++D D   EN  + Y L     L   S F++  +TG I+
Sbjct:  550 HAQWFQIDPQTGLITTRSHIDCET-------------EPVPQLTVVARD---GGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTI--GEGFKHLTEFEVRSASGEICIAGELDFERRSSYEF-PVLAT----DRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRI-----------VAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRI------AKPLDHEAKSQVLLNIQATL-GEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTP-AAHAKTRVIVRVLDANDNDPKFQKSKYEF-------RIEENLRRGSVVGVVTASDLDLG-ENAAIRYSL-----LPINSSFQVHPVTGEIS 1209          

HSP 2 Score: 149.828 bits (377), Expect = 5.564e-36
Identity = 175/703 (24.89%), Postives = 305/703 (43.39%), Query Frame = 1
Query:  460 ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENI---FNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNG-----TPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGE-YFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDK--KSEVAFSIVHS--SNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDN--VNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTL------SCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQI--------ILENERYHKNVNEEINR 2475
            + ++D NDN+P+FP+ +  IE  E +P   +  L  A+D D   +   +Y++  S N+   F LS    RD    L+ Q+   + R  +  Y  +   L          M + + + D+ND+ P +  S+Y+  + EN  + + +    A+D D    G V Y+I R       ++    +F ID  TG + +N  LDFE +   E +V  +AKD+G     T +  S     ++      N   ++ +      E   P  ++   +V D D           L  G+ +F L     +I   Y + +   LD E  S   L +   D G P L + K I + + DVNDN   F Q     ++ E    G+ ++++   D D+   S + +S+  +  ++  +  ID   G +TT    D ET  E   ++ VV +D      + T  V++ I D+NDN+P+FD + Y+ S+ EN  V   I +V A D D G N  V+Y       +   +   S  GEI +   LD ++++ ++  ++A D+G    +S++  + + + D N++ P F    + ++L      S Q  +       +TD    P+      +   I       +F+ID+ TG I   V+ +  + +T     + I  +     +        L I        I E  RY+  V E+I R
Sbjct:  162 VTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNI-VSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINR------RQSDKEQMFRIDPRTGAIYINKALDFETKELHELVV--VAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSI---YLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCET--EPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRG---GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATD----PDYGNFGQVSYRIVAGNEAGIFRIDRSTGEI-FVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPR 842          

HSP 3 Score: 143.665 bits (361), Expect = 4.641e-34
Identity = 169/659 (25.64%), Postives = 311/659 (47.19%), Query Frame = 1
Query:  460 ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDM--KCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISF----RYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGN----LFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEEN-TPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDN--RVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVH---SSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVI-LRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDN--DLGENGT--------VSYVQVNQISNQRF--YFTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRPIS-MSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQ--TIDKNLFPSTDKDKSPENTKMNYLLDNIKPL------EFKSLFKIDKLTGTIAM 2307
            I +ED+NDN+P F      I + E + +G  L    A D+DS     + Y +  +  + +F +          +  H   LI+++++ +    R+  I         + S+++ ++V V D+ND+ P +   +Y + + E+  +++ I    A+D DT    +++Y I    V ++  + S +     F I   +G + L   LD E R    Y +T++A DNGTP+  + T  ++ + D NDN P    ++    +EEN    + +   T  D D   N  I   +L     F +       P+T EI   + LD E + +  L+++ +D G P  +++  + ++V DVNDN   +  PQ+ + +S+ E  P G+E++R+  +D D  + + + +SIV    S      +ID  +G + T  + D E +  Y   V   +  N    +TV+++ + + D+NDN+P F  +   F + E+ ++   +G +  I+   D+  N          V+Y  +N ++       F +  + G + +  +LD + Q+  ++ I A D     +  SS+ TV I V D N++ PE+ +    L +S  T   TI  N F +TD D +  N  + Y L    P       +  SLF++D LTG +++
Sbjct:  919 IEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAID--------ARSGH---LILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETR--DRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVH------PVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDV-VSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPP-RETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYT-LNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHN-FTATDAD-TGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSL 1553          

HSP 4 Score: 143.28 bits (360), Expect = 6.196e-34
Identity = 166/678 (24.48%), Postives = 283/678 (41.74%), Query Frame = 1
Query:  274 YNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIE--DINDNSPSFPELTQTIEINEKSPIG------TELELHSAQDRDS-----SDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNI------SFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVR-DIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLD----------YFTVFDNDEDANGKIECEILEW-GE-YFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPN-LTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKD-----------------------NVNFTDTVKVILRISDINDNKPVF--DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFE 2124
            + +F+I P++G ++T   +D E              + +  L + ASD      PP    + + +E  D+NDN P+F   +    + E + +G      + +E  +   R+S      D  +       ++++   +F I R       H   L+V R +       FR +      TA +   SS++ + ++V D+ND++PEWP     +++ E   + +IIH F ATDADT   G + Y + R   + +  +  + +LF +DS+TG + L   LDFE    +EY++ + A D  +       T+V       D                 T   ++           +    D D   NG++  EI    GE  F +   T  I +   +      D EK     LII  +D G+P    S   + + V   ++N   F Q   R +I EN+P GS +++++   L   + + +++ I         ++D   G +TT   FDRE++  Y   V V + +                       N    D   + + + D+NDN P F   + Y  S+PEN S  G I  V A D D G N  + Y         +F    S+ GE+     LD ++ + + + I A D+G+P S      + I V D N++ P F+
Sbjct: 1305 HGLFSIDPTSGVIRTRVVLDHE-------------ERSIYRLGVAASD---GGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDR-------HSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEA--VQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSL-PPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPEN-SEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSS-GELSA-RPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFK 1953          

HSP 5 Score: 140.584 bits (353), Expect = 4.123e-33
Identity = 154/630 (24.44%), Postives = 272/630 (43.17%), Query Frame = 1
Query:  397 LTIFASDLIQSNKPPERIYKTIC--IEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRN-ISFRYDPI-QCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNG----TPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGE--YFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEI--IRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHY-SFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPSTDKD-KSPENTKMNY 2232
            L++ A+D      PP    K+I   I D+NDN P F +      + E +  GT +    A DRD    + + Y +  +             + ++++ Q  LI TR+ I    +P+ Q T+ A D      SS+  ++V ++D+ND+ P +  S Y + + EN  +   I    A+D D  V   V+Y+IG               F + S +G++ + G LDFE R   E+   ++A D G    T  +    T V D              R             +      D D    G++   I+   E   F + +ST  I +        +L    Q M  L I   DGG     +   + +++ID       F +      + E+IP G+ +  +  ++ D+  +S V +SI       + +I+TN+G +   +  D E K +    +Q    +   +  T +V + + D+NDN P F+A     S+PE+  +   +    A D D G +G V+Y  V + S +  +   +  G + L   LD +    H + + A D G P S+S++ T+ + V D N++PP FEK  +++ +S ++++I+  +      D  +  N ++ Y
Sbjct:  472 LSVVATD---KGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPET--------HAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTE-------FEVRSASGEICIAGELDFERRSSYEF--PVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVR----PDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHT-QVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKE-SGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVP-SLSTNLTILVDVQDVNDNPPVFEKDEYSVNVS-ESRSINAQIIQVNASDLDTGNNARITY 1073          

HSP 6 Score: 139.043 bits (349), Expect = 1.068e-32
Identity = 150/602 (24.92%), Postives = 263/602 (43.69%), Query Frame = 1
Query:  466 IEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDM----------KCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSS---MRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSS--PTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSS------------------NCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNF--TDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSY------VQVNQISNQ--RFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPIS--MSSSTTVFITVLDSNNHPPEFEKP 2130
            ++D+NDN P F +   ++ ++E   I  ++   +A D D+ + A I Y +            S +  +  F IF +  +     ++  + R    RY   Q T+ A D  + ++    R+IV+V D ND+ P++  SKY  RI+ENL   S++    A+D D      + YS+       +P   S   F +  +TG++     LD E  L+  Y + + A+D GTP  S+  P    +   + N           +   EE  P   +      D D   N  I   I++ G   +     +  P +  I    +LD+E++S+  L +   DGG P   + + + V V+D+NDNR  F   ++   + E+  +G  +  IS I  ++ ++V  + V  S                    +F +ID ++G L    + DRE + E+  E++ ++    N   +  + V + ++D+NDN P +        + E T V   I    A D D G NG + Y       Q+N+   Q    +   S  G + L   LD +    + + + A DQ   ++  + +S TV + +LD+N+H P F  P
Sbjct: 1026 VQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIY---LRAPLDRETRDRY---QLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSL-------LPINSS---FQVHPVTGEISTREPLDRE--LRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVK-GRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPI--ERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAF-DIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSP 1605          

HSP 7 Score: 132.494 bits (332), Expect = 1.083e-30
Identity = 165/651 (25.35%), Postives = 281/651 (43.16%), Query Frame = 1
Query:  466 IEDINDNSPSFPELTQTIEINEKSPIGTELELHS-----AQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQ-CTLTAWD---LNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVY-GKVSYSIGRIMVRDIPKTFSGN---LFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENT---PPNYLDYFTVFDNDEDANGKIECEIL-EWGE-YFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKS--------------EVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNL--FPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTV 2313
            + D+NDN P F      + + E     ++          A D D  +F  + Y +            IFR    +   ++ ++    +S R  P+    ++A D   L S++   + + + D     P +  ++Y   +KE++   +++ +  A   D  +   V YSI           +SG+    F+I++ +G++++   LD E + Q   ++  I    G P +   T   I++ED NDN P    +   I V E+     P Y  +    D D  ++G++   ++ E G+  F +   + ++       LSQ LDYE      LI+   DGG P+L++   I V+V DVNDN   F +    +++ E+  I ++II+++  DLD  +               V  SI  S       I  N+G++      DRET+D Y   V   +          +VI+R+ D NDN P F  + Y F I EN      +G V A D DLGEN  + Y  +   S+ + +      GEI     LD + + ++ + + ARDQG P+  S+   V I V D N++ PE   P   +    + Q     +    + D+D   +N  + Y +   +  +   LF ID  +G I   V
Sbjct:  705 LTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEA-----GIFRID--RSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSI-----------YSGDPDGYFSIETNSGNIRIAKPLDHEAKSQ---VLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAH--AHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHL------ILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVT---GEISTREPLDRELRELYDLVVEARDQGTPVR-SARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHG-QNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRV 1321          

HSP 8 Score: 120.553 bits (301), Expect = 5.529e-27
Identity = 139/479 (29.02%), Postives = 219/479 (45.72%), Query Frame = 1
Query:  766 SSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEEN-TPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANI-----PITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNR----VYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIV--HSSNCSFVNIDTNNG-YLTTNEM-FDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVS-NYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLS 2151
            S  ++R++V V D ND++P +P +  +I   EN   +       A D D   Y    Y+I    V D  +  S +      +  D++++G LD E      Y + I A D GTP L    T  I I+D NDN PI N +R    V EN T    +      D D D NG +E  I       N ++S         P T  IY+++ LD+E + +  L++  +D G+  L +   +++ V DVNDN+    V F        I E+   G  + RIS  D D K+E A   V  +  +  F     +N  YL    +  DRE    Y   V   +K       +  + LRI+D+NDN P F+   Y  ++ E       + +V A D D G N  ++Y           +F +    G I     +D + + + Q+T+VARD G P  +SS+ TV +T+ D N++ P F++ F+ ++++
Sbjct:  154 SGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFR-LSSHRERDGVLYLDLQISGFLDRET--TPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAI-------NRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVP-PLSSTATVLVTIHDVNDNEPIFDQSFYNVSVA 621          

HSP 9 Score: 113.235 bits (282), Expect = 8.901e-25
Identity = 140/600 (23.33%), Postives = 257/600 (42.83%), Query Frame = 1
Query:  436 PPERIYKT--ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLI-VTRNISFRYDPI-QCTLTAWDLNSS---SSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDI-PKTFSGNL-FTIDSITGDMKLNG----------NLDFEERLQREYIVTIIAKDNGTPSL-SSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGE----YFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHS-SNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGF-----IGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVS-NYGEIRLFH--MLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEK 2127
            PP R + T  I I+D+NDN P F +      + E + +GT +    A D D+ +  +++Y +   ++         +++ ++++ +   I + + + F    + +  + A D       ++  + ++V D+ND+ P                ++ I  +  A+   +   +    + RI V D   KT   N+  T++   G   L            +L  +  +   Y ++++A D GTP L +S +  +   +  ++ P           +E   P   +      D DE  N  +   + E  E    +F +   T  I     I      D E + +  L +  +DGG P L+S   + V + DVNDN   F Q    +S+ EN P+G  I+++S  D D    + V ++I     + +   + + +G +      D E +  Y F V   ++  ++ T  +K  ++++D+NDN+PVF    Y  S+ E+           I  V A D D G  G VSY  V    N+   F +  + GEI +    ML +  Q +H + I A D G  +  ++   VF++++D+   PP FEK
Sbjct:  264 PPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSD--------KEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPT---------------INVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHI------DCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIK--MQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIV--AGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGN-LRSNADAVVFLSIIDAMQRPPIFEK 829          

HSP 10 Score: 103.99 bits (258), Expect = 6.219e-22
Identity = 163/681 (23.94%), Postives = 289/681 (42.44%), Query Frame = 1
Query:  268 QHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKT---ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQV--KLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKY-YIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-------------PNYLDYFTVFDNDEDAN-----GKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPN--LTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKS--EVAFSIV---------HSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTD----TVKVILRISDINDNKPVFDA-------HYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHML-----DIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTL 2148
            QH+ IF   P++G++     +DRE              +   +LT+ A+D    N  P    KT   + + D NDN P F +      I E    G+ + + +A D D  + A I+Y +       N SF +     + +  ++  +  + R +   YD +           S+ + + + V+D+ND++PE  + +   + ++E     + +   +A D D      ++YSI  +  RD   +    LF+ID  +G ++    LD EER    Y + + A D G P   +     +++ D NDN P    +  +  V E+               P  +   +V ++ ED         +  +++E    F++ + + N+ +      +++LD E QS   L I+  D    N   +S   + + V DVNDN   +PQ  I + + E  P+G+ I   +  D D  +  ++ + ++              S   +D+  G L+     D E   EY   VQ +++ + N T+    +V V LRI D ND+ P F +         S  I + T +   +  + A+D D G+NG ++Y         RF    S  G I L   L     D++K     + I A+D G+P    SS  + + V  S+N+PP F +  +  T+
Sbjct: 1094 QHFGIF---PNSGWIYLRAPLDRET-------------RDRYQLTVLATD----NGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLL----PINSSFQV-----HPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSI--VKGRD---SDGHGLFSIDPTSGVIRTRVVLDHEER--SIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAA--FDIDRHSGNLVV------ARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSS-NVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRIN-SQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATI 1728          

HSP 11 Score: 99.3673 bits (246), Expect = 1.533e-20
Identity = 140/613 (22.84%), Postives = 257/613 (41.92%), Query Frame = 1
Query:  373 LKRKCVLELTIFASDLIQSNKPPERIYKTICIE----DINDNSPSFPE------LTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLI-VTRNISFRYDPIQ------CTLTAWDLNS----SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKD-NGTPSLSSP-----------------------TTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEIL--EWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKK-RIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNF-TDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVS-NYGEIRLFHMLDIDKQNIHQVTIVARDQGRP 2052
            L  + V E  +    L QS+   ER+  ++ +     D ND++P F         T ++ I++ + IG  +    A D DS D   + Y++               + ++++N Q  +I + +++    + ++        + A D        SS+ L + V   +++ P +  + Y   I EN+   S +   Q T A +++G  + ++      +IP   + +LF +D   G +   G  D E   Q  Y++ +  +D N   +LSS                        T  +   +  +++P     +   + V EN+ P  +      D DE  N  +   I     G  F++  S+  +        ++ LD E+ S   L IQ  D G+P        I + V D NDN   F       S+ E+ P+G+ +++IS +D D    + + +S+ + +   F  ID  +G +TT    DRE +  Y F V   +       + TV V + + DINDN+P+F+ + Y   +P        + +V+A+D DLG N  + Y    + S     F ++ + G +     L  +   +  + +VARD+G P
Sbjct: 1557 LDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNG----------EGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFV--LQVT-AKSLHGAENANLSY----EIPAGVANDLFHVDWQRGIITTRGQFDRES--QASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELS-------ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFA-IDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNP 2142          

HSP 12 Score: 92.4337 bits (228), Expect = 1.961e-18
Identity = 160/687 (23.29%), Postives = 278/687 (40.47%), Query Frame = 1
Query:  283 FAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPER-IYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSS-----DFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQ---CTLTAWDLNSSSSMRLIVKVN------DINDHSPEW--PNSK----YYIRIKENLLLDSIIHTFQATDADTV-YGKVSYSIGRIMVRDIPKTFSGN---LFTIDSITGDMKLNGNLD-FEERLQR--EYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYF---TVFDNDEDANG--KIECEILEWGEYFNLKKSTANIPITYEIYLSQI------------LDYEKQSMIALIIQCQDGGKPNLTS-----KKR------------------IAVNVIDVNDNRVYF-PQKTIRISIPENIPIGS-EIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDT-VKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEK 2127
            F I   +G L   R +DRE              +    L I A D   SN P    I   I + D+NDN+P +P+    ++++E +P+GT +   +A D D+       + +I+Y  + +E+    + S+FR         +   ++      ++ +Q     + A D +S+ + RL   V       D NDH+P +  PNS       + I +   +  ++    A D D+   G+++Y I             GN    F I+S TG ++L  +L    E +++   + + I AKD+G P     +  +  I                     N PP +L      T+ +N    +   ++  + L   E  NL   +  IP      L  +             D E Q+   L +  +D  + +  S     K+R                  I + V DVNDN   F P     +S+PEN   G    +  S +D    +++ +SI   +  +  +ID+++G L+   + DRE    Y  ++Q  ++           + + + D NDN P F  + Y+ S+ E+  +   + ++ A+D DLG N  + Y   N+   Q  +      G I     LD + Q  +   ++A D GR    S++  V I VLD N++ P FE+
Sbjct: 1426 FDIDRHSGNLVVARLLDREV-------------QSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQ-EQAMSLFR------MDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEIT-----------GGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQG----------------SHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANL---SYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPL-DREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ--FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFER 2059          

HSP 13 Score: 92.4337 bits (228), Expect = 2.189e-18
Identity = 159/654 (24.31%), Postives = 277/654 (42.35%), Query Frame = 1
Query:  460 ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDM--KCSENIFNL--SFS------IFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXX------XXXXVEENTPPNYLDYFTVFDNDEDA---NGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDK-------KSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVE------KDNVNFTDTVKVILRISDINDNKPVFD--AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQIS-NQRFYFTVS-NYGEIRLFHMLDIDK-QNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFP--STDKDKSPENTKMNYLLDNIKPLEFK-SLFKIDKLTGTI 2301
            I +ED NDNSP F +      ++E +  GT +    A D D+   A ++Y +     +N F +  +FS      I  D++ +  +++K+I T                  +  ++++R  V++ D+ND+ P +P +   + + E   L ++I +  A D DT Y  ++Y +G     DI      ++F +D  +G + L   LD+E  LQ+EY + +IA D    + +  T  V D  D                   I ++ E+   ++ D  TV   D D+   N K+   I    E F++  S   + +     L   +       + +I   +D GKP L S   + V   D    R  F Q   R  I E  P+GS ++++    LD+         E AF ++ S     V            +  DRE  D Y   + +          ++N +  + VI+ I D NDN P+FD  A Y   I E   +   I +++AID D  EN   S V  +  S N    FT+    G + + + LD D     +++ I A D      + S     + + D N++ P+F    +   L+ + + +  ++F   ++D DK P   ++NY +      E    +F++D  +G +
Sbjct: 2310 IELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDE------------GVPQMTGTATIR--VQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDT-YPALTYRLGAESTVDIENM---SIFALDRYSGKLVLKRRLDYE--LQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDF-DLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMS-RLQPAVSSSGDYFVRII--AKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIVLV------------KPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDAD-QENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLA-ENEPVGSSVFRAHASDLDKGPFG-QLNYSIGPAPSDESSWKMFRVDSESGLV 2923          

HSP 14 Score: 90.5077 bits (223), Expect = 7.024e-18
Identity = 180/766 (23.50%), Postives = 314/766 (40.99%), Query Frame = 1
Query:  226 NLTRGKNLK-KYELIQHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDL---IQSNKPPERIYKTICIEDINDNSPSFPELTQ-TIEINEKSPIGTELELHSAQDRDSSDFAIIKYDM-KCSENIFNLSFSI-----FRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATD--ADTVYGKVSYSIGRIMVRDIPKTFSGNL----FTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPS--LSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDY-FTVFDNDEDANGKIECEILEWGEYFNLKKSTANI-----PITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNV----IDVNDNRVYFPQ------KTIRISIPENIPIGSEIIRISTIDLDK--KSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYA---FEVQVVEKDNVN---FTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSS----------------------TTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFP-------STDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIA 2304
            +L  G+N   +Y L+   + F +HP TG + T   +DRE              + + +L + A D    ++S + P RI+    + D+NDN+P   +  +  + + E+ P GTE+    A DRD    A I Y + K  ++  +  FSI         +  L+H+ + I    ++             +    +   L V+V D+ND+ P + +S    R++E+  L  ++ +    +  AD V   V  S   + V       + +L    F ID  +G++ +   LD E  +Q E+ + I A D    +   SS  T  I++ D NDN P    +   + V E TP   + + FT  D D   NG ++  ++ +    N  +  A        +T  + L   LD+E      LI+Q  D    N+T + + +V V    +D ND+  +F        KT  + I +   IG  +  I  +D D     ++ + I   +      I++  G +   +     T+D      F + +  KD+        ++ + L +   ++N P F  A Y  +I EN     F+ +V A      EN  +SY     ++N  F+      G I      D + Q  + + +  RD  R  ++SSS                       T++ITV D N++ PEF         SC   ++ +N  P       ++D D+ P N  + Y   +I      + F ID  +G ++
Sbjct: 1179 DLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDREL-------------RELYDLVVEARDQGTPVRSARVPVRIH----VSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVA--------ASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDRE--VQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSS-NVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQR-GIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPG------SCYGLSVPENSEPGVIHTVVASDLDEGP-NADLIY---SITGGNLGNKFSIDSSSGELS 1905          

HSP 15 Score: 86.2705 bits (212), Expect = 1.482e-16
Identity = 172/734 (23.43%), Postives = 298/734 (40.60%), Query Frame = 1
Query:  238 GKNLK-KYELI--QHYNIFAIHPS-TGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIE--DINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYD-PIQCTLTAWDLNSSSSMRLIVKVNDINDHSP----EWPNSKYYI-----RIKENLLLDSIIHTFQATDADTV--YGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLN-GNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGE--YFNLKKSTANIPITYEIYLSQILDYEKQSMIAL-IIQCQDGGKP-----NLTSKKRIAVNVIDVNDNRVYFPQKT-IRISIPENIPIGSEIIRISTIDLDKK----SEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRET-KDEYAFEVQVVEKDNVNFTDTVKVI-LRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYV---QVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQT---QTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVK 2316
            G N + +Y ++   H N F I P+ +G ++T   +DRE              + + +L I A+D      P      TI ++  D+NDN P+FP     + ++E + +G  +   SA D D+  +  + Y +     +   + SIF   +Y      KL++ R + +      +  + A D    +   L V+VND ND++P    + P + + I      I E+L +D  + T  ATDAD+     KV Y I            +   F++    G + +N   L        +Y V IIAKD G P+L S T   +   D          N+    + E  P   +    V    +DA  +    I+   E   F L +S A       I L + LD E+  +  L ++     G P     N +S   + + ++D NDN   F +       I E  P+   I ++  ID D++    SEV + I   ++     ID   G L  N   D ++    Y   ++  +  +     +++   L + D NDN+P F    Y   + EN  V   + R  A D D G  G ++Y      +  S+ + +   S  G +    + D +++  + + ++A D G      +S  V + +   +   P+F +  +   L       Q        +TD D  P+  ++ Y L    P    S FK+++ +G + +  K
Sbjct: 2352 GSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREI-------------RDIYKLKIIATD---EGVPQMTGTATIRVQIVDVNDNQPTFPP-NNLVTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRY----SGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEP----------AQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSV----VLQLGQDALDQ-SLAIIAGNEESAFELLQSKA-------IVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMG---GKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDG-RVVYQLS--AP---HSHFKVNRSSGAVLIKRK 3031          

HSP 16 Score: 80.8777 bits (198), Expect = 7.456e-15
Identity = 102/376 (27.13%), Postives = 173/376 (46.01%), Query Frame = 1
Query: 1063 EYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEE-NTPPNYLDYFTVFDNDEDANGKIECEILEWGE--YFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAF-----SIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-----DAHYSF-----SIPENTSVDGFIGRVRAIDNDL-GENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLD----IDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEF 2121
            E  V ++A+    P L+S    VI++ED NDN P  +  + +  V E N    ++     FD+D  +N ++   I++      F ++ + + I     +  + +LD E + +  L I   D G P +T    I V ++DVNDN+  FP   + +++ E   +G+ I  IS  D+D    + +     S V   N S   +D  +G L      D E + EY  E+ V+  D  +   TV + +R++D NDN PVF      A+++       I E+ SVD  +  V A D D  G N  V Y+    I   +  F+V     +   +M      +     + V I+A+D G+P ++ SST + +   D+ +   +F
Sbjct: 2287 EIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGI-----VRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEY--ELDVIASDAAHEARTV-LTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYI----IEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKP-ALKSSTLLRVQANDNGSGRSQF 2648          

HSP 17 Score: 78.9518 bits (193), Expect = 2.557e-14
Identity = 85/366 (23.22%), Postives = 162/366 (44.26%), Query Frame = 1
Query: 1390 IALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKS--EVAFSIVHSS-NCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDND--------LGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEF--EKP--FFALTLS----CQTQTIDKNLFP--STDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQI 2424
            I +++  +    P L S   + + + D NDN   F QK    ++ E    G+ + ++   D D  S   + + IV  + + +FV     +G + TN + DRE +D Y  ++   ++     T T  + ++I D+NDN+P F  +   ++ E T +   I  + A D D        LG   TV       I N   +      G++ L   LD + Q  +++ ++A D        + T + + V D N++ P F  ++P  +FA+  +     ++ ++D +L    +TD D    N+K+ Y+   I+P +    F +    G +++ +        ++    V I     D  KP  + ST+L++
Sbjct: 2288 IRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVD------IENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAH----EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYI---IEPAQ--EGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAK--DAGKPALKSSTLLRV 2636          

HSP 18 Score: 64.3142 bits (155), Expect = 6.773e-10
Identity = 74/279 (26.52%), Postives = 128/279 (45.88%), Query Frame = 1
Query: 1336 ITYEIYLSQILDYEK--QSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSI----VHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSV-DGF-IGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVS-NYGEIRLFHMLDIDKQNIHQVTIVARD--------QGRPISMSSSTTVFITVLDSNNHP 2112
            +T  ++++  LDY+   +S   +I  C    +  L S +   + + D NDN   FP       + EN P+GS + R    DLDK    ++ +SI       S+     +D+ +G +T+  +FD E +  Y  +++++  D      +V V + I   ++  P F +  Y F +P   ++  G+ +G+V A D+D G +G V Y    Q+S    +F V+ + G + +   L +D      + +  RD         GR  S+SS   V I  LD   HP
Sbjct: 2808 VTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRY--DMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVY----QLSAPHSHFKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRDISLVISASSGRHNSLSSMAVVEIA-LDPLAHP 3079          

HSP 19 Score: 51.2174 bits (121), Expect = 6.693e-6
Identity = 60/231 (25.97%), Postives = 101/231 (43.72%), Query Frame = 1
Query: 1636 IDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSN------YGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFP--STDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTI 2301
            ID   G + T    DRET+  Y+     +   N      ++V++ + D NDN P F         PENT  +     + A D DL    T  Y  V+   N  F  +         Y ++++   LD +    + + I A D G P  +    TV IT+ D N++ P F +  +  T+  +  T+  ++    ++D D + EN  + Y + N +  + + +F+ID  TG I
Sbjct:  125 IDRATGEIRTKVKLDRETRASYSLVAIPLSGRN------IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTP-PLRGFMTVNITIQDVNDNQPIFNQSRYFATVP-ENATVGTSVLQVYASDTD-ADENGLVEYAI-NRRQSDKEQMFRIDPRTGAI 345          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 150.214 bits (378), Expect = 4.202e-36
Identity = 186/715 (26.01%), Postives = 319/715 (44.62%), Query Frame = 1
Query:  271 HYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTI--CIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLI-VKVNDINDHSPEWPNSKYYIRIKENLLLDS-----IIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGN---LFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGE---YFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKS--EVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDA-HYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSY----VQVNQISNQRFYFTVS-------NYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNL--------FPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIA 2304
            H   F I P TG + T   ID E              + V +LT+ A D      PP     T+   I D+NDN P F +    + + E  P+G  +   SA D D    A++ Y +   E   +L+    R    ++    +L   R  S+ + P+  T    D    S+  +I +++ D+ND+ P +   +Y + ++E+    S      I    ATD D   +G+VSY I            +GN   +F ID  TG++ +        R Q  +++ I A D G    ++     + I D    PPI    R    V+E+ P   +    +  + + A+       +  G+   YF+++ ++ NI I      ++ LD+E +S + L IQ    G+P +    ++ + V DVNDN   F    +RIS+PE+  +G+ +      D D  S  +V +S+V  S      ID  +G+L  ++  D E+   +   V   +    + +  + +++ + D+NDN PVF+   YS ++ E+ S++  I +V A D D G N  ++Y      V+ ++N      VS       N G I L   LD + ++ +Q+T++A D G P +  + T V + VLD+N++ P+F+K  +          I++NL          ++D D   EN  + Y L     L   S F++  +TG I+
Sbjct:  550 HAQWFQIDPQTGLITTRSHIDCET-------------EPVPQLTVVARD---GGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTI--GEGFKHLTEFEVRSASGEICIAGELDFERRSSYEF-PVLAT----DRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRI-----------VAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRI------AKPLDHEAKSQVLLNIQATL-GEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTP-AAHAKTRVIVRVLDANDNDPKFQKSKYEF-------RIEENLRRGSVVGVVTASDLDLG-ENAAIRYSL-----LPINSSFQVHPVTGEIS 1209          

HSP 2 Score: 149.828 bits (377), Expect = 5.564e-36
Identity = 175/703 (24.89%), Postives = 305/703 (43.39%), Query Frame = 1
Query:  460 ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENI---FNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNG-----TPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGE-YFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDK--KSEVAFSIVHS--SNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDN--VNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTL------SCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQI--------ILENERYHKNVNEEINR 2475
            + ++D NDN+P+FP+ +  IE  E +P   +  L  A+D D   +   +Y++  S N+   F LS    RD    L+ Q+   + R  +  Y  +   L          M + + + D+ND+ P +  S+Y+  + EN  + + +    A+D D    G V Y+I R       ++    +F ID  TG + +N  LDFE +   E +V  +AKD+G     T +  S     ++      N   ++ +      E   P  ++   +V D D           L  G+ +F L     +I   Y + +   LD E  S   L +   D G P L + K I + + DVNDN   F Q     ++ E    G+ ++++   D D+   S + +S+  +  ++  +  ID   G +TT    D ET  E   ++ VV +D      + T  V++ I D+NDN+P+FD + Y+ S+ EN  V   I +V A D D G N  V+Y       +   +   S  GEI +   LD ++++ ++  ++A D+G    +S++  + + + D N++ P F    + ++L      S Q  +       +TD    P+      +   I       +F+ID+ TG I   V+ +  + +T     + I  +     +        L I        I E  RY+  V E+I R
Sbjct:  162 VTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNI-VSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINR------RQSDKEQMFRIDPRTGAIYINKALDFETKELHELVV--VAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSI---YLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCET--EPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRG---GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATD----PDYGNFGQVSYRIVAGNEAGIFRIDRSTGEI-FVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPR 842          

HSP 3 Score: 143.665 bits (361), Expect = 4.641e-34
Identity = 169/659 (25.64%), Postives = 311/659 (47.19%), Query Frame = 1
Query:  460 ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDM--KCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISF----RYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGN----LFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEEN-TPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDN--RVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVH---SSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVI-LRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDN--DLGENGT--------VSYVQVNQISNQRF--YFTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRPIS-MSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQ--TIDKNLFPSTDKDKSPENTKMNYLLDNIKPL------EFKSLFKIDKLTGTIAM 2307
            I +ED+NDN+P F      I + E + +G  L    A D+DS     + Y +  +  + +F +          +  H   LI+++++ +    R+  I         + S+++ ++V V D+ND+ P +   +Y + + E+  +++ I    A+D DT    +++Y I    V ++  + S +     F I   +G + L   LD E R    Y +T++A DNGTP+  + T  ++ + D NDN P    ++    +EEN    + +   T  D D   N  I   +L     F +       P+T EI   + LD E + +  L+++ +D G P  +++  + ++V DVNDN   +  PQ+ + +S+ E  P G+E++R+  +D D  + + + +SIV    S      +ID  +G + T  + D E +  Y   V   +  N    +TV+++ + + D+NDN+P F  +   F + E+ ++   +G +  I+   D+  N          V+Y  +N ++       F +  + G + +  +LD + Q+  ++ I A D     +  SS+ TV I V D N++ PE+ +    L +S  T   TI  N F +TD D +  N  + Y L    P       +  SLF++D LTG +++
Sbjct:  919 IEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAID--------ARSGH---LILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETR--DRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVH------PVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDV-VSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPP-RETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYT-LNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHN-FTATDAD-TGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSL 1553          

HSP 4 Score: 143.28 bits (360), Expect = 6.196e-34
Identity = 166/678 (24.48%), Postives = 283/678 (41.74%), Query Frame = 1
Query:  274 YNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIE--DINDNSPSFPELTQTIEINEKSPIG------TELELHSAQDRDS-----SDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNI------SFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVR-DIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLD----------YFTVFDNDEDANGKIECEILEW-GE-YFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPN-LTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKD-----------------------NVNFTDTVKVILRISDINDNKPVF--DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFE 2124
            + +F+I P++G ++T   +D E              + +  L + ASD      PP    + + +E  D+NDN P+F   +    + E + +G      + +E  +   R+S      D  +       ++++   +F I R       H   L+V R +       FR +      TA +   SS++ + ++V D+ND++PEWP     +++ E   + +IIH F ATDADT   G + Y + R   + +  +  + +LF +DS+TG + L   LDFE    +EY++ + A D  +       T+V       D                 T   ++           +    D D   NG++  EI    GE  F +   T  I +   +      D EK     LII  +D G+P    S   + + V   ++N   F Q   R +I EN+P GS +++++   L   + + +++ I         ++D   G +TT   FDRE++  Y   V V + +                       N    D   + + + D+NDN P F   + Y  S+PEN S  G I  V A D D G N  + Y         +F    S+ GE+     LD ++ + + + I A D+G+P S      + I V D N++ P F+
Sbjct: 1305 HGLFSIDPTSGVIRTRVVLDHE-------------ERSIYRLGVAASD---GGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDR-------HSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEA--VQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSL-PPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPEN-SEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSS-GELSA-RPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFK 1953          

HSP 5 Score: 140.584 bits (353), Expect = 4.123e-33
Identity = 154/630 (24.44%), Postives = 272/630 (43.17%), Query Frame = 1
Query:  397 LTIFASDLIQSNKPPERIYKTIC--IEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRN-ISFRYDPI-QCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNG----TPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGE--YFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEI--IRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHY-SFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPSTDKD-KSPENTKMNY 2232
            L++ A+D      PP    K+I   I D+NDN P F +      + E +  GT +    A DRD    + + Y +  +             + ++++ Q  LI TR+ I    +P+ Q T+ A D      SS+  ++V ++D+ND+ P +  S Y + + EN  +   I    A+D D  V   V+Y+IG               F + S +G++ + G LDFE R   E+   ++A D G    T  +    T V D              R             +      D D    G++   I+   E   F + +ST  I +        +L    Q M  L I   DGG     +   + +++ID       F +      + E+IP G+ +  +  ++ D+  +S V +SI       + +I+TN+G +   +  D E K +    +Q    +   +  T +V + + D+NDN P F+A     S+PE+  +   +    A D D G +G V+Y  V + S +  +   +  G + L   LD +    H + + A D G P S+S++ T+ + V D N++PP FEK  +++ +S ++++I+  +      D  +  N ++ Y
Sbjct:  472 LSVVATD---KGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPET--------HAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTE-------FEVRSASGEICIAGELDFERRSSYEF--PVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVR----PDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHT-QVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKE-SGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVP-SLSTNLTILVDVQDVNDNPPVFEKDEYSVNVS-ESRSINAQIIQVNASDLDTGNNARITY 1073          

HSP 6 Score: 139.043 bits (349), Expect = 1.068e-32
Identity = 150/602 (24.92%), Postives = 263/602 (43.69%), Query Frame = 1
Query:  466 IEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDM----------KCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSS---MRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSS--PTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSS------------------NCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNF--TDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSY------VQVNQISNQ--RFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPIS--MSSSTTVFITVLDSNNHPPEFEKP 2130
            ++D+NDN P F +   ++ ++E   I  ++   +A D D+ + A I Y +            S +  +  F IF +  +     ++  + R    RY   Q T+ A D  + ++    R+IV+V D ND+ P++  SKY  RI+ENL   S++    A+D D      + YS+       +P   S   F +  +TG++     LD E  L+  Y + + A+D GTP  S+  P    +   + N           +   EE  P   +      D D   N  I   I++ G   +     +  P +  I    +LD+E++S+  L +   DGG P   + + + V V+D+NDNR  F   ++   + E+  +G  +  IS I  ++ ++V  + V  S                    +F +ID ++G L    + DRE + E+  E++ ++    N   +  + V + ++D+NDN P +        + E T V   I    A D D G NG + Y       Q+N+   Q    +   S  G + L   LD +    + + + A DQ   ++  + +S TV + +LD+N+H P F  P
Sbjct: 1026 VQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIY---LRAPLDRETRDRY---QLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSL-------LPINSS---FQVHPVTGEISTREPLDRE--LRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVK-GRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPI--ERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAF-DIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSP 1605          

HSP 7 Score: 132.494 bits (332), Expect = 1.083e-30
Identity = 165/651 (25.35%), Postives = 281/651 (43.16%), Query Frame = 1
Query:  466 IEDINDNSPSFPELTQTIEINEKSPIGTELELHS-----AQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQ-CTLTAWD---LNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVY-GKVSYSIGRIMVRDIPKTFSGN---LFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENT---PPNYLDYFTVFDNDEDANGKIECEIL-EWGE-YFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKS--------------EVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNL--FPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTV 2313
            + D+NDN P F      + + E     ++          A D D  +F  + Y +            IFR    +   ++ ++    +S R  P+    ++A D   L S++   + + + D     P +  ++Y   +KE++   +++ +  A   D  +   V YSI           +SG+    F+I++ +G++++   LD E + Q   ++  I    G P +   T   I++ED NDN P    +   I V E+     P Y  +    D D  ++G++   ++ E G+  F +   + ++       LSQ LDYE      LI+   DGG P+L++   I V+V DVNDN   F +    +++ E+  I ++II+++  DLD  +               V  SI  S       I  N+G++      DRET+D Y   V   +          +VI+R+ D NDN P F  + Y F I EN      +G V A D DLGEN  + Y  +   S+ + +      GEI     LD + + ++ + + ARDQG P+  S+   V I V D N++ PE   P   +    + Q     +    + D+D   +N  + Y +   +  +   LF ID  +G I   V
Sbjct:  705 LTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEA-----GIFRID--RSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSI-----------YSGDPDGYFSIETNSGNIRIAKPLDHEAKSQ---VLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAH--AHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHL------ILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVT---GEISTREPLDRELRELYDLVVEARDQGTPVR-SARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHG-QNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRV 1321          

HSP 8 Score: 120.553 bits (301), Expect = 5.529e-27
Identity = 139/479 (29.02%), Postives = 219/479 (45.72%), Query Frame = 1
Query:  766 SSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEEN-TPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANI-----PITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNR----VYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIV--HSSNCSFVNIDTNNG-YLTTNEM-FDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVS-NYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLS 2151
            S  ++R++V V D ND++P +P +  +I   EN   +       A D D   Y    Y+I    V D  +  S +      +  D++++G LD E      Y + I A D GTP L    T  I I+D NDN PI N +R    V EN T    +      D D D NG +E  I       N ++S         P T  IY+++ LD+E + +  L++  +D G+  L +   +++ V DVNDN+    V F        I E+   G  + RIS  D D K+E A   V  +  +  F     +N  YL    +  DRE    Y   V   +K       +  + LRI+D+NDN P F+   Y  ++ E       + +V A D D G N  ++Y           +F +    G I     +D + + + Q+T+VARD G P  +SS+ TV +T+ D N++ P F++ F+ ++++
Sbjct:  154 SGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFR-LSSHRERDGVLYLDLQISGFLDRET--TPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAI-------NRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVP-PLSSTATVLVTIHDVNDNEPIFDQSFYNVSVA 621          

HSP 9 Score: 113.235 bits (282), Expect = 8.901e-25
Identity = 140/600 (23.33%), Postives = 257/600 (42.83%), Query Frame = 1
Query:  436 PPERIYKT--ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLI-VTRNISFRYDPI-QCTLTAWDLNSS---SSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDI-PKTFSGNL-FTIDSITGDMKLNG----------NLDFEERLQREYIVTIIAKDNGTPSL-SSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGE----YFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHS-SNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGF-----IGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVS-NYGEIRLFH--MLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEK 2127
            PP R + T  I I+D+NDN P F +      + E + +GT +    A D D+ +  +++Y +   ++         +++ ++++ +   I + + + F    + +  + A D       ++  + ++V D+ND+ P                ++ I  +  A+   +   +    + RI V D   KT   N+  T++   G   L            +L  +  +   Y ++++A D GTP L +S +  +   +  ++ P           +E   P   +      D DE  N  +   + E  E    +F +   T  I     I      D E + +  L +  +DGG P L+S   + V + DVNDN   F Q    +S+ EN P+G  I+++S  D D    + V ++I     + +   + + +G +      D E +  Y F V   ++  ++ T  +K  ++++D+NDN+PVF    Y  S+ E+           I  V A D D G  G VSY  V    N+   F +  + GEI +    ML +  Q +H + I A D G  +  ++   VF++++D+   PP FEK
Sbjct:  264 PPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSD--------KEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPT---------------INVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHI------DCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIK--MQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIV--AGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGN-LRSNADAVVFLSIIDAMQRPPIFEK 829          

HSP 10 Score: 103.99 bits (258), Expect = 6.219e-22
Identity = 163/681 (23.94%), Postives = 289/681 (42.44%), Query Frame = 1
Query:  268 QHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKT---ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQV--KLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKY-YIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-------------PNYLDYFTVFDNDEDAN-----GKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPN--LTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKS--EVAFSIV---------HSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTD----TVKVILRISDINDNKPVFDA-------HYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHML-----DIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTL 2148
            QH+ IF   P++G++     +DRE              +   +LT+ A+D    N  P    KT   + + D NDN P F +      I E    G+ + + +A D D  + A I+Y +       N SF +     + +  ++  +  + R +   YD +           S+ + + + V+D+ND++PE  + +   + ++E     + +   +A D D      ++YSI  +  RD   +    LF+ID  +G ++    LD EER    Y + + A D G P   +     +++ D NDN P    +  +  V E+               P  +   +V ++ ED         +  +++E    F++ + + N+ +      +++LD E QS   L I+  D    N   +S   + + V DVNDN   +PQ  I + + E  P+G+ I   +  D D  +  ++ + ++              S   +D+  G L+     D E   EY   VQ +++ + N T+    +V V LRI D ND+ P F +         S  I + T +   +  + A+D D G+NG ++Y         RF    S  G I L   L     D++K     + I A+D G+P    SS  + + V  S+N+PP F +  +  T+
Sbjct: 1094 QHFGIF---PNSGWIYLRAPLDRET-------------RDRYQLTVLATD----NGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLL----PINSSFQV-----HPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSI--VKGRD---SDGHGLFSIDPTSGVIRTRVVLDHEER--SIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAA--FDIDRHSGNLVV------ARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSS-NVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRIN-SQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATI 1728          

HSP 11 Score: 99.3673 bits (246), Expect = 1.533e-20
Identity = 140/613 (22.84%), Postives = 257/613 (41.92%), Query Frame = 1
Query:  373 LKRKCVLELTIFASDLIQSNKPPERIYKTICIE----DINDNSPSFPE------LTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLI-VTRNISFRYDPIQ------CTLTAWDLNS----SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKD-NGTPSLSSP-----------------------TTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEIL--EWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKK-RIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNF-TDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVS-NYGEIRLFHMLDIDKQNIHQVTIVARDQGRP 2052
            L  + V E  +    L QS+   ER+  ++ +     D ND++P F         T ++ I++ + IG  +    A D DS D   + Y++               + ++++N Q  +I + +++    + ++        + A D        SS+ L + V   +++ P +  + Y   I EN+   S +   Q T A +++G  + ++      +IP   + +LF +D   G +   G  D E   Q  Y++ +  +D N   +LSS                        T  +   +  +++P     +   + V EN+ P  +      D DE  N  +   I     G  F++  S+  +        ++ LD E+ S   L IQ  D G+P        I + V D NDN   F       S+ E+ P+G+ +++IS +D D    + + +S+ + +   F  ID  +G +TT    DRE +  Y F V   +       + TV V + + DINDN+P+F+ + Y   +P        + +V+A+D DLG N  + Y    + S     F ++ + G +     L  +   +  + +VARD+G P
Sbjct: 1557 LDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNG----------EGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFV--LQVT-AKSLHGAENANLSY----EIPAGVANDLFHVDWQRGIITTRGQFDRES--QASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELS-------ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFA-IDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNP 2142          

HSP 12 Score: 92.4337 bits (228), Expect = 1.961e-18
Identity = 160/687 (23.29%), Postives = 278/687 (40.47%), Query Frame = 1
Query:  283 FAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPER-IYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSS-----DFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQ---CTLTAWDLNSSSSMRLIVKVN------DINDHSPEW--PNSK----YYIRIKENLLLDSIIHTFQATDADTV-YGKVSYSIGRIMVRDIPKTFSGN---LFTIDSITGDMKLNGNLD-FEERLQR--EYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYF---TVFDNDEDANG--KIECEILEWGEYFNLKKSTANIPITYEIYLSQI------------LDYEKQSMIALIIQCQDGGKPNLTS-----KKR------------------IAVNVIDVNDNRVYF-PQKTIRISIPENIPIGS-EIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDT-VKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEK 2127
            F I   +G L   R +DRE              +    L I A D   SN P    I   I + D+NDN+P +P+    ++++E +P+GT +   +A D D+       + +I+Y  + +E+    + S+FR         +   ++      ++ +Q     + A D +S+ + RL   V       D NDH+P +  PNS       + I +   +  ++    A D D+   G+++Y I             GN    F I+S TG ++L  +L    E +++   + + I AKD+G P     +  +  I                     N PP +L      T+ +N    +   ++  + L   E  NL   +  IP      L  +             D E Q+   L +  +D  + +  S     K+R                  I + V DVNDN   F P     +S+PEN   G    +  S +D    +++ +SI   +  +  +ID+++G L+   + DRE    Y  ++Q  ++           + + + D NDN P F  + Y+ S+ E+  +   + ++ A+D DLG N  + Y   N+   Q  +      G I     LD + Q  +   ++A D GR    S++  V I VLD N++ P FE+
Sbjct: 1426 FDIDRHSGNLVVARLLDREV-------------QSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQ-EQAMSLFR------MDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEIT-----------GGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQG----------------SHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANL---SYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPL-DREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ--FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFER 2059          

HSP 13 Score: 92.4337 bits (228), Expect = 2.189e-18
Identity = 159/654 (24.31%), Postives = 277/654 (42.35%), Query Frame = 1
Query:  460 ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDM--KCSENIFNL--SFS------IFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXX------XXXXVEENTPPNYLDYFTVFDNDEDA---NGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDK-------KSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVE------KDNVNFTDTVKVILRISDINDNKPVFD--AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQIS-NQRFYFTVS-NYGEIRLFHMLDIDK-QNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFP--STDKDKSPENTKMNYLLDNIKPLEFK-SLFKIDKLTGTI 2301
            I +ED NDNSP F +      ++E +  GT +    A D D+   A ++Y +     +N F +  +FS      I  D++ +  +++K+I T                  +  ++++R  V++ D+ND+ P +P +   + + E   L ++I +  A D DT Y  ++Y +G     DI      ++F +D  +G + L   LD+E  LQ+EY + +IA D    + +  T  V D  D                   I ++ E+   ++ D  TV   D D+   N K+   I    E F++  S   + +     L   +       + +I   +D GKP L S   + V   D    R  F Q   R  I E  P+GS ++++    LD+         E AF ++ S     V            +  DRE  D Y   + +          ++N +  + VI+ I D NDN P+FD  A Y   I E   +   I +++AID D  EN   S V  +  S N    FT+    G + + + LD D     +++ I A D      + S     + + D N++ P+F    +   L+ + + +  ++F   ++D DK P   ++NY +      E    +F++D  +G +
Sbjct: 2310 IELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDE------------GVPQMTGTATIR--VQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDT-YPALTYRLGAESTVDIENM---SIFALDRYSGKLVLKRRLDYE--LQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDF-DLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMS-RLQPAVSSSGDYFVRII--AKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIVLV------------KPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDAD-QENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLA-ENEPVGSSVFRAHASDLDKGPFG-QLNYSIGPAPSDESSWKMFRVDSESGLV 2923          

HSP 14 Score: 90.5077 bits (223), Expect = 7.024e-18
Identity = 180/766 (23.50%), Postives = 314/766 (40.99%), Query Frame = 1
Query:  226 NLTRGKNLK-KYELIQHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDL---IQSNKPPERIYKTICIEDINDNSPSFPELTQ-TIEINEKSPIGTELELHSAQDRDSSDFAIIKYDM-KCSENIFNLSFSI-----FRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATD--ADTVYGKVSYSIGRIMVRDIPKTFSGNL----FTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPS--LSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDY-FTVFDNDEDANGKIECEILEWGEYFNLKKSTANI-----PITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNV----IDVNDNRVYFPQ------KTIRISIPENIPIGSEIIRISTIDLDK--KSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYA---FEVQVVEKDNVN---FTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSS----------------------TTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFP-------STDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIA 2304
            +L  G+N   +Y L+   + F +HP TG + T   +DRE              + + +L + A D    ++S + P RI+    + D+NDN+P   +  +  + + E+ P GTE+    A DRD    A I Y + K  ++  +  FSI         +  L+H+ + I    ++             +    +   L V+V D+ND+ P + +S    R++E+  L  ++ +    +  AD V   V  S   + V       + +L    F ID  +G++ +   LD E  +Q E+ + I A D    +   SS  T  I++ D NDN P    +   + V E TP   + + FT  D D   NG ++  ++ +    N  +  A        +T  + L   LD+E      LI+Q  D    N+T + + +V V    +D ND+  +F        KT  + I +   IG  +  I  +D D     ++ + I   +      I++  G +   +     T+D      F + +  KD+        ++ + L +   ++N P F  A Y  +I EN     F+ +V A      EN  +SY     ++N  F+      G I      D + Q  + + +  RD  R  ++SSS                       T++ITV D N++ PEF         SC   ++ +N  P       ++D D+ P N  + Y   +I      + F ID  +G ++
Sbjct: 1179 DLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDREL-------------RELYDLVVEARDQGTPVRSARVPVRIH----VSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVA--------ASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDRE--VQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSS-NVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQR-GIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPG------SCYGLSVPENSEPGVIHTVVASDLDEGP-NADLIY---SITGGNLGNKFSIDSSSGELS 1905          

HSP 15 Score: 86.2705 bits (212), Expect = 1.482e-16
Identity = 172/734 (23.43%), Postives = 298/734 (40.60%), Query Frame = 1
Query:  238 GKNLK-KYELI--QHYNIFAIHPS-TGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIE--DINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYD-PIQCTLTAWDLNSSSSMRLIVKVNDINDHSP----EWPNSKYYI-----RIKENLLLDSIIHTFQATDADTV--YGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLN-GNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGE--YFNLKKSTANIPITYEIYLSQILDYEKQSMIAL-IIQCQDGGKP-----NLTSKKRIAVNVIDVNDNRVYFPQKT-IRISIPENIPIGSEIIRISTIDLDKK----SEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRET-KDEYAFEVQVVEKDNVNFTDTVKVI-LRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYV---QVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQT---QTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVK 2316
            G N + +Y ++   H N F I P+ +G ++T   +DRE              + + +L I A+D      P      TI ++  D+NDN P+FP     + ++E + +G  +   SA D D+  +  + Y +     +   + SIF   +Y      KL++ R + +      +  + A D    +   L V+VND ND++P    + P + + I      I E+L +D  + T  ATDAD+     KV Y I            +   F++    G + +N   L        +Y V IIAKD G P+L S T   +   D          N+    + E  P   +    V    +DA  +    I+   E   F L +S A       I L + LD E+  +  L ++     G P     N +S   + + ++D NDN   F +       I E  P+   I ++  ID D++    SEV + I   ++     ID   G L  N   D ++    Y   ++  +  +     +++   L + D NDN+P F    Y   + EN  V   + R  A D D G  G ++Y      +  S+ + +   S  G +    + D +++  + + ++A D G      +S  V + +   +   P+F +  +   L       Q        +TD D  P+  ++ Y L    P    S FK+++ +G + +  K
Sbjct: 2352 GSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREI-------------RDIYKLKIIATD---EGVPQMTGTATIRVQIVDVNDNQPTFPP-NNLVTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRY----SGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEP----------AQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSV----VLQLGQDALDQ-SLAIIAGNEESAFELLQSKA-------IVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMG---GKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDG-RVVYQLS--AP---HSHFKVNRSSGAVLIKRK 3031          

HSP 16 Score: 80.8777 bits (198), Expect = 7.456e-15
Identity = 102/376 (27.13%), Postives = 173/376 (46.01%), Query Frame = 1
Query: 1063 EYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEE-NTPPNYLDYFTVFDNDEDANGKIECEILEWGE--YFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAF-----SIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-----DAHYSF-----SIPENTSVDGFIGRVRAIDNDL-GENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLD----IDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEF 2121
            E  V ++A+    P L+S    VI++ED NDN P  +  + +  V E N    ++     FD+D  +N ++   I++      F ++ + + I     +  + +LD E + +  L I   D G P +T    I V ++DVNDN+  FP   + +++ E   +G+ I  IS  D+D    + +     S V   N S   +D  +G L      D E + EY  E+ V+  D  +   TV + +R++D NDN PVF      A+++       I E+ SVD  +  V A D D  G N  V Y+    I   +  F+V     +   +M      +     + V I+A+D G+P ++ SST + +   D+ +   +F
Sbjct: 2287 EIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGI-----VRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEY--ELDVIASDAAHEARTV-LTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYI----IEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKP-ALKSSTLLRVQANDNGSGRSQF 2648          

HSP 17 Score: 78.9518 bits (193), Expect = 2.557e-14
Identity = 85/366 (23.22%), Postives = 162/366 (44.26%), Query Frame = 1
Query: 1390 IALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKS--EVAFSIVHSS-NCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDND--------LGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEF--EKP--FFALTLS----CQTQTIDKNLFP--STDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQI 2424
            I +++  +    P L S   + + + D NDN   F QK    ++ E    G+ + ++   D D  S   + + IV  + + +FV     +G + TN + DRE +D Y  ++   ++     T T  + ++I D+NDN+P F  +   ++ E T +   I  + A D D        LG   TV       I N   +      G++ L   LD + Q  +++ ++A D        + T + + V D N++ P F  ++P  +FA+  +     ++ ++D +L    +TD D    N+K+ Y+   I+P +    F +    G +++ +        ++    V I     D  KP  + ST+L++
Sbjct: 2288 IRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVD------IENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAH----EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYI---IEPAQ--EGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAK--DAGKPALKSSTLLRV 2636          

HSP 18 Score: 64.3142 bits (155), Expect = 6.773e-10
Identity = 74/279 (26.52%), Postives = 128/279 (45.88%), Query Frame = 1
Query: 1336 ITYEIYLSQILDYEK--QSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSI----VHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSV-DGF-IGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVS-NYGEIRLFHMLDIDKQNIHQVTIVARD--------QGRPISMSSSTTVFITVLDSNNHP 2112
            +T  ++++  LDY+   +S   +I  C    +  L S +   + + D NDN   FP       + EN P+GS + R    DLDK    ++ +SI       S+     +D+ +G +T+  +FD E +  Y  +++++  D      +V V + I   ++  P F +  Y F +P   ++  G+ +G+V A D+D G +G V Y    Q+S    +F V+ + G + +   L +D      + +  RD         GR  S+SS   V I  LD   HP
Sbjct: 2808 VTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRY--DMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVY----QLSAPHSHFKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRDISLVISASSGRHNSLSSMAVVEIA-LDPLAHP 3079          

HSP 19 Score: 51.2174 bits (121), Expect = 6.693e-6
Identity = 60/231 (25.97%), Postives = 101/231 (43.72%), Query Frame = 1
Query: 1636 IDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSN------YGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFP--STDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTI 2301
            ID   G + T    DRET+  Y+     +   N      ++V++ + D NDN P F         PENT  +     + A D DL    T  Y  V+   N  F  +         Y ++++   LD +    + + I A D G P  +    TV IT+ D N++ P F +  +  T+  +  T+  ++    ++D D + EN  + Y + N +  + + +F+ID  TG I
Sbjct:  125 IDRATGEIRTKVKLDRETRASYSLVAIPLSGRN------IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTP-PLRGFMTVNITIQDVNDNQPIFNQSRYFATVP-ENATVGTSVLQVYASDTD-ADENGLVEYAI-NRRQSDKEQMFRIDPRTGAI 345          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh2ab3 (protocadherin 2 alpha b 3 [Source:ZFIN;Acc:ZDB-GENE-041118-3])

HSP 1 Score: 200.675 bits (509), Expect = 2.184e-52
Identity = 190/648 (29.32%), Postives = 304/648 (46.91%), Query Frame = 1
Query:  283 FAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKT-ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDP-IQCTLTAWDLNSSSSMR---LIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-PNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNC----SFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYS-------FSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNN-------HPPEFEKPFFALTL 2148
            F ++  TGFL     IDRE  C  +  C           T+    +I +   P ++Y+  I I D+NDNSPSF E +QTI+I E +  G    LH A D D    AI  Y +  +E+    S ++ R +        +L++ + +     P IQ TLTA D  + S      ++V+V DIND++P +    Y   + EN  + + I    ATD D   G  S  I  ++ RD  K     +F ID  TG + + GN+DFEE     + +   A D G P +S+    ++++ D NDN P I +   +  V+E+      +   +V D D   NG + C +      F L+ +  N    Y + +   LD E+ S   + I   D G P L+S   IAV+V DVNDN   FP+  I + + EN  IG+ +  +S +D D    + + +S++ SS      S +NI+++ G L + + F+ E    + F+VQ  +      +  V V + + D NDN P   A YS        +IP +     F+ ++RA+D D G N  +SY  +++      +   ++ GEIR    +  +    H + I+  D G P S+S++ ++   V++S         H P  E+ F  L L
Sbjct:   74 FEVNLKTGFLYVNERIDREEHCAKAPKC-----------TVSVEAVINN---PLKLYQIEINIVDVNDNSPSFSEKSQTIDIAENTLSGVRFPLHHATDADVGKNAINDYKLSSNEH---FSLAVHRGEGV----SAELVLQKALDREKKPAIQLTLTAVDGGTPSKTGTSIIMVRVLDINDNAPAFSKPLYKTSVFENAAIGTTIAVLNATDFDE--GSNSDIIYSLIKRDQNKVL--QMFDIDQNTGVIIVKGNIDFEE--NNAFEIRAQASDKGQPPMSTHCKVLVEVLDINDNEPEITVTSLLSTVKEDASIGTAVALVSVIDRDGGRNGVVNCAVSN-NVPFKLQTNYKNY---YSLVVDGPLDRERASEYNVTISAADEGSPPLSSTSVIAVHVSDVNDNAPRFPEPVINVYVKENSQIGAVLHTVSAVDPDVGDNARITYSLLESSKSGPVTSMININSDTGDLHSLQSFNYEEIKTFEFKVQATDSGVPPLSSNVTVNVFVLDENDNSPAILAPYSELGSVNTENIPYSAEAGYFVAKIRAVDADSGYNALLSY-HISEPKGNNLFRIGTSSGEIRTKRRMSDNDLKTHPLVILVCDNGEP-SLSATVSIDAVVVESGGDVKTPFRHAPVKEESFSDLNL 688          

HSP 2 Score: 113.62 bits (283), Expect = 5.031e-25
Identity = 96/348 (27.59%), Postives = 163/348 (46.84%), Query Frame = 1
Query: 1285 LEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSN---CSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFS-IPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNL--FPSTDKDKSPENTKMNY-LLDNIKPLEFKSLFKIDKLTGTI 2301
            L   E+F+L        ++ E+ L + LD EK+  I L +   DGG P+ T    I V V+D+NDN   F +   + S+ EN  IG+ I  ++  D D+   S++ +S++           +ID N G +      D E  + +    Q  +K     +   KV++ + DINDN+P        S + E+ S+   +  V  ID D G NG V+    N +   +      NY  + +   LD ++ + + VTI A D+G P  +SS++ + + V D N++ P F +P   + +   +Q I   L    + D D   +N ++ Y LL++ K     S+  I+  TG +
Sbjct:  171 LSSNEHFSLAVHRGE-GVSAELVLQKALDREKKPAIQLTLTAVDGGTPSKTGTSIIMVRVLDINDNAPAFSKPLYKTSVFENAAIGTTIAVLNATDFDEGSNSDIIYSLIKRDQNKVLQMFDIDQNTGVIIVKGNIDFEENNAFEIRAQASDKGQPPMSTHCKVLVEVLDINDNEPEITVTSLLSTVKEDASIGTAVALVSVIDRDGGRNGVVNCAVSNNVP-FKLQTNYKNYYSLVVDGPLDRERASEYNVTISAADEGSP-PLSSTSVIAVHVSDVNDNAPRFPEPVINVYVKENSQ-IGAVLHTVSAVDPDVG-DNARITYSLLESSKSGPVTSMININSDTGDL 513          

HSP 3 Score: 70.0922 bits (170), Expect = 1.265e-11
Identity = 80/288 (27.78%), Postives = 130/288 (45.14%), Query Frame = 1
Query: 1597 FSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQV-VEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSN----YGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTL---SCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIILE 2433
            F IV  +   +  ++   G+L  NE  DRE     A +  V VE    N     ++ + I D+NDN P F +   +  I ENT          A D D+G+N    Y      SN+ F   V        E+ L   LD +K+   Q+T+ A D G P S + ++ + + VLD N++ P F KP +  ++   +    TI   +  +TD D+   N+ + Y L      +   +F ID+ TG I   + + + +F+ NN    EI+    D  +P    ST  ++++E
Sbjct:   63 FQIVTGAKKKYFEVNLKTGFLYVNERIDREEHCAKAPKCTVSVEAVINNPLKLYQIEINIVDVNDNSPSFSEKSQTIDIAENTLSGVRFPLHHATDADVGKNAINDY---KLSSNEHFSLAVHRGEGVSAELVLQKALDREKKPAIQLTLTAVDGGTP-SKTGTSIIMVRVLDINDNAPAFSKPLYKTSVFENAAIGTTI--AVLNATDFDEG-SNSDIIYSLIKRDQNKVLQMFDIDQNTGVI---IVKGNIDFEENN--AFEIRAQASDKGQPPM--STHCKVLVE 336          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh2ab9 (protocadherin 2 alpha b 9 [Source:ZFIN;Acc:ZDB-GENE-041118-8])

HSP 1 Score: 194.126 bits (492), Expect = 2.485e-50
Identity = 184/628 (29.30%), Postives = 307/628 (48.89%), Query Frame = 1
Query:  283 FAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDK-QYKLNHQV--KLIVTRNISFRYDPIQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYL-DYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTI--DLDKKSEVAFSIV-----HSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF--------DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLD 2097
            F ++P+ G L+  R IDRE LC     C  +  K V+E             P E  Y  + I D+ND+SP+F E  + +EI+E + IGT  +L +A+D DS   ++  Y +  +E+ F+L     RD+ + KL   V  K +   N +  Y      LTA D  +   S ++ + V V D+ND+ P + +  Y   + EN+ L +++    A+D+D    G+VSYS G     +I      ++F++D ITG++++ G +DFE+     Y + I A D+G P L++    +I I D NDN P I +      V E++ P  L    +V D D   NG++ C + E    F LK S       + +     LD E  S   + I   D G+P L+S K ++V V DVNDN   F    + + + EN   G+ I+ +S    DL++ + +++ I+      S   SF+N+++  G +   + FD ET  ++ F +   +  + + +  V V + I D NDN PV          A     IP N +    + +VRA D D+G NG + +  + ++S    +      G+IR         +  H++ I+ +D G  +S+S++ TV + V++
Sbjct:   77 FVVNPNNGVLRVQRKIDREELCDGIGAC-LINLKIVVE------------NPLEIHYIAVEITDVNDHSPTFTEKEKRLEISENTLIGTRFQLQAARDPDSGVNSVRSYKLSQNEH-FDLE---IRDRAEDKLPFLVLQKPLDRENKAEHY----LILTAIDGGNPQRSGTLNITVIVLDVNDNRPMFSHDVYSSTVHENVQLGTLVLKVMASDSDYGPNGEVSYSFGGDNSDNI-----FHIFSLDRITGEIRVTGEVDFEK--NNVYKLDIQAVDSGQPPLNTDCRVIIKILDLNDNKPTIEVTSLSNVVSEDSKPGTLISLISVTDRDTGINGRVVCSLSEHVP-FELKPSVQE--NMFSLVTKGKLDRETLSHFDITITATDLGQPPLSSYKTLSVQVSDVNDNPPEFSLNPVELYMIENNAAGAPILTLSAFDKDLNENAIISYQIIKGNGSQSDLTSFLNVNSETGAVYALKSFDFETVKKFQFHILATDSGSPSLSSNVTVNVFILDQNDNVPVILYPVSANGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLF-SLQEVSEHSLFALDRYTGQIRTLRSFTETDEAQHKLVILVKDNGN-VSLSATATVIVKVVE 671          

HSP 2 Score: 90.5077 bits (223), Expect = 6.045e-18
Identity = 81/294 (27.55%), Postives = 136/294 (46.26%), Query Frame = 1
Query: 1285 LEWGEYFNLK---KSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNCSFVNI---DTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDA-HYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQI------SNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEF 2121
            L   E+F+L+   ++   +P    + L + LD E ++   LI+   DGG P  +    I V V+DVNDNR  F       ++ EN+ +G+ ++++   D D     EV++S    ++ +  +I   D   G +      D E  + Y  ++Q V+          +VI++I D+NDNKP  +    S  + E++     I  +   D D G NG V       +      S Q   F++   G+      LD +  +   +TI A D G+P  +SS  T+ + V D N++PPEF
Sbjct:  174 LSQNEHFDLEIRDRAEDKLPF---LVLQKPLDRENKAEHYLILTAIDGGNPQRSGTLNITVIVLDVNDNRPMFSHDVYSSTVHENVQLGTLVLKVMASDSDYGPNGEVSYSFGGDNSDNIFHIFSLDRITGEIRVTGEVDFEKNNVYKLDIQAVDSGQPPLNTDCRVIIKILDLNDNKPTIEVTSLSNVVSEDSKPGTLISLISVTDRDTGINGRVVCSLSEHVPFELKPSVQENMFSLVTKGK------LDRETLSHFDITITATDLGQP-PLSSYKTLSVQVSDVNDNPPEF 457          

HSP 3 Score: 65.4698 bits (158), Expect = 3.280e-10
Identity = 80/300 (26.67%), Postives = 136/300 (45.33%), Query Frame = 1
Query: 1507 IRISIPENIPIGSEIIRIS---TIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNV-NFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHM-----LDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTL--SCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKV 2370
            IR SIPE +  G  +  I+    +D+    +  F IV  S+ S   ++ NNG L      DRE   +      +  K  V N  +   + + I+D+ND+ P F +      I ENT +        A D D G N   SY +++Q  N+ F   + +  E +L  +     LD + +  H + + A D G P   S +  + + VLD N++ P F    ++ T+  + Q  T+   +  S D D  P N +++Y            +F +D++TG I +T    + +F+ NN  K++I+ 
Sbjct:   33 IRYSIPEEVKEGFVVGNIAKDLGLDVSSLMDRRFRIVSGSDDSQFVVNPNNGVLRVQRKIDREELCDGIGACLINLKIVVENPLEIHYIAVEITDVNDHSPTFTEKEKRLEISENTLIGTRFQLQAARDPDSGVNSVRSY-KLSQ--NEHFDLEIRDRAEDKLPFLVLQKPLDRENKAEHYLILTAIDGGNP-QRSGTLNITVIVLDVNDNRPMFSHDVYSSTVHENVQLGTLVLKVMAS-DSDYGP-NGEVSYSFGGDNSDNIFHIFSLDRITGEIRVT---GEVDFEKNNVYKLDIQA 323          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: si:dkeyp-115d7.2 (si:dkeyp-115d7.2 [Source:ZFIN;Acc:ZDB-GENE-141215-15])

HSP 1 Score: 190.274 bits (482), Expect = 1.534e-49
Identity = 188/674 (27.89%), Postives = 323/674 (47.92%), Query Frame = 1
Query:  217 INLNLTRGKNLKKYELIQ-HYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYK-TICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDP-IQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNL--FTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYL-DYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNC----SFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYS-------FSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNN-------HPPEFEKPFFALTL 2148
            +NLNL   ++ + ++++  +   F ++  TG  Q    +DRE +C         + KC LEL    +        P  +Y+  + + DINDNSP+FP  +  + ++E + +G    L +A D D    ++  Y +  +E+     FS+      + +   +L++ + +     P I+ TLTA D      S ++ +IVK+ D ND+ P +  S Y  RI EN  + + I T QA+DAD  + G++ YS        I     G +  F I+ ++G++ + G LD E     E  + + A+D G    ++    +I+I D NDN P I++   +  V E++P   +    TV D+D   NG +  +IL+    F L+ +  N    Y + +   LD E+ S   + I   D G P L+S   IAV+V DVNDN   FP+  I + + EN  IG+ +  +S +D D    + + +S++ SS      S +NI+++ G L + + F+ E    + F+VQ  +      +  V V + + D NDN P   A YS        +IP +     F+ ++RA+D D G N  +SY  +++      +   ++ GEIR    +  +    H + I+  D G P S+S++ ++   V++S         H P  E+ F  L L
Sbjct:   50 LNLNLQELEH-RGFQIVGPNKRYFDVNMKTGLFQIKDKLDREEICGQ-------RLKCALELEAIVNS-------PLNMYRFEVNVLDINDNSPTFPSSSLHLNVSEAAFVGERYALPNAFDADVGINSVKSYKLSANEH-----FSLDVQSGGEQSVSAELVLQKALDREKQPVIRLTLTAVDGGKPPRSGTVNIIVKIIDANDNIPVFTKSLYKARIPENAPVGASIITVQASDADEGLNGEIVYSF-------IKHINDGTIEYFAINEVSGEITVLGKLDHESNNAVE--IRVQARDKGPLPRAAHCKVLIEIMDVNDNIPEISVTSLVNVVNEDSPKGTMVGLVTVKDDDSGENGSVRLKILD-SLPFALQNTYKN---KYSLVVDGPLDRERASEYNVTISAADEGTPPLSSTSVIAVHVSDVNDNAPRFPEPVINVYVKENSQIGAVLHTVSAVDPDVGDNARITYSLLESSKSGPVTSMININSDTGDLHSLQSFNYEEIKTFEFKVQATDSGVPPLSSNVTVNVFVLDENDNSPAILAPYSELGSVNTENIPYSAEAGYFVAKIRAVDADSGYNALLSY-HISEPKGNNLFRIGTSSGEIRTKRRMSDNDLKTHPLVILVCDNGEP-SLSATVSIDAVVVESGGDVKTPFRHAPVKEESFSDLNL 688          

HSP 2 Score: 117.472 bits (293), Expect = 2.506e-26
Identity = 105/367 (28.61%), Postives = 174/367 (47.41%), Query Frame = 1
Query: 1237 VFDNDEDANGKIECEILEWGEYFNLK-KSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSN---CSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDG-FIGRVRAIDNDLGENGTVSYVQVNQISNQRFYF--TVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNL--FPSTDKDKSPENTKMNY-LLDNIKPLEFKSLFKIDKLTGTI 2301
             FD D   N  ++   L   E+F+L  +S     ++ E+ L + LD EKQ +I L +   DGGKP  +    I V +ID NDN   F +   +  IPEN P+G+ II +   D D+    E+ +S +   N     +  I+  +G +T     D E+ +     VQ  +K  +      KV++ I D+NDN P        ++    S  G  +G V   D+D GENG+   V++  + +  F    T  N   + +   LD ++ + + VTI A D+G P  +SS++ + + V D N++ P F +P   + +   +Q I   L    + D D   +N ++ Y LL++ K     S+  I+  TG +
Sbjct:  154 AFDADVGIN-SVKSYKLSANEHFSLDVQSGGEQSVSAELVLQKALDREKQPVIRLTLTAVDGGKPPRSGTVNIIVKIIDANDNIPVFTKSLYKARIPENAPVGASIITVQASDADEGLNGEIVYSFIKHINDGTIEYFAINEVSGEITVLGKLDHESNNAVEIRVQARDKGPLPRAAHCKVLIEIMDVNDNIPEISVTSLVNVVNEDSPKGTMVGLVTVKDDDSGENGS---VRLKILDSLPFALQNTYKNKYSLVVDGPLDRERASEYNVTISAADEGTP-PLSSTSVIAVHVSDVNDNAPRFPEPVINVYVKENSQ-IGAVLHTVSAVDPDVG-DNARITYSLLESSKSGPVTSMININSDTGDL 513          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh17 (protocadherin 17 [Source:ZFIN;Acc:ZDB-GENE-090608-3])

HSP 1 Score: 192.2 bits (487), Expect = 2.007e-49
Identity = 180/628 (28.66%), Postives = 291/628 (46.34%), Query Frame = 1
Query:  277 NIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTIC-----IEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSE-NIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGT---PSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPE-NIP---IGSEIIRISTIDLDKKSEVAFSIVHS-----SNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF------DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFI 2085
            ++  + P +G L T + IDRE LC  ++       KC L + +FA+D            K IC     I+DINDN+PSFP     I+I+E +  GT   L +A D D+ +  +  Y +   + +IF+L      D        V+  + R     +  I       +   S +M++ VKV D ND+SP +    Y + I EN  L ++I    ATD+D  + G+V+YS    +   I +     LF+ID  TG +K+ G +DFEE    E  + + AKD G    P     T  V+D  D   +   + + +G +  E  TP   +    V D D   NG+++C IL     F L+++  N    Y +   + LD E +    + I  +D G P L S K   V ++D NDN   F +    + +PE NIP   +GS  +     DL +   V++S++ S     S  ++VNI   +G +     F+ E    + F+VQ  +  N +      V + + D+NDN PV       +      +P N  V   I  VRA+DND GE+G ++Y +++  + +  +   S  GE+R    L  +   + ++ I   D G+P S+S+   + +
Sbjct:   63 HLIDVDPESGLLYTKQRIDRETLCRQNS-------KCQLSMEVFAND------------KEICMIKVEIQDINDNAPSFPSEQIDIDISENAAPGTRFPLAAAYDPDTKENGLKTYQITRDDYSIFSLDVKSRGDGTKFPELVVQRSLDREERSHHTLIITATDGGEYPKSGTMQINVKVTDSNDNSPVFEQPSYVVEIPENAPLGTVIIDLNATDSDEGINGQVTYSFSCYVPDRIKE-----LFSIDPRTGVIKIQGKIDFEENPIIE--IDVQAKDQGPNPIPGHCKVTVKVLDRNDNWPSIGFVAVRQGAVS-EAATPGTVIALVRVTDKDSGRNGQLQCRIL-GNVPFKLEENYDNF---YTVVTDRPLDREVKDEYNITIVAKDNGNPPLNSTKSFTVKILDENDNAPRFTKMVYLLQVPENNIPGEYLGS--VLAHDPDLGQNGTVSYSLLPSNVSEESITTYVNIKPTDGAIYALRSFNYEQTKYFDFKVQAKDSGNPHLESNTTVRVSVLDVNDNIPVIVLPLLQNDTAEIHVPRNVGVGHIITTVRAVDNDFGESGRLTY-EISDGNEEHLFEIDSVTGEVRTAQPLWEEVTPVVELIIKVTDHGKP-SLSAMAKLIV 655          

HSP 2 Score: 107.071 bits (266), Expect = 6.045e-23
Identity = 132/470 (28.09%), Postives = 205/470 (43.62%), Query Frame = 1
Query:  790 VKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVY-GKVSYSIGR----IMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDY-FTVFDNDEDANGKI----ECEILEW-GEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIR-ISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSF-VNIDTNNGY-LTTNEMFDRETKDEYAFEVQVVEKDNVN--FTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNY----GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFF 2136
            V++ DIND++P +P+ +  I I EN    +      A D DT   G  +Y I R    I   D+     G  F       ++ +  +LD EER     I+T  A D G    S      + + D NDN P+      ++++ EN P   +       D+DE  NG++     C + +   E F++   T  I I  +I      D+E+  +I + +Q +D G   +    ++ V V+D NDN        +R  ++ E    G+ I  +   D D             N  F +  + +N Y + T+   DRE KDEY   + +V KDN N     T    ++I D NDN P F    Y   +PEN     ++G V A D DLG+NGTVSY  +    ++    T  N     G I      + ++       + A+D G P  + S+TTV ++VLD N++ P    P  
Sbjct:  110 VEIQDINDNAPSFPSEQIDIDISENAAPGTRFPLAAAYDPDTKENGLKTYQITRDDYSIFSLDVKSRGDGTKFP------ELVVQRSLDREERSHHTLIIT--ATDGGEYPKSGTMQINVKVTDSNDNSPVFEQPSYVVEIPENAPLGTVIIDLNATDSDEGINGQVTYSFSCYVPDRIKELFSIDPRTGVIKIQGKI------DFEENPIIEIDVQAKDQGPNPIPGHCKVTVKVLDRNDNWPSIGFVAVRQGAVSEAATPGTVIALVRVTDKDSGRNGQLQCRILGNVPFKLEENYDNFYTVVTDRPLDREVKDEY--NITIVAKDNGNPPLNSTKSFTVKILDENDNAPRFTKMVYLLQVPENNIPGEYLGSVLAHDPDLGQNGTVSYSLLPSNVSEESITTYVNIKPTDGAIYALRSFNYEQTKYFDFKVQAKDSGNP-HLESNTTVRVSVLDVNDNIPVIVLPLL 562          

HSP 3 Score: 95.1301 bits (235), Expect = 3.100e-19
Identity = 78/279 (27.96%), Postives = 128/279 (45.88%), Query Frame = 1
Query: 1345 EIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNC-------SFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPV--FDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYF--TVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTL 2148
            E+ + + LD E++S   LII   DGG+   +   +I V V D NDN   F Q +  + IPEN P+G+ II ++  D D+   +   + +S +C          +ID   G +      D E       +VQ  ++         KV +++ D NDN P   F A    ++ E  +    I  VR  D D G NG    +Q   + N  F       N+  +     LD + ++ + +TIVA+D G P  ++S+ +  + +LD N++ P F K  + L +
Sbjct:  184 ELVVQRSLDREERSHHTLIITATDGGEYPKSGTMQINVKVTDSNDNSPVFEQPSYVVEIPENAPLGTVIIDLNATDSDEG--INGQVTYSFSCYVPDRIKELFSIDPRTGVIKIQGKIDFEENPIIEIDVQAKDQGPNPIPGHCKVTVKVLDRNDNWPSIGFVAVRQGAVSEAATPGTVIALVRVTDKDSGRNGQ---LQCRILGNVPFKLEENYDNFYTVVTDRPLDREVKDEYNITIVAKDNGNP-PLNSTKSFTVKILDENDNAPRFTKMVYLLQV 456          

HSP 4 Score: 75.8702 bits (185), Expect = 2.220e-13
Identity = 78/286 (27.27%), Postives = 128/286 (44.76%), Query Frame = 1
Query: 1501 KTIRISIPENIPIG--SEIIRISTIDLDKKSEVA-FSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDA-HYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYG------EIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTL----SCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVK 2316
            K +  SIPE    G    I + + ++L ++ + + F ++ +S    +++D  +G L T +  DRET      + Q+  +   N  +   + + I DINDN P F +      I EN +         A D D  ENG  +Y Q+ +     F   V + G      E+ +   LD ++++ H + I A D G     S +  + + V DSN++ P FE+P + + +       T  ID N   +TD D+   N ++ Y      P   K LF ID  TG I +  K
Sbjct:   19 KNLNYSIPEEKIQGVIGNIAKDAELELGEQGKKSNFRVLENSAPHLIDVDPESGLLYTKQRIDRETLCRQNSKCQLSMEVFANDKEICMIKVEIQDINDNAPSFPSEQIDIDISENAAPGTRFPLAAAYDPDTKENGLKTY-QITRDDYSIFSLDVKSRGDGTKFPELVVQRSLDREERSHHTLIITATDGGE-YPKSGTMQINVKVTDSNDNSPVFEQPSYVVEIPENAPLGTVIIDLN---ATDSDEG-INGQVTYSFSCYVPDRIKELFSIDPRTGVIKIQGK 298          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh2ab5 (protocadherin 2 alpha b 5 [Source:ZFIN;Acc:ZDB-GENE-041118-4])

HSP 1 Score: 187.963 bits (476), Expect = 2.554e-48
Identity = 180/649 (27.73%), Postives = 308/649 (47.46%), Query Frame = 1
Query:  283 FAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKT-ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDP-IQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-PNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNC----SFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYS-------FSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNN-------HPPEFEKPFFALTL 2148
            F ++  TGFL     IDRE LC  +  C           T+    +I +   P ++Y+  I I D+NDN P+F   TQ +++ E +  G +  L  A D D     +  Y  K S+N +   FS+   K  + +   +L++ + +     P +Q TLTA D  +   S + ++I++V DIND++P +    Y   + EN+ + S +    ATD D      + YS+     R+  +    ++F ID+ITG + + G+++FE+     + +   A D G P +S+    ++++ D NDN P I +   +  V+E+      +   +V D D   NG + C +      F L+ +  N    Y + +   LD E+ S   + I   D G P L+S   IAV+V DVNDN   FP+  I + + EN  IG+ +  +S +D D    + + +S++ SS      S +NI+++ G L + + F+ E    + F+VQ  +      +  V V + + D NDN P   A YS        +IP +     F+ ++RA+D D G N  +SY  +++      +   ++ GEIR    +  +    H + I+  D G P S+S++ ++   V++S         H P  E+ F  L L
Sbjct:   74 FEVNLKTGFLYVNERIDREELCAKAPKC-----------TVSVEAVINN---PLKLYQIEINIVDVNDNKPTFNSKTQYLDVAENTLPGVKFPLSYASDADVGKNTVSTY--KLSQNEY---FSLAVHKGEEQSVSAELVLQKALDREKQPLVQLTLTAADGGNPPKSGTSQIIIRVLDINDNAPVFSRPLYKASLVENVPIGSTVIIINATDKDEGTNSDIIYSL-----RETDQDHILDIFQIDAITGAITVKGDVNFEK--NNAFEIRAQASDKGQPPMSTHCKVLVEVLDINDNEPEITVTSLLSTVKEDASIGTAVALVSVIDRDGGRNGVVNCAVSN-NVPFKLQTNYKNY---YSLVVDGPLDRERASEYNVTISAADEGSPPLSSTSVIAVHVSDVNDNAPRFPEPVINVYVKENSQIGAVLHTVSAVDPDVGDNARITYSLLESSKSGPVTSMININSDTGDLHSLQSFNYEEIKTFEFKVQATDSGVPPLSSNVTVNVFVLDENDNSPAILAPYSELGSVNTENIPYSAEAGYFVAKIRAVDADSGYNALLSY-HISEPKGNNLFRIGTSSGEIRTKRRMSDNDLKTHPLVILVCDNGEP-SLSATVSIDAVVVESGGDVKTPFRHAPVKEESFSDLNL 690          

HSP 2 Score: 119.783 bits (299), Expect = 6.355e-27
Identity = 106/381 (27.82%), Postives = 180/381 (47.24%), Query Frame = 1
Query: 1195 VEENTPPNYLDYFTVFDNDEDANGK--IECEILEWGEYFNLKKSTAN-IPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSN---CSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFS-IPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNL--FPSTDKDKSPENTKMNY-LLDNIKPLEFKSLFKIDKLTGTI 2301
            V ENT P  + +   + +D D  GK  +    L   EYF+L         ++ E+ L + LD EKQ ++ L +   DGG P  +   +I + V+D+NDN   F +   + S+ EN+PIGS +I I+  D D+   S++ +S+  +          ID   G +T     + E  + +    Q  +K     +   KV++ + DINDN+P        S + E+ S+   +  V  ID D G NG V+    N +   +      NY  + +   LD ++ + + VTI A D+G P  +SS++ + + V D N++ P F +P   + +   +Q I   L    + D D   +N ++ Y LL++ K     S+  I+  TG +
Sbjct:  141 VAENTLPG-VKFPLSYASDADV-GKNTVSTYKLSQNEYFSLAVHKGEEQSVSAELVLQKALDREKQPLVQLTLTAADGGNPPKSGTSQIIIRVLDINDNAPVFSRPLYKASLVENVPIGSTVIIINATDKDEGTNSDIIYSLRETDQDHILDIFQIDAITGAITVKGDVNFEKNNAFEIRAQASDKGQPPMSTHCKVLVEVLDINDNEPEITVTSLLSTVKEDASIGTAVALVSVIDRDGGRNGVVNCAVSNNVP-FKLQTNYKNYYSLVVDGPLDRERASEYNVTISAADEGSP-PLSSTSVIAVHVSDVNDNAPRFPEPVINVYVKENSQ-IGAVLHTVSAVDPDVG-DNARITYSLLESSKSGPVTSMININSDTGDL 515          

HSP 3 Score: 87.4261 bits (215), Expect = 6.027e-17
Identity = 90/289 (31.14%), Postives = 140/289 (48.44%), Query Frame = 1
Query: 1597 FSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQV-VEKDNVNFTDTVKVILRISDINDNKPVFDAHYSF-SIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTV------SNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKN--LFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIILE 2433
            F IV  +   +  ++   G+L  NE  DRE     A +  V VE    N     ++ + I D+NDNKP F++   +  + ENT          A D D+G+N TVS  +++Q  N+ F   V      S   E+ L   LD +KQ + Q+T+ A D G P   S ++ + I VLD N++ P F +P +  +L  +   I     +  +TDKD+   N+ + Y L          +F+ID +TG  A+TVK  D NF+ NN    EI+    D  +P    ST  ++++E
Sbjct:   63 FQIVTGAKKKYFEVNLKTGFLYVNERIDREELCAKAPKCTVSVEAVINNPLKLYQIEINIVDVNDNKPTFNSKTQYLDVAENTLPGVKFPLSYASDADVGKN-TVSTYKLSQ--NEYFSLAVHKGEEQSVSAELVLQKALDREKQPLVQLTLTAADGGNP-PKSGTSQIIIRVLDINDNAPVFSRPLYKASL-VENVPIGSTVIIINATDKDEG-TNSDIIYSLRETDQDHILDIFQIDAITG--AITVK-GDVNFEKNN--AFEIRAQASDKGQPPM--STHCKVLVE 338          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: vat1l (vesicle amine transport 1-like [Source:Xenbase;Acc:XB-GENE-952539])

HSP 1 Score: 191.045 bits (484), Expect = 1.403e-49
Identity = 183/626 (29.23%), Postives = 296/626 (47.28%), Query Frame = 1
Query:  268 QHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQV--------KLIVTRNISF-RYDPIQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENT-PPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRI--STIDLDKKSEVAFSIVHSSN-----CSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVN--FTDTVKVILRISDINDNKP-------VFDAHYSFSI-PENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRP 2052
            +H+  F ++   G L     IDRE++C  +  C  L+ K V+E  ++              +  + I+DINDNSPSF       EI E +P GT   L +AQD D+    +  Y  K SEN F           +KLN +         +L++ + +   +   ++  LTA D  +   + +  + + + D+ND++P +    Y + + EN  +D+++    ATDAD  V G + YS   I         +   FTIDS TG+++  G LDFE  + + Y + + A+D G   L S T  VI + D NDN P I +      + E++ P   +    + D D   NG + C+I +    F L  S++N    Y +  +  LD E+     + I+  D G   L++ K I + ++DVNDN   F Q +  + IPEN P GS I ++  S  DLD  +++ +S VH +       S++++++  G L     FD E   E  F +Q++ KDN +     TV V + ++D NDN P       V +    F I P + +    I +V A+D D G N  +SY Q  Q S   ++    + GEIR   +    +   H+V ++ +D G P
Sbjct:   75 EHF--FHVNLENGNLYVADRIDRESVCEMAPIC-LLRLKAVVENPLYV------------FHVEVEIQDINDNSPSFSRKNMNFEILENTPTGTRFVLGNAQDPDTGINTLQTY--KISENEF-----------FKLNEKTSTDGRKYPELVLEKPLDREKQSALEIILTALDGGTPIKTGTAIIKISITDVNDNTPMFSKEVYPVNLPENAPVDTLVICLNATDADEGVNGHILYSFSHI------SKIAQQTFTIDSHTGEIRTKGTLDFE--ITKAYEMIVEAQDGG--GLFSHTKVVIQVLDTNDNAPEIILTSVSNSIPEDSLPGTVVALIDIQDMDSGENGNVYCQITD-SLPFALTSSSSNY---YTLVTTGTLDREEMPEYNITIKATDRGSLPLSTTKTIRLVILDVNDNAPIFEQPSYVVYIPENNPSGSSIFQVQASDPDLDNNAKIVYSTVHKNASDVPVSSYISLNSITGVLYAQRPFDYEQMRE--FTIQIMAKDNGSPPLNSTVIVKICVTDRNDNSPKILYPSSVVEDSAQFEIVPRSANKGELIAKVVAVDADSGHNAWLSY-QFLQPSEPSYFSIGRHTGEIRTLRVFQEKETTKHKVIVLVKDNGNP 655          

HSP 2 Score: 116.701 bits (291), Expect = 7.045e-26
Identity = 86/288 (29.86%), Postives = 146/288 (50.69%), Query Frame = 1
Query: 1297 EYFNLKKSTANIPITY-EIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCS--FVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKP-VFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFAL 2142
            E+F L + T+     Y E+ L + LD EKQS + +I+   DGG P  T    I +++ DVNDN   F ++   +++PEN P+ + +I ++  D D+     + +S  H S  +     ID++ G + T    D E     A+E+ V  +D        KV++++ D NDN P +     S SIPE++     +  +   D D GENG V Y Q+          + SNY  +     LD ++   + +TI A D+G  + +S++ T+ + +LD N++ P FE+P + +
Sbjct:  179 EFFKLNEKTSTDGRKYPELVLEKPLDREKQSALEIILTALDGGTPIKTGTAIIKISITDVNDNTPMFSKEVYPVNLPENAPVDTLVICLNATDADEGVNGHILYSFSHISKIAQQTFTIDSHTGEIRTKGTLDFEITK--AYEMIVEAQDGGGLFSHTKVVIQVLDTNDNAPEIILTSVSNSIPEDSLPGTVVALIDIQDMDSGENGNV-YCQITDSLPFALTSSSSNYYTLVTTGTLDREEMPEYNITIKATDRGS-LPLSTTKTIRLVILDVNDNAPIFEQPSYVV 462          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: cdkn2aipnl (CDKN2A interacting protein N-terminal like [Source:Xenbase;Acc:XB-GENE-1003699])

HSP 1 Score: 187.193 bits (474), Expect = 2.779e-48
Identity = 193/626 (30.83%), Postives = 298/626 (47.60%), Query Frame = 1
Query:  283 FAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEK-SPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-PNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVH-----SSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-------DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDS 2100
            FA++P  G L     IDRE LC +S        +CVL L I   +      P E     I I DINDNSP F    Q I+I+E  +  GT+  L +AQD D S   + KY +  +   F+LS +  +D +      ++ I+ R     +   + T+TA+D  +   S + ++ V V D ND++P + +S Y I + EN   +++I    ATD D  + G++ YS G   +  + +     LFT++  +G++ +NG +DFEE  +  Y +++ AKD G P   S    +I+IED NDN P I +   +  V EN      + + +V D D   NG++  EI       NLK         Y I    +LD EK +   L +   D G P L +   I +N+ DVNDN   F Q  +   I EN   GS +  +S +DLD    S + +SIV      SS  S VNI++  G +     FD E        V+V +  +   +  + V + I D NDN P+        +      IP +      + +V A+D D G N  +SY  V+      F  + S +GEI+    L    Q   ++ IV +D G P ++S++ T++IT+ D+
Sbjct:   74 FALNPRNGDLTVNEKIDRETLCGSST-------RCVLPLEIIIEN------PLELFSLEIEIVDINDNSPVFLRNDQLIKISEALANPGTQFPLETAQDPDISTNGVSKYTLTPNP-YFSLSVNSRKDGKLVPELVIEKILDREEKEYH---KLTITAFDGGNPPRSGTSQITVIVLDSNDNAPVFDHSTYKIVLPENTPQNTVILKLNATDRDEGLNGEIEYSFGYHTLDSMKE-----LFTLNKQSGEISVNGVIDFEE--ENFYEISVRAKDKGNPEHESRCIVLIEIEDVNDNVPEITLTSLLNAVPENAALGTAVGFLSVRDKDSGKNGEVSVEISP-----NLKFKIKPFNNRYTIVTDGVLDREKIAQYVLELTATDLGSPPLRTTMSIILNISDVNDNPPAFSQPHLNSFIIENNDPGSFLCTVSAVDLDDGLNSVLTYSIVERKTDASSILSLVNINSKTGNIYAQGSFDYEQIQVLQITVKVEDAGSPKLSSNITVFIFILDQNDNAPLMLYPEHSREISPQQKIPTSAPAGFLVTKVSAVDLDSGHNAWLSYHIVDGTDPSLFQISAS-HGEIQTARGLQETDQIDQRLIIVVKDHGEP-ALSTTVTIYITLEDT 668          

HSP 2 Score: 124.02 bits (310), Expect = 3.794e-28
Identity = 135/477 (28.30%), Postives = 217/477 (45.49%), Query Frame = 1
Query:  784 LIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQ-ATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITG--DMKLNGNLDFEERLQRE----YIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDY-FTVFDNDEDANGKIECE-----ILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGY-LTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNY----GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQ 2157
            L +++ DIND+SP +  +   I+I E L         + A D D     VS             T + N +   S+    D KL   L  E+ L RE    + +TI A D G P  S  +   + + D NDN P+ + +   I + ENTP N +       D DE  NG+IE       +    E F L K +       EI ++ ++D+E+++   + ++ +D G P   S+  + + + DVNDN       ++  ++PEN  +G+ +  +S  D D       S+  S N  F     NN Y + T+ + DRE   +Y  E+   +  +     T+ +IL ISD+NDN P F   H +  I EN     F+  V A+D D G N  ++Y  V + ++     ++ N     G I      D ++  + Q+T+   D G P  +SS+ TVFI +LD N++ P    P  +  +S Q
Sbjct:  118 LEIEIVDINDNSPVFLRNDQLIKISEALANPGTQFPLETAQDPDISTNGVSK-----------YTLTPNPYFSLSVNSRKDGKLVPELVIEKILDREEKEYHKLTITAFDGGNPPRSGTSQITVIVLDSNDNAPVFDHSTYKIVLPENTPQNTVILKLNATDRDEGLNGEIEYSFGYHTLDSMKELFTLNKQSG------EISVNGVIDFEEENFYEISVRAKDKGNPEHESRCIVLIEIEDVNDNVPEITLTSLLNAVPENAALGTAVGFLSVRDKDSGKNGEVSVEISPNLKFKIKPFNNRYTIVTDGVLDREKIAQYVLELTATDLGSPPLRTTMSIILNISDVNDNPPAFSQPHLNSFIIENNDPGSFLCTVSAVDLDDGLNSVLTYSIVERKTDASSILSLVNINSKTGNIYAQGSFDYEQIQVLQITVKVEDAGSP-KLSSNITVFIFILDQNDNAPLMLYPEHSREISPQ 576          

HSP 3 Score: 56.225 bits (134), Expect = 3.441e-7
Identity = 66/246 (26.83%), Postives = 112/246 (45.53%), Query Frame = 1
Query: 1615 SNCSFVNIDTNNGYLTTNEMFDRET----KDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSF-SIPENTSVDGFIGRVR-AIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLF------HMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTL---SCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAM 2307
             N  +  ++  NG LT NE  DRET           ++++ +   N  +   + + I DINDN PVF  +     I E  +  G    +  A D D+  NG   Y       N  F  +V++  + +L        +LD +++  H++TI A D G P   S ++ + + VLDSN++ P F+   + + L   + Q   I K    +TD+D+   N ++ Y          K LF ++K +G I++
Sbjct:   69 GNVKYFALNPRNGDLTVNEKIDRETLCGSSTRCVLPLEIIIE---NPLELFSLEIEIVDINDNSPVFLRNDQLIKISEALANPGTQFPLETAQDPDISTNGVSKYTLT---PNPYFSLSVNSRKDGKLVPELVIEKILDREEKEYHKLTITAFDGGNP-PRSGTSQITVIVLDSNDNAPVFDHSTYKIVLPENTPQNTVILK--LNATDRDEG-LNGEIEYSFGYHTLDSMKELFTLNKQSGEISV 304          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: ENSXETT00000039438.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:18370669:18374036:1 gene:ENSXETG00000012646.1 transcript:ENSXETT00000039438.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 185.267 bits (469), Expect = 1.862e-47
Identity = 186/661 (28.14%), Postives = 311/661 (47.05%), Query Frame = 1
Query:  217 INLNLTRGKNLKKYELIQHYN--IFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDP-IQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHS-----SNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRIS--DINDNKP--------VFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSY--VQVNQISNQRFYFTVSNY-GEI---RLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNH 2109
            + LN+    N +K  ++ H +   F+I+   G L     IDREALC     C  LK   V+E             P    +  + I+DINDN P F   T   EI+E +  G +  L +A+D D    +I+ Y +       N  F +   K        +LI+  ++       ++  LTA D  +   + +  + + V D ND+ P +    Y + I EN+ ++S +    A+D D  +  +++YS        +       LFT++   G++K  GN+DFEE  ++ Y +++ AKD+G   +++    +  I++ ++ P I   +      E++ P   +      D D   NG++ CEI+  G  F L  S+ N    Y+I  +  LD E+ S   + IQ  D G P L+  K I ++V+D+NDN+  F + T     PEN   G+ I  I  ID D +   ++ +SI+ S     S+ S+++I+   G +     FD E   E  FE+Q++ KD+ +       I+RI   D NDN P        V  A Y   +P ++     + +V A+D D G N  +SY  +Q ++ S    +F +  Y GEI   R+F   DI +   H+V ++ +D G P S+S++ T+ + V D+  H
Sbjct:   57 LGLNVKEIAN-RKLRIVSHLSEKYFSINLGNGNLNVADRIDREALCGTRGEC-FLKFDTVIE------------NPLNIFHVRVDIKDINDNLPRFIPETNEFEISESTSSGAKFTLQNAEDLDVGMNSIVTYKLSA-----NKHFVLGEKKSTNGRTFPELILQTSLDRETQSNLELILTASDGGNPVQTGTTLIKITVTDFNDNVPVFTQEVYKVNIHENIPINSSVLQVNASDKDEGINAQITYSFSTAATNVL------RLFTVNPDNGEIKTIGNVDFEE--EKYYDISVQAKDSGG-LVANAKVLIEIIDENDNAPEISVTSISTPISEDSAPGTVVALIKAHDLDSGENGEVNCEIIGVGP-FKLMSSSGNF---YKIVTTSTLDRERSSHYNITIQATDKGSPPLSFSKTIRLDVLDINDNQPVFERSTFMAYAPENNQPGASIYSIQAIDKDTEENGKLFYSIITSNTEEISSTSYISINPVTGVIYAQRSFDYEQDRE--FEIQIMAKDSGSPPLNSSAIVRICVVDQNDNSPTVLYPSPDVGSAAYEM-VPFSSEQGTLVTKVVAVDADSGHNAWLSYHFLQDSETS----HFIIDQYTGEIRTSRVFQERDILR---HKVVVIVKDNGTP-SLSATVTLTLVVADNFQH 674          

HSP 2 Score: 116.316 bits (290), Expect = 9.589e-26
Identity = 104/374 (27.81%), Postives = 180/374 (48.13%), Query Frame = 1
Query: 1345 EIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDK----KSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKP-VFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFP--STDKDKSPENTKMNY--LLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIILENE 2439
            E+ L   LD E QS + LI+   DGG P  T    I + V D NDN   F Q+  +++I ENIPI S +++++  D D+    +   +FS   ++      ++ +NG + T    D E +  Y   VQ   KD+       KV++ I D NDN P +     S  I E+++    +  ++A D D GENG V+  ++  +   +   +  N+ +I     LD ++ + + +TI A D+G P  +S S T+ + VLD N++ P FE+  F +  + +      +++   + DKD + EN K+ Y  +  N + +   S   I+ +TG I         +F      + EI++   D   P    S I++I + ++
Sbjct:  198 ELILQTSLDRETQSNLELILTASDGGNPVQTGTTLIKITVTDFNDNVPVFTQEVYKVNIHENIPINSSVLQVNASDKDEGINAQITYSFSTAATNVLRLFTVNPDNGEIKTIGNVDFEEEKYYDISVQA--KDSGGLVANAKVLIEIIDENDNAPEISVTSISTPISEDSAPGTVVALIKAHDLDSGENGEVN-CEIIGVGPFKLMSSSGNFYKIVTTSTLDRERSSHYNITIQATDKGSP-PLSFSKTIRLDVLDINDNQPVFERSTF-MAYAPENNQPGASIYSIQAIDKD-TEENGKLFYSIITSNTEEISSTSYISINPVTGVIYA-----QRSFDYEQDREFEIQIMAKDSGSPPLNSSAIVRICVVDQ 560          

HSP 3 Score: 86.2705 bits (212), Expect = 1.874e-16
Identity = 124/460 (26.96%), Postives = 199/460 (43.26%), Query Frame = 1
Query:  790 VKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGK-VSY--SIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNY-LDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDN--VNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVN----QISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKP 2130
            V + DIND+ P +        I E+    +      A D D      V+Y  S  +  V    K+ +G  F       ++ L  +LD E +   E I+T  A D G P  +  T   I + DFNDN P+       +++ EN P N  +      D DE  N +I            L+  T N P   EI     +D+E++    + +Q +D G   L +  ++ + +ID NDN       +I   I E+   G+ +  I   DLD  +  EV   I+       ++   N   + T    DRE    Y   +Q  +K +  ++F+ T++  L + DINDN+PVF+ + +    PEN      I  ++AID D  ENG + Y  +     +IS+  +       G I      D ++    ++ I+A+D G P  ++SS  V I V+D N++ P    P
Sbjct:  126 VDIKDINDNLPRFIPETNEFEISESTSSGAKFTLQNAEDLDVGMNSIVTYKLSANKHFVLGEKKSTNGRTFP------ELILQTSLDRETQSNLELILT--ASDGGNPVQTGTTLIKITVTDFNDNVPVFTQEVYKVNIHENIPINSSVLQVNASDKDEGINAQITYSFSTAATNV-LRLFTVN-PDNGEIKTIGNVDFEEEKYYDISVQAKDSG--GLVANAKVLIEIIDENDNAPEISVTSISTPISEDSAPGTVVALIKAHDLDSGENGEVNCEIIGVGPFKLMSSSGNFYKIVTTSTLDRERSSHYNITIQATDKGSPPLSFSKTIR--LDVLDINDNQPVFERSTFMAYAPENNQPGASIYSIQAIDKDTEENGKLFYSIITSNTEEISSTSYISINPVTGVIYAQRSFDYEQDREFEIQIMAKDSGSP-PLNSSAIVRICVVDQNDNSPTVLYP 570          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: abhd8 (Xenopus tropicalis protocadherin gamma subfamily A, 3 (pcdhga3), mRNA. [Source:RefSeq mRNA;Acc:NM_001170512])

HSP 1 Score: 185.267 bits (469), Expect = 2.438e-47
Identity = 192/634 (30.28%), Postives = 294/634 (46.37%), Query Frame = 1
Query:  283 FAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEK-SPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPI-QCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-PNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPIT-------YEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVH-----SSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-------DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDS 2100
            FA++   G L     IDRE LC +S        +CVL L I   +      P E     I I DINDNSP F    Q I+I+E  +  GT   L SAQD D S   + KY +       N  FS+  D +       +LI+ +N+        + T+TA+D  +   S + ++ V V D ND++P + +SKY + ++EN   +++I    ATD D  + G++ Y  G   +  +       LFT++  +G++ +NG +DFEE+    Y +++ AKD G P L S    +I+IED NDN P I +   +  V EN      + + +V D D   NG++  EI            + N+P         Y I    +LD EK +   L +   D G P L +   + +N+ DVNDN   F Q  +   I EN   GS +  +S +D D    S + +SI       SS  S VNI++  G +     FD E        V+V +  +   +  + V L I D NDN P+        +      IP +      + +V A+D D G N  +SY  V+      F  + S +GEIR    L    Q   ++ IV +D G P ++S++ T++IT+ D+
Sbjct:   74 FALNHRNGDLTVNEKIDRETLCGSST-------RCVLPLEIIIEN------PLELFSLEIEIVDINDNSPLFLSSDQLIKISEALANPGTRFRLESAQDLDISTNGVSKYTLTP-----NPYFSLSVDTRKDGTLVPELILEKNLDREEKEYHKFTITAFDGGNPPRSGTSQITVIVLDSNDNAPVFDHSKYKVVVQENAPQNTVILKLNATDQDAGLNGEIEYFFGYHTLDSMKA-----LFTLNPQSGEISVNGVIDFEEK--EFYEISVRAKDKGNPELESHCLVLIEIEDVNDNVPEITLTSLLNAVPENAALGTAVGFLSVRDKDSGKNGEVSVEI------------SPNLPFKIKPFNNRYTIVTDGVLDREKVAQYVLDLIATDLGSPPLRTTMSVILNISDVNDNPPAFSQPHLNAFIMENNDPGSFLCTVSAVDPDDGLNSVLTYSIFERKTDASSILSLVNINSKTGNIYAQGSFDYEQIQVLQITVKVEDSGSPKLSSNITVFLFILDQNDNAPLMLYPEHSREVSPQQKIPTSAPAGFLVTKVSAVDLDSGHNAWLSYHIVDGTDPSLFQVSAS-HGEIRTARGLQETDQIDQRLVIVVKDHGEP-ALSTTVTIYITLEDT 668          

HSP 2 Score: 122.094 bits (305), Expect = 1.606e-27
Identity = 129/472 (27.33%), Postives = 220/472 (46.61%), Query Frame = 1
Query:  784 LIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQ-ATDADTVYGKVS-YSIGRIMVRDIPKTFSGNLFTIDS-----ITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDY-FTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGY-LTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNY----GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQ 2157
            L +++ DIND+SP + +S   I+I E L         + A D D     VS Y++        P  +     ++D+     +  ++ L  NLD EE+   ++  TI A D G P  S  +   + + D NDN P+ + ++  + V+EN P N +       D D   NG+IE     +    ++K      P + EI ++ ++D+E++    + ++ +D G P L S   + + + DVNDN       ++  ++PEN  +G+ +  +S  D D       S+  S N  F     NN Y + T+ + DRE   +Y  ++   +  +     T+ VIL ISD+NDN P F   H +  I EN     F+  V A+D D G N  ++Y    + ++     ++ N     G I      D ++  + Q+T+   D G P  +SS+ TVF+ +LD N++ P    P  +  +S Q
Sbjct:  118 LEIEIVDINDNSPLFLSSDQLIKISEALANPGTRFRLESAQDLDISTNGVSKYTL-------TPNPYFS--LSVDTRKDGTLVPELILEKNLDREEKEYHKF--TITAFDGGNPPRSGTSQITVIVLDSNDNAPVFDHSKYKVVVQENAPQNTVILKLNATDQDAGLNGEIEY-FFGYHTLDSMKALFTLNPQSGEISVNGVIDFEEKEFYEISVRAKDKGNPELESHCLVLIEIEDVNDNVPEITLTSLLNAVPENAALGTAVGFLSVRDKDSGKNGEVSVEISPNLPFKIKPFNNRYTIVTDGVLDREKVAQYVLDLIATDLGSPPLRTTMSVILNISDVNDNPPAFSQPHLNAFIMENNDPGSFLCTVSAVDPDDGLNSVLTYSIFERKTDASSILSLVNINSKTGNIYAQGSFDYEQIQVLQITVKVEDSGSP-KLSSNITVFLFILDQNDNAPLMLYPEHSREVSPQ 576          

HSP 3 Score: 54.6842 bits (130), Expect = 9.385e-7
Identity = 78/298 (26.17%), Postives = 128/298 (42.95%), Query Frame = 1
Query: 1615 SNCSFVNIDTNNGYLTTNEMFDRET----KDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVR-AIDNDLGENGTVSYVQVNQISNQRFYFTVSN------YGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTL---SCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIILENERYHKNVNE 2463
             N  +  ++  NG LT NE  DRET           ++++ +   N  +   + + I DINDN P+F  +     I E  +  G   R+  A D D+  NG   Y       N  F  +V          E+ L   LD +++  H+ TI A D G P   S ++ + + VLDSN++ P F+   + + +   + Q   I K    +TD+D    N ++ Y          K+LF ++  +G I++       +F+   KE  EI V   D   P      +  +++E E  + NV E
Sbjct:   69 GNVKYFALNHRNGDLTVNEKIDRETLCGSSTRCVLPLEIIIE---NPLELFSLEIEIVDINDNSPLFLSSDQLIKISEALANPGTRFRLESAQDLDISTNGVSKYTLT---PNPYFSLSVDTRKDGTLVPELILEKNLDREEKEYHKFTITAFDGGNP-PRSGTSQITVIVLDSNDNAPVFDHSKYKVVVQENAPQNTVILK--LNATDQDAG-LNGEIEYFFGYHTLDSMKALFTLNPQSGEISVN---GVIDFE--EKEFYEISVRAKDKGNPELESHCL--VLIEIEDVNDNVPE 349          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: ENSXETT00000039400.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:18417570:18420374:1 gene:ENSXETG00000012683.1 transcript:ENSXETT00000039400.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 184.111 bits (466), Expect = 2.601e-47
Identity = 188/620 (30.32%), Postives = 305/620 (49.19%), Query Frame = 1
Query:  268 QHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISF-RYDPIQCTLTAWD--LNSSSSMRLI-VKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENT-PPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRI--STIDLDKKSEVAFSIVHSSN-----CSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVN--FTDTVKVILRISDINDNKPVF-------DAHYSFSIPENTSVDG-FIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNY-GEIRLFHMLDIDKQNIHQ-VTIVARDQGRP 2052
            +H+  F ++   G L     IDRE++C  +  C  L  + V+E             P    +  I I+DINDNSPSF + T  +EI E +  GT   L  A D D    ++  YD+  +E  F L+     D +       +L++ R +   +   +Q  LTA D  + + + + +I + ++DIND+SP +    Y + + E+  +++++    ATDAD  V G ++Y + RI      K      FTID+ TG+++  G LDFE     E IV   A+D G   L S    VI I D NDN P I +      + EN+ P   +    + D D   NG + C+I +    F +  S++N    + +  ++ LD E+     + I+  D G P+L++ K I + ++DVNDN   F Q +  + IPEN P GS + ++  S  DLD  +++ +SI++++       S+++I++  G L     FD E   E  F +QV+ KDN +     T  V + I+D+NDN P         D    F I   TS  G  + +V A+D D G N  +SY +  Q+S +   FT+S + GEIR   +   +K+ + Q + ++ +D G P
Sbjct:   77 EHF--FNVNLENGNLYVADRIDRESVCEMTPIC-SLSLEAVVE------------NPLNIFHVEIEIKDINDNSPSFSKDTMNLEITELTHPGTRFILGDALDPDDGMNSLQAYDISKNE-YFKLNVKTSSDGRMI----PELVLERPLDREKQSALQIILTALDGGIPARTGISMIKIIISDINDNSPLFSQELYQVSLTESAPVNTLVIQMNATDADEGVNGHITYYLSRISKAAQQK------FTIDTETGEIRTKGTLDFETTKAYEMIVE--AQDGG--GLFSNAKVVIQIVDANDNAPEIILTSVSNSIPENSVPGTVIALINIRDIDSGENGNVYCQITDLLP-FEITSSSSNY---FRLLTTRNLDREEMHGYNITIKATDRGSPSLSTTKTIKLVLLDVNDNPPVFGQASYVVYIPENNPSGSSVFQVQASDPDLDDNAKITYSIMNTNTDNFPVSSYISINSMTGILYAQRPFDYEQLRE--FGIQVMAKDNGSPPLNSTTTVTICITDLNDNSPKILYPSTSADDSAQFEIVPRTSNKGELVAKVVAVDADSGHNAWLSY-EFLQVS-ESMSFTISRHTGEIRTLRVFP-EKETLKQRLVVLVKDNGSP 657          

HSP 2 Score: 124.02 bits (310), Expect = 3.608e-28
Identity = 92/305 (30.16%), Postives = 156/305 (51.15%), Query Frame = 1
Query: 1252 EDANGKIECEILEWGEYFNLK-KSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCS--FVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKP-VFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIH--QVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFAL 2142
            +D    ++   +   EYF L  K++++  +  E+ L + LD EKQS + +I+   DGG P  T    I + + D+NDN   F Q+  ++S+ E+ P+ + +I+++  D D+     + + +   S  +     IDT  G + T    D ET    A+E+ V  +D        KV+++I D NDN P +     S SIPEN+     I  +   D D GENG V Y Q+  +       + SNY   RL    ++D++ +H   +TI A D+G P S+S++ T+ + +LD N++PP F +  + +
Sbjct:  166 DDGMNSLQAYDISKNEYFKLNVKTSSDGRMIPELVLERPLDREKQSALQIILTALDGGIPARTGISMIKIIISDINDNSPLFSQELYQVSLTESAPVNTLVIQMNATDADEGVNGHITYYLSRISKAAQQKFTIDTETGEIRTKGTLDFETTK--AYEMIVEAQDGGGLFSNAKVVIQIVDANDNAPEIILTSVSNSIPENSVPGTVIALINIRDIDSGENGNV-YCQITDLLPFEITSSSSNY--FRLLTTRNLDREEMHGYNITIKATDRGSP-SLSTTKTIKLVLLDVNDNPPVFGQASYVV 464          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdhb4 (protocadherin beta 4 [Source:MGI Symbol;Acc:MGI:2136738])

HSP 1 Score: 194.126 bits (492), Expect = 9.540e-51
Identity = 181/674 (26.85%), Postives = 305/674 (45.25%), Query Frame = 1
Query:  202 IYQMGINLNLTRGKNLKKYELIQHY---NIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKT-ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDP-IQCTLTAWDLNSS--SSMRLI-VKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGN----LFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKS--EVAFSIVHSSN-----CSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-------DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFAL 2142
            +  +  +L +  G+   +   + H    ++  +   TG L     +DRE LC A+         CVL   I         K P + ++T + + DIND+SP FP+    + I E +  GT   L +AQD D    AI  Y +  + +   ++ S    ++Y      +L++ R +     P +   LTA D  +   S M  + +++ DIND++P++  S Y +++ EN  LD+++ T  A D D  +YG ++YS+           F G+     F ID ITG+++L+  LDFE  +   Y V I A D G   LS   T  + + D NDN P + ++     + EN+P   +  F VFD D   NG++ C I     +  LK +  N    Y +   + LD E  +   + I   D G P LT++  I V V D+NDN   F Q +  + + EN      I  IS  D D  S   + +S++   +      S ++I+ +NG L      D E    + F V   +  +   +    V + + D NDN P          A Y+  +P        + +V A+D D G+N  +S+ Q+ + +    +   ++ GE+R   +L       H++ ++ +D G P+  S+S T+ + V+D       F +P+  L
Sbjct:   45 VANLAQDLGIRVGELAAREARVHHRGNKDLLQLDAETGNLFLKEKLDREGLCGAT-------EPCVLHFQIIL-------KNPVQFFQTELQLTDINDHSPEFPDTEMLLTIPESAQPGTVFPLKAAQDPDMGSNAIQNYTVSPNLHFHVVTLSRSDGRKYP-----ELVLDRALDREEQPELTLILTALDGGAPRRSGMTTVHIEIMDINDNAPQFVQSLYEVQVPENFPLDALLVTVSARDLDAGIYGNIAYSL-----------FQGDGDSQPFVIDEITGEIRLSKKLDFE--VTPYYNVEIAATDGG--GLSGKCTVAVQVLDVNDNAPELTVSTLSSPIPENSPETVVAVFGVFDPDSGDNGRMVCSIQNELPFL-LKSTFENY---YTLATERPLDRESIAEYNITITVSDMGTPRLTTQHTIKVQVSDINDNAPAFTQTSYTLFVHENNSPALHIGTISATDSDSGSNAHITYSLLPPQDPQLALSSLISINADNGQLFALRALDYEALQAFEFHVGATDGGSPALSSQTLVRVVVLDDNDNAPFVLYPLQNASAPYTELLPRAAEPGYLVTKVVAVDRDSGQNAWLSF-QLLKATEPGLFSVWAHNGEVRTTRLLSERDAPKHRLLLLVKDNGEPLR-SASVTMHVLVVDG------FSQPYLPL 672          

HSP 2 Score: 98.2117 bits (243), Expect = 2.430e-20
Identity = 96/374 (25.67%), Postives = 164/374 (43.85%), Query Frame = 1
Query: 1345 EIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCS--FVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYF---TVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTL-SCQTQTIDKNLFPSTDKDKSPENTKMNY-LLDNIKP-LEFKSLFKIDKLTGTI-AMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIIL 2430
            E+ L + LD E+Q  + LI+   DGG P  +    + + ++D+NDN   F Q    + +PEN P+ + ++ +S  DLD      +A+S+      S  FV ID   G +  ++  D E    Y   V++   D    +    V +++ D+NDN P    +  S  IPEN S +  +      D D G+NG +    V  I N+  +    T  NY  +     LD +    + +TI   D G P  +++  T+ + V D N++ P F +  + L +    +  +      +TD D S  N  + Y LL    P L   SL  I+   G + A+   + +        +  E  V   D   P     T++++++
Sbjct:  193 ELVLDRALDREEQPELTLILTALDGGAPRRSGMTTVHIEIMDINDNAPQFVQSLYEVQVPENFPLDALLVTVSARDLDAGIYGNIAYSLFQGDGDSQPFV-IDEITGEIRLSKKLDFEVTPYY--NVEIAATDGGGLSGKCTVAVQVLDVNDNAPELTVSTLSSPIPEN-SPETVVAVFGVFDPDSGDNGRM----VCSIQNELPFLLKSTFENYYTLATERPLDRESIAEYNITITVSDMGTP-RLTTQHTIKVQVSDINDNAPAFTQTSYTLFVHENNSPALHIGTISATDSD-SGSNAHITYSLLPPQDPQLALSSLISINADNGQLFALRALDYEA------LQAFEFHVGATDGGSPALSSQTLVRVVV 550          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdha11 (protocadherin alpha 11 [Source:MGI Symbol;Acc:MGI:1298372])

HSP 1 Score: 193.356 bits (490), Expect = 4.304e-50
Identity = 174/648 (26.85%), Postives = 299/648 (46.14%), Query Frame = 1
Query:  277 NIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDP-IQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPN-YLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPIT--------YEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSN-----CSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFS--------IPENTSVDGFIGRVRAIDNDLGENGTVSY-VQVNQISNQRFYFTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEK 2127
            ++  ++   G L     IDRE LC  S  C        LE+ +        ++P +  +  + + DINDN P FP   Q + I+E     +   L  A D D  + A++ Y  + S+N +   FS+      K   +  LI+ + +     P +   LTA D      + +++L V+V D+ND+ P + + +Y +RI EN   ++++ T  ATD D    G++ YS+  I      K    +LFT+D   G++++NG LD+EE   + Y + ++A D GTP +      +++I D NDN P + +    + V E+  PN  +   +V D D   NG++ C +            T N+P          Y + L   LD E+ S   L++  +DGG P+L++   ++V V DVNDN   F Q    + + EN P G+ I  +S +D D +  + V++S+V          S+V++   +G +   +  D E  +   F+V   +         V + + + D NDN P    H +          +  +      + +VRA+D D G N  +SY VQ+      R  F V  Y GEI     LD        + ++ +D G P +++++ TV +++++S   P  F +
Sbjct:   73 DLLEVNLQNGILFVNSRIDREELCGRSAECSIH-----LEVIV--------DRPLQVFHVEVEVRDINDNPPVFPLREQRLLISESKQPDSRFPLEGASDADIGENAVLVY--RLSQNEY---FSLEPPINSKQTKRPSLILKKVLDREKTPELNLLLTATDGGKPELTGTVQLWVRVLDVNDNDPVFDHLEYKVRIMENAAKETLVITLNATDLDEGANGQLVYSLMSI------KPTGRHLFTLDEKNGELRVNGTLDYEE--NKLYEIEVLATDKGTPPMVGHCVVLVEILDTNDNSPEVTLTSLSLPVREDAQPNTVIALISVSDLDSGINGQVTCSL------------TPNVPFKIVSTFKNYYSLVLDSSLDRERVSTYDLVVIARDGGSPSLSATVSVSVEVADVNDNAPVFAQPEYTVFVKENNPPGAHIFTVSAMDADAQENALVSYSLVERRVGERLLSSYVSVHAESGKVFALQPLDHEELELLQFQVSARDAGVPALGSNVTLQVFVLDENDNAPTLLPHGAVGAGGAVSELVSRSVGSGHVVTKVRAVDADSGYNAWLSYEVQLG-TGGVRSPFRVGLYTGEISTTRALDEVDSPRQTLLVLVKDHGEP-ALTATATVLVSLVESGQAPKSFSQ 680          

HSP 2 Score: 55.8398 bits (133), Expect = 2.910e-7
Identity = 78/329 (23.71%), Postives = 145/329 (44.07%), Query Frame = 1
Query: 1507 IRISIPENIPIGSEIIRIS---TIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRE----TKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTV--------SNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTL----SCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIILE 2433
            +  SIPE    G+ + RI+    ++L +     F +        + ++  NG L  N   DRE       E +  ++V+    +       V + + DINDN PVF        I E+   D       A D D+GEN  + Y    ++S Q  YF++        +    + L  +LD +K     + + A D G+P  ++ +  +++ VLD N++ P F+   + + +    + +T  I  N   +TD D+   N ++ Y L +IKP   + LF +D+  G + +       +++ N   ++E+ ++    T P+     +L  IL+
Sbjct:   31 LHYSIPEEAKHGTFVGRIAQDLGLELTELVPRLFRVASKDRGDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVIVDRPLQ---VFHVEVEVRDINDNPPVFPLREQRLLISESKQPDSRFPLEGASDADIGENAVLVY----RLS-QNEYFSLEPPINSKQTKRPSLILKKVLDREKTPELNLLLTATDGGKP-ELTGTVQLWVRVLDVNDNDPVFDHLEYKVRIMENAAKETLVITLN---ATDLDEG-ANGQLVYSLMSIKP-TGRHLFTLDEKNGELRVN---GTLDYEENKLYEIEV-LATDKGTPPMVGHCVVLVEILD 341          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh19 (protocadherin 19 [Source:MGI Symbol;Acc:MGI:2685563])

HSP 1 Score: 194.512 bits (493), Expect = 4.724e-50
Identity = 184/630 (29.21%), Postives = 292/630 (46.35%), Query Frame = 1
Query:  289 IHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSI-GRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKD---NGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNY-LDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLS-------QILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSS-----NCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDN----VNFTDTVKVILRISDINDNKPVFDA------HYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFI 2085
            I+PS+G L T + IDR+ LC  S        KC++ L + +S +       E     + I+D+NDN+PSFP     +EI+E +  GT + L SA D DS  F +  Y++  +E +F L      D        V+  + R     Y      L   D     ++ L +KV D ND++P +  S Y + + EN   ++ +    A+D D    G+V YS  G +  R      +  LF ID  +G + + G LD+EE     Y + + AKD   N  P+    T +V+D  D      ++++N  +++V E+ PP Y +    V D D   NG+++C +L             N+P   + Y S         LD E+     L IQ +D G P L S K   V + D NDN  +F +   ++ + EN   G+ ++ +S  D D      V++ IV S        ++V+I+ N+G +     F+ E     AFE +V+ KD     +    TV+VI  I D+NDN PV  A           IP N+ +   +  V+A D D GENG V+Y   +     R +F +    GE+R     + + +  +++ +VA D G+  S+S+S  V I
Sbjct:   74 INPSSGLLVTKQKIDRDLLCRQS-------PKCIISLEVMSSSM-------EICVIKVEIKDLNDNAPSFPAAQIELEISEAASPGTRIPLDSAYDPDSGSFGVQTYELTPNE-LFGLEIKTRGDGSRFAELVVEKSLDRETQSHYSFRITALDGGDPPHMGTVGLSIKVTDSNDNNPVFGESTYSVSVPENSPPNTPVIRLNASDPDEGTNGQVVYSFYGYVNDR------TRELFQIDPHSGLVTVTGALDYEE--GHVYELDVQAKDLGPNSIPAHCKVTVSVLDTNDNPPIINLLSVNSELVEVSESAPPGYVIALVRVSDRDSGLNGRVQCRLL------------GNVPFRLQEYESFSTILVDGRLDREQHDQYNLTIQARDSGVPMLQSAKSFTVRITDENDNHPHFSKPYYQVIVQENNTPGAYLLSVSARDPDMGLNGSVSYQIVPSQVRDMPVFTYVSINPNSGDIYALRSFNHEQTK--AFEFKVLAKDGGLPSLQSNATVRVI--ILDVNDNTPVITAPPLINGTAEVYIPRNSGIGYLVTVVKADDYDEGENGRVTY---DMTEGDRGFFEIDQVNGEVRTTRTFNENSKPSYELIVVAHDHGK-TSLSASALVLI 660          

HSP 2 Score: 114.005 bits (284), Expect = 4.784e-25
Identity = 154/626 (24.60%), Postives = 269/626 (42.97%), Query Frame = 1
Query:  676 LNHQVKLIVT-----RNISFRYDPIQCTLTAWDLNSSSSMRLI-VKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGNLFTIDSIT-GDMKLNGNLDFEERLQRE----YIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNY-LDYFTVFDNDEDANGKIECEILEWGEYFNLK-KSTANI-PITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIR---ISIPENIPIGSEI--IRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQV-NQISNQRFYFTVS---NYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEF----------------KSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIIL 2430
            +N    L+VT     R++  R  P +C ++   ++SS  + +I V++ D+ND++P +P ++  + I E     + I    A D D+  +G  +Y +               LF ++  T GD      L  E+ L RE    Y   I A D G P         I + D NDN P+   +   + V EN+PPN  +      D DE  NG++   +  +  Y N + +    I P +  + ++  LDYE+  +  L +Q +D G  ++ +  ++ V+V+D NDN       ++    + + E+ P G  I  +R+S  D      V   ++ +        ++ +  L    + DRE  D+Y   +Q  +             +RI+D NDN P F   +Y   + EN +   ++  V A D D+G NG+VSY  V +Q+ +   +  VS   N G+I      + ++    +  ++A+D G P S+ S+ TV + +LD N++ P    P                L   T +   P N+ + YL+  +K  ++                +  F+ID++ G +  T       F  N+K   E+ V   D  K     S ++ I L
Sbjct:   74 INPSSGLLVTKQKIDRDLLCRQSP-KCIISLEVMSSSMEICVIKVEIKDLNDNAPSFPAAQIELEISEAASPGTRIPLDSAYDPDSGSFGVQTYEL-----------TPNELFGLEIKTRGDGSRFAELVVEKSLDRETQSHYSFRITALDGGDPPHMGTVGLSIKVTDSNDNNPVFGESTYSVSVPENSPPNTPVIRLNASDPDEGTNGQV---VYSFYGYVNDRTRELFQIDPHSGLVTVTGALDYEEGHVYELDVQAKDLGPNSIPAHCKVTVSVLDTNDNPPIINLLSVNSELVEVSESAPPGYVIALVRVSDRDSGLNGRVQCRLLGNVPFRLQEYESFSTILVDGRL-DREQHDQYNLTIQARDSGVPMLQSAKSFTVRITDENDNHPHFSKPYYQVIVQENNTPGAYLLSVSARDPDMGLNGSVSYQIVPSQVRDMPVFTYVSINPNSGDIYALRSFNHEQTKAFEFKVLAKDGGLP-SLQSNATVRVIILDVNDNTPVITAP---------------PLINGTAEVYIPRNSGIGYLVTVVKADDYDEGENGRVTYDMTEGDRGFFEIDQVNGEVRTTR-----TFNENSKPSYELIVVAHDHGKTSLSASALVLIYL 662          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdha2 (protocadherin alpha 2 [Source:MGI Symbol;Acc:MGI:2681880])

HSP 1 Score: 193.356 bits (490), Expect = 4.816e-50
Identity = 170/636 (26.73%), Postives = 300/636 (47.17%), Query Frame = 1
Query:  277 NIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQY--KLNHQVKLIVTRNISFRYDP-IQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVY-GKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPN-YLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSN-----CSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF--------DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHP 2112
            ++  ++   G L     IDRE LC  S  C        LE+ +        ++P +  +  + + DINDN P FP   +TI+ +E   + +   L  A D D    A++ Y +  SE +F      F D Q   +L+  + L++ +++    D  ++  L A D      + ++++++KV D+ND+ P +P S Y +++ EN    +++    A+DAD     ++ YS+G     D+  T +   F ID  +G+++  G LD+EER    Y + +IA D GTP++S      + + D NDN P ++I    + V+EN P    +   +V D D   NG++ C  L     F L  +  N    Y + L   LD E  +   +++  +DGG P+L +   ++V V DVNDN   F Q    + + EN P G+ I  +S +D D +  + V++S+V          S+V++   +G +   +  D E  +   F+V   +         V + + + D NDN P+             S  +P +      + +VRA+D D G N  +SY ++      R  F V  Y GEI     LD       ++ ++ +D G P S++++ TV +++++++  P
Sbjct:   73 DLLEVNLQNGILFVNSRIDREELCGRSAECSIH-----LEVIV--------DRPLQVFHVEVEVRDINDNPPRFPMTEKTIQFSESRSLDSRFPLEGASDADIGVNALLSYKLSPSE-LF------FLDVQTSDELSQSLFLVLGKSLDREEDAEVKLLLVATDGGKPELTGTVQILIKVLDVNDNEPTFPQSVYKVQLLENTANGTLVMKLNASDADEGSNSEIVYSLGS----DVSST-TRTKFQIDPNSGEVRTKGELDYEERTS--YEIQVIASDKGTPAMSGHCKISVKLVDINDNTPEVSITSLSLPVQENAPLGAVIALISVSDRDSGVNGQVTCS-LSPHVPFKLVSTFKNY---YSLVLDSALDREATADYKVMVTARDGGSPSLRATASVSVEVADVNDNAPVFAQPEYTVFVKENNPPGAHIFTVSAMDADAQENALVSYSLVERRVGERLLSSYVSVHAESGKVFALQPLDHEELELLQFQVTARDAGVPALGSNVTLQVFVLDENDNAPLLLPQGAVGVGGSVSELVPRSVGSGHVVTKVRAVDADSGYNAWLSY-ELQSTVGMRSLFRVGLYTGEISTTRALDEVDAPRQRLLVLVKDHGEP-SLTATATVLVSLVENSQAP 675          

HSP 2 Score: 121.324 bits (303), Expect = 2.124e-27
Identity = 80/271 (29.52%), Postives = 136/271 (50.18%), Query Frame = 1
Query: 1348 IYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSI---VHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKP-VFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFAL 2142
            + L + LD E+ + + L++   DGGKP LT   +I + V+DVNDN   FPQ   ++ + EN   G+ +++++  D D+   SE+ +S+   V S+  +   ID N+G + T    D E +  Y  +V   +K     +   K+ +++ DINDN P V     S  + EN  +   I  +   D D G NG V+      +   +   T  NY  + L   LD +    ++V + ARD G P S+ ++ +V + V D N++ P F +P + +
Sbjct:  194 LVLGKSLDREEDAEVKLLLVATDGGKPELTGTVQILIKVLDVNDNEPTFPQSVYKVQLLENTANGTLVMKLNASDADEGSNSEIVYSLGSDVSSTTRTKFQIDPNSGEVRTKGELDYEERTSYEIQVIASDKGTPAMSGHCKISVKLVDINDNTPEVSITSLSLPVQENAPLGAVIALISVSDRDSGVNGQVTCSLSPHVPF-KLVSTFKNYYSLVLDSALDREATADYKVMVTARDGGSP-SLRATASVSVEVADVNDNAPVFAQPEYTV 462          

HSP 3 Score: 55.8398 bits (133), Expect = 3.689e-7
Identity = 80/325 (24.62%), Postives = 144/325 (44.31%), Query Frame = 1
Query: 1507 IRISIPENIPIGSEIIRIS---TIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRE----TKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQIS-NQRFYFTVSNYGEIR--LFHMLD--IDKQNIHQVTI--VARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQ--TIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIIL 2430
            +  S+PE    G+ + RI+    ++L +     F +        + ++  NG L  N   DRE       E +  ++V+    +       V + + DINDN P F     +    E+ S+D       A D D+G N  +SY    ++S ++ F+  V    E+   LF +L   +D++   +V +  VA D G+P  ++ +  + I VLD N++ P F +  + + L   T   T+   L  ++D D+   N+++ Y L +      ++ F+ID  +G +  T  E D   +T+     EI+V   D   P   G   + + L
Sbjct:   31 LHYSVPEEAKHGTFVGRIAQDLGLELTELVPRLFRVASKDRGDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVIVDRPLQ---VFHVEVEVRDINDNPPRFPMTEKTIQFSESRSLDSRFPLEGASDADIGVNALLSY----KLSPSELFFLDVQTSDELSQSLFLVLGKSLDREEDAEVKLLLVATDGGKP-ELTGTVQILIKVLDVNDNEPTFPQSVYKVQLLENTANGTLVMKLN-ASDADEG-SNSEIVYSLGSDVSSTTRTKFQIDPNSGEV-RTKGELDYEERTS----YEIQVIASDKGTPAMSGHCKISVKL 340          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdha11 (protocadherin alpha 11 [Source:MGI Symbol;Acc:MGI:1298372])

HSP 1 Score: 193.356 bits (490), Expect = 5.347e-50
Identity = 174/648 (26.85%), Postives = 299/648 (46.14%), Query Frame = 1
Query:  277 NIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDP-IQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPN-YLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPIT--------YEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSN-----CSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFS--------IPENTSVDGFIGRVRAIDNDLGENGTVSY-VQVNQISNQRFYFTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEK 2127
            ++  ++   G L     IDRE LC  S  C        LE+ +        ++P +  +  + + DINDN P FP   Q + I+E     +   L  A D D  + A++ Y  + S+N +   FS+      K   +  LI+ + +     P +   LTA D      + +++L V+V D+ND+ P + + +Y +RI EN   ++++ T  ATD D    G++ YS+  I      K    +LFT+D   G++++NG LD+EE   + Y + ++A D GTP +      +++I D NDN P + +    + V E+  PN  +   +V D D   NG++ C +            T N+P          Y + L   LD E+ S   L++  +DGG P+L++   ++V V DVNDN   F Q    + + EN P G+ I  +S +D D +  + V++S+V          S+V++   +G +   +  D E  +   F+V   +         V + + + D NDN P    H +          +  +      + +VRA+D D G N  +SY VQ+      R  F V  Y GEI     LD        + ++ +D G P +++++ TV +++++S   P  F +
Sbjct:   73 DLLEVNLQNGILFVNSRIDREELCGRSAECSIH-----LEVIV--------DRPLQVFHVEVEVRDINDNPPVFPLREQRLLISESKQPDSRFPLEGASDADIGENAVLVY--RLSQNEY---FSLEPPINSKQTKRPSLILKKVLDREKTPELNLLLTATDGGKPELTGTVQLWVRVLDVNDNDPVFDHLEYKVRIMENAAKETLVITLNATDLDEGANGQLVYSLMSI------KPTGRHLFTLDEKNGELRVNGTLDYEE--NKLYEIEVLATDKGTPPMVGHCVVLVEILDTNDNSPEVTLTSLSLPVREDAQPNTVIALISVSDLDSGINGQVTCSL------------TPNVPFKIVSTFKNYYSLVLDSSLDRERVSTYDLVVIARDGGSPSLSATVSVSVEVADVNDNAPVFAQPEYTVFVKENNPPGAHIFTVSAMDADAQENALVSYSLVERRVGERLLSSYVSVHAESGKVFALQPLDHEELELLQFQVSARDAGVPALGSNVTLQVFVLDENDNAPTLLPHGAVGAGGAVSELVSRSVGSGHVVTKVRAVDADSGYNAWLSYEVQLG-TGGVRSPFRVGLYTGEISTTRALDEVDSPRQTLLVLVKDHGEP-ALTATATVLVSLVESGQAPKSFSQ 680          

HSP 2 Score: 55.8398 bits (133), Expect = 2.956e-7
Identity = 78/329 (23.71%), Postives = 145/329 (44.07%), Query Frame = 1
Query: 1507 IRISIPENIPIGSEIIRIS---TIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRE----TKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTV--------SNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTL----SCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIILE 2433
            +  SIPE    G+ + RI+    ++L +     F +        + ++  NG L  N   DRE       E +  ++V+    +       V + + DINDN PVF        I E+   D       A D D+GEN  + Y    ++S Q  YF++        +    + L  +LD +K     + + A D G+P  ++ +  +++ VLD N++ P F+   + + +    + +T  I  N   +TD D+   N ++ Y L +IKP   + LF +D+  G + +       +++ N   ++E+ ++    T P+     +L  IL+
Sbjct:   31 LHYSIPEEAKHGTFVGRIAQDLGLELTELVPRLFRVASKDRGDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVIVDRPLQ---VFHVEVEVRDINDNPPVFPLREQRLLISESKQPDSRFPLEGASDADIGENAVLVY----RLS-QNEYFSLEPPINSKQTKRPSLILKKVLDREKTPELNLLLTATDGGKP-ELTGTVQLWVRVLDVNDNDPVFDHLEYKVRIMENAAKETLVITLN---ATDLDEG-ANGQLVYSLMSIKPTG-RHLFTLDEKNGELRVN---GTLDYEENKLYEIEV-LATDKGTPPMVGHCVVLVEILD 341          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q9Y5I1|PCDAB_HUMAN (Protocadherin alpha-11 OS=Homo sapiens OX=9606 GN=PCDHA11 PE=2 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 2.097e-54
Identity = 184/678 (27.14%), Postives = 315/678 (46.46%), Query Frame = 1
Query:  244 NLKKYELIQ---------HYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDP-IQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPN-YLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVH-----SSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFS--------IPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLF 2184
             L+  EL+Q         H ++  ++   G L     IDRE LC  S  C        LE+ +        ++P +  +  + ++DINDN P F    Q + I E     +   L  A D D  + A++ Y  + S+N +   FS+      K   ++ LI+ +++     P +   LTA D      + ++RL+V+V D+ND+ PE+  S+Y + + EN   ++++    ATD D  V G+V+YS+  I      K    +LFT+D   G++++NG LD+EE   + Y + + A D GTP ++   T  ++I D NDN P + +    + V E+  P+  +   +V D D   NG++ C +      F L  +  N    Y + L   LD E      L++  +DGG P+L +  R++V V DVNDN   F Q    + + EN P G  I  +S  D D +  + V++S+V       +  S+V++   +G +   +  D E  +   F+V   +      +  V + + + D NDN P   A  + S        +P +      + +VRA+D D G N  +SY         R  F V  Y GEI     LD      H++ ++ +D G P +++++ TV +++++S   P    +   A   S +   +D N++
Sbjct:   53 GLELAELVQRLFRVASKTHGDLLEVNLQNGILFVNSRIDREELCGQSAECSIH-----LEVIV--------DRPLQVFHVNVEVKDINDNPPVFSLREQKLLIAESKQSDSRFPLEGASDADIEENALLTY--RLSKNEY---FSLDSPTNGKQIKRLSLILKKSLDREKTPELNLLLTATDGGKPELTGTVRLLVQVLDVNDNDPEFDKSEYKVSLMENAAKETLVLKLNATDRDEGVNGEVTYSLMSI------KPNGRHLFTLDQNNGEVRVNGTLDYEE--NKFYKIEVQATDKGTPPMAGHCTVWVEILDTNDNSPEVAVTSLSLPVREDAQPSTVIALISVSDRDSGVNGQVTCSLTP-HVPFKLVSTFKNY---YSLVLDSALDRENVWAYELVVTARDGGSPSLWATARVSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSARDADAQENALVSYSLVERRLGDRALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLSSNVTLQVFVLDENDNAPALLATQAGSAGGAVNKLVPRSVGAGHVVAKVRAVDADSGYNAWLSYELQPAAGGSRIPFRVGLYTGEISTTRALDEADSPRHRLLVLVKDHGEP-ALTATATVLVSLVESGQAPKASSR-TLAGAASPEAALVDVNVY 698          

HSP 2 Score: 61.6178 bits (148), Expect = 3.563e-8
Identity = 71/308 (23.05%), Postives = 142/308 (46.10%), Query Frame = 1
Query: 1507 IRISIPENIPIGSEIIRIS---TIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRE----TKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYF--TVSNYGEIRLFHM-----LDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTL----SCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVS 2373
            +  S+ E    G+ + RI+    ++L +  +  F +   ++   + ++  NG L  N   DRE       E +  ++V+    +       V + + DINDN PVF        I E+   D       A D D+ EN  ++Y    ++S   ++   + +N  +I+   +     LD +K     + + A D G+P  ++ +  + + VLD N++ PEF+K  + ++L    + +T  +  N   +TD+D+   N ++ Y L +IKP   + LF +D+  G + +       +++ N   K+E++ +
Sbjct:   31 LHYSVSEEAKHGTFVGRIAQDLGLELAELVQRLFRVASKTHGDLLEVNLQNGILFVNSRIDREELCGQSAECSIHLEVIVDRPLQ---VFHVNVEVKDINDNPPVFSLREQKLLIAESKQSDSRFPLEGASDADIEENALLTY----RLSKNEYFSLDSPTNGKQIKRLSLILKKSLDREKTPELNLLLTATDGGKP-ELTGTVRLLVQVLDVNDNDPEFDKSEYKVSLMENAAKETLVLKLN---ATDRDEG-VNGEVTYSLMSIKP-NGRHLFTLDQNNGEVRVN---GTLDYEENKFYKIEVQAT 322          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q5DRF3|PCDAB_PANTR (Protocadherin alpha-11 OS=Pan troglodytes OX=9598 GN=PCDHA11 PE=3 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 9.989e-53
Identity = 178/668 (26.65%), Postives = 315/668 (47.16%), Query Frame = 1
Query:  271 HYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDP-IQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPN-YLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPI----TYEIYLSQILD--YEKQSMIA--LIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVH-----SSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFS--------IPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLF 2184
            H ++  ++   G L     IDRE LC  S  C        LE+ +        ++P +  +  + ++DINDN P F    Q + I E     +   L  A D D  + A++ Y  + S+N +   FS+      K   ++ LI+ +++     P +   +TA D      + ++RL+V+V D+ND+ P++  S+Y + + EN   ++++    ATD D  V G+V+YS+  I      K    +LFT+D   G++++NG LD+EE   + Y + + A D GTP ++   T  ++I D NDN P + +    + V E+  P+  +   +V D D   NG++ C +            T ++P     T++ Y S +LD   +++S+ A  L++  +DGG P+L +  R++V V DVNDN   F Q    + + EN P G  I  +S  D D +  + V++S+V       +  S+V++   +G +   +  D E  +   F+V   +         V + + + D NDN P   A  + S        +P +      + +VRA+D D G N  +SY         R  F V  Y GEI     LD      H++ ++ +D G P +++++ TV +++++S   P    +       S +   +D N++
Sbjct:   71 HGDLLEVNLQNGILFVNSRIDREELCGQSAECSIH-----LEVIV--------DRPLQVFHVNVEVKDINDNPPVFSLREQKLLIAESKQSDSRFPLEGASDADIEENALLTY--RLSKNEY---FSLDSPTNGKQIKRLSLILKKSLDREKTPELNLMVTATDGGKPELTGTVRLLVQVLDVNDNDPDFDKSEYKVSLMENAAKETLVLKLNATDRDEGVNGEVTYSLMSI------KPNGRHLFTLDQNNGEVRVNGTLDYEE--NKFYKIEVQATDKGTPPMAGHCTVWVEILDTNDNSPEVAVTSLSLPVREDAQPSTVIALISVSDRDSGVNGQVTCSL------------TPHVPFKLVSTFKNYYSLVLDSALDRESVWAYELVVTARDGGSPSLWATARVSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSARDADAQENALVSYSLVERRLGDRALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLGSNVTLQVFVLDENDNAPALLATQAGSAGGAVNKLVPRSVGAGHVVAKVRAVDADSGYNAWLSYELQPAAGGSRIPFRVGLYTGEISTTRALDEADSPRHRLLVLVKDHGEP-ALTATATVLVSLVESGQAPKASSRTLVG-AASPEAALVDVNVY 698          

HSP 2 Score: 58.9214 bits (141), Expect = 2.330e-7
Identity = 70/308 (22.73%), Postives = 141/308 (45.78%), Query Frame = 1
Query: 1507 IRISIPENIPIGSEIIRIS---TIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRE----TKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYF--TVSNYGEIRLFHM-----LDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTL----SCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVS 2373
            +  S+ E    G+ + RI+    ++L +     F +   ++   + ++  NG L  N   DRE       E +  ++V+    +       V + + DINDN PVF        I E+   D       A D D+ EN  ++Y    ++S   ++   + +N  +I+   +     LD +K     + + A D G+P  ++ +  + + VLD N++ P+F+K  + ++L    + +T  +  N   +TD+D+   N ++ Y L +IKP   + LF +D+  G + +       +++ N   K+E++ +
Sbjct:   31 LHYSVSEEAKHGTFVGRIAQDLGLELAELVPRLFRVASKTHGDLLEVNLQNGILFVNSRIDREELCGQSAECSIHLEVIVDRPLQ---VFHVNVEVKDINDNPPVFSLREQKLLIAESKQSDSRFPLEGASDADIEENALLTY----RLSKNEYFSLDSPTNGKQIKRLSLILKKSLDREKTPELNLMVTATDGGKP-ELTGTVRLLVQVLDVNDNDPDFDKSEYKVSLMENAAKETLVLKLN---ATDRDEG-VNGEVTYSLMSIKP-NGRHLFTLDQNNGEVRVN---GTLDYEENKFYKIEVQAT 322          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q9UN75|PCDAC_HUMAN (Protocadherin alpha-12 OS=Homo sapiens OX=9606 GN=PCDHA12 PE=2 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 5.462e-50
Identity = 163/633 (25.75%), Postives = 294/633 (46.45%), Query Frame = 1
Query:  268 QHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-PNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHS-----SNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFS--------IPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHP 2112
            +H ++  ++   G L     IDRE LC  S  C        LE+ +        ++P +  +  + ++DINDN P F E  Q + ++E +P+ +   L  A D D    +++ Y +  +EN F L     +DK       ++ ++ R  + + + +   +       + S+++ + V D+ND+ P +    Y + + EN+  D+ +    A+D D  + G++SY I  I+           +F+I+  TG++++ G LDFEE     Y + + A D G PS++  +  ++++ D NDN P + +    + V+E+      +   +V D D  ANG++ C +      F L  +  N    Y + L   LD E  S   L++  +DGG P+L +  R++V V DVNDN   F Q    + + EN P G  I  +S  D D  K + V++S+V       +  S+V++   +G +   +  D E  +   F+V   +         V + + + D NDN P   A  + S        +P +      + +VRA+D D G N  +SY            F V  Y GEI    +LD      H++ ++ +D G P +++S+ TV ++++++   P
Sbjct:   70 RHGDLLEVNLQNGILFVNSRIDREKLCGRSAECSIH-----LEVIV--------DRPLQVFHVDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEGASDADIGVNSLLTYALSLNEN-FELKIKTKKDKSILPELVLRKLLDREQTPKLNLLLMVIDGGKPELTGSVQIQITVLDVNDNGPAFDKPSYKVVLSENVQNDTRVIQLNASDPDEGLNGEISYGIKMIL-----PVSEKCMFSINPDTGEIRIYGELDFEE--NNAYEIQVNAIDKGIPSMAGHSMVLVEVLDVNDNVPEVMVTSLSLPVQEDAQVGTVIALISVSDRDSGANGQVICSLTPHVP-FKLVSTYKNY---YSLVLDSALDRESVSAYELVVTARDGGSPSLWATARVSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSAWDADAQKNALVSYSLVERRVGEHALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLGSNVTLQVFVLDENDNAPALLATPAGSAGGAVSELVPRSVGAGHVVAKVRAVDADSGYNAWLSYELQPAAVGAHIPFHVGLYTGEISTTRILDEADAPRHRLLVLVKDHGEP-ALTSTATVLVSLVENGQAP 676          

HSP 2 Score: 72.7886 bits (177), Expect = 1.446e-11
Identity = 72/288 (25.00%), Postives = 131/288 (45.49%), Query Frame = 1
Query: 1597 FSIVHSSNCSFVNIDTNNGYLTTNEMFDRET----KDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTV------SNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNL-FPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQI 2424
            F +    +   + ++  NG L  N   DRE       E +  ++V+    +       V + + DINDN PVF +      + E+  +D       A D D+G N  ++Y       N+ F   +      S   E+ L  +LD ++     + ++  D G+P  ++ S  + ITVLD N++ P F+KP + + LS   Q   + +   ++D D+   N +++Y +  I P+  K +F I+  TG I +     + +F+ NN    EI+V+  D   P   G +++ +
Sbjct:   64 FRVASKRHGDLLEVNLQNGILFVNSRIDREKLCGRSAECSIHLEVIVDRPLQ---VFHVDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEGASDADIGVNSLLTYALS---LNENFELKIKTKKDKSILPELVLRKLLDREQTPKLNLLLMVIDGGKP-ELTGSVQIQITVLDVNDNGPAFDKPSYKVVLSENVQNDTRVIQLNASDPDEG-LNGEISYGIKMILPVSEKCMFSINPDTGEIRIY---GELDFEENN--AYEIQVNAIDKGIPSMAGHSMVLV 338          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q8TAB3|PCD19_HUMAN (Protocadherin-19 OS=Homo sapiens OX=9606 GN=PCDH19 PE=1 SV=3)

HSP 1 Score: 196.052 bits (497), Expect = 9.465e-50
Identity = 185/630 (29.37%), Postives = 292/630 (46.35%), Query Frame = 1
Query:  289 IHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSI-GRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKD---NGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNY-LDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLS-------QILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRIST--IDLDKKSEVAFSIVHSS-----NCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDN----VNFTDTVKVILRISDINDNKPVFDA------HYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFI 2085
            I+PS+G L T + IDR+ LC  S        KC++ L + +S +       E     + I+D+NDN+PSFP     +EI+E +  GT + L SA D DS  F +  Y++  +E +F L      D        V+  + R     Y      L   D     ++ L +KV D ND++P +  S Y + + EN   ++ +    A+D D    G+V YS  G +  R      +  LF ID  +G + + G LD+EE     Y + + AKD   N  P+    T +V+D  D      ++++N  +++V E+ PP Y +    V D D   NG+++C +L             N+P   + Y S         LD E+     L IQ +DGG P L S K   V + D NDN  +F +   ++ + EN   G+ ++ +S    DL     V++ IV S        ++V+I+ N+G +     F+ E     AFE +V+ KD     +    TV+VI  I D+NDN PV  A           IP N+ +   +  V+A D D GENG V+Y   +     R +F +    GE+R         ++ +++ +VA D G+  S+S+S  V I
Sbjct:   74 INPSSGLLVTKQKIDRDLLCRQS-------PKCIISLEVMSSSM-------EICVIKVEIKDLNDNAPSFPAAQIELEISEAASPGTRIPLDSAYDPDSGSFGVQTYELTPNE-LFGLEIKTRGDGSRFAELVVEKSLDRETQSHYSFRITALDGGDPPRLGTVGLSIKVTDSNDNNPVFSESTYAVSVPENSPPNTPVIRLNASDPDEGTNGQVVYSFYGYVNDR------TRELFQIDPHSGLVTVTGALDYEE--GHVYELDVQAKDLGPNSIPAHCKVTVSVLDTNDNPPVINLLSVNSELVEVSESAPPGYVIALVRVSDRDSGLNGRVQCRLL------------GNVPFRLQEYESFSTILVDGRLDREQHDQYNLTIQARDGGVPMLQSAKSFTVLITDENDNHPHFSKPYYQVIVQENNTPGAYLLSVSARDPDLGLNGSVSYQIVPSQVRDMPVFTYVSINPNSGDIYALRSFNHEQTK--AFEFKVLAKDGGLPSLQSNATVRVI--ILDVNDNTPVITAPPLINGTAEVYIPRNSGIGYLVTVVKAEDYDEGENGRVTY---DMTEGDRGFFEIDQVNGEVRTTRTFGESSKSSYELIVVAHDHGK-TSLSASALVLI 660          

HSP 2 Score: 111.309 bits (277), Expect = 2.686e-23
Identity = 153/626 (24.44%), Postives = 269/626 (42.97%), Query Frame = 1
Query:  676 LNHQVKLIVT-----RNISFRYDPIQCTLTAWDLNSSSSMRLI-VKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGNLFTIDSIT-GDMKLNGNLDFEERLQRE----YIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNY-LDYFTVFDNDEDANGKIECEILEWGEYFNLK-KSTANI-PITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIR---ISIPENIPIGSEI--IRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQV-NQISNQRFYFTVS---NYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEF----------------KSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIIL 2430
            +N    L+VT     R++  R  P +C ++   ++SS  + +I V++ D+ND++P +P ++  + I E     + I    A D D+  +G  +Y +               LF ++  T GD      L  E+ L RE    Y   I A D G P         I + D NDN P+ + +   + V EN+PPN  +      D DE  NG++   +  +  Y N + +    I P +  + ++  LDYE+  +  L +Q +D G  ++ +  ++ V+V+D NDN       ++    + + E+ P G  I  +R+S  D      V   ++ +        ++ +  L    + DRE  D+Y   +Q  +             + I+D NDN P F   +Y   + EN +   ++  V A D DLG NG+VSY  V +Q+ +   +  VS   N G+I      + ++    +  ++A+D G P S+ S+ TV + +LD N++ P    P                L   T +   P N+ + YL+  +K  ++                +  F+ID++ G +  T       F  ++K   E+ V   D  K     S ++ I L
Sbjct:   74 INPSSGLLVTKQKIDRDLLCRQSP-KCIISLEVMSSSMEICVIKVEIKDLNDNAPSFPAAQIELEISEAASPGTRIPLDSAYDPDSGSFGVQTYEL-----------TPNELFGLEIKTRGDGSRFAELVVEKSLDRETQSHYSFRITALDGGDPPRLGTVGLSIKVTDSNDNNPVFSESTYAVSVPENSPPNTPVIRLNASDPDEGTNGQV---VYSFYGYVNDRTRELFQIDPHSGLVTVTGALDYEEGHVYELDVQAKDLGPNSIPAHCKVTVSVLDTNDNPPVINLLSVNSELVEVSESAPPGYVIALVRVSDRDSGLNGRVQCRLLGNVPFRLQEYESFSTILVDGRL-DREQHDQYNLTIQARDGGVPMLQSAKSFTVLITDENDNHPHFSKPYYQVIVQENNTPGAYLLSVSARDPDLGLNGSVSYQIVPSQVRDMPVFTYVSINPNSGDIYALRSFNHEQTKAFEFKVLAKDGGLP-SLQSNATVRVIILDVNDNTPVITAP---------------PLINGTAEVYIPRNSGIGYLVTVVKAEDYDEGENGRVTYDMTEGDRGFFEIDQVNGEVRTTR-----TFGESSKSSYELIVVAHDHGKTSLSASALVLIYL 662          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q5DRF0|PCDA2_PANTR (Protocadherin alpha-2 OS=Pan troglodytes OX=9598 GN=PCDHA2 PE=3 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 1.039e-49
Identity = 172/663 (25.94%), Postives = 301/663 (45.40%), Query Frame = 1
Query:  268 QHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQY--KLNHQVKLIVTRNISFRYDP-IQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVY-GKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-PNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIV-----HSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFS--------IPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLF 2184
            +H ++  ++   G L     IDRE LC  S  C        LE+ +        ++P +  +  + ++DINDN P FP   +TI   E   + +   L  A D D    A++ Y +  SE  F        D Q   +L+  + L++ +++       +   L A D      + ++++++KV D+ND+ P +  S Y +++ EN    +++    A+DAD     ++ YS+G     D+  T     FTID I+G+++  G LD+EE   + Y + + A D GTPS+S      + + D NDN P ++I    + + EN      +   TV D D   NG + C +      F L  +  N    Y + L   LD E  S   L++  +DGG P+L +   +++ V DVNDN   F Q    + + EN P G  I  +S  D D +  + V++S+V       +  S+V++   +G +   +  D E  +   F+V   +         V + + + D NDN P   A  + +        +P +      + +VRA+D D G N  +SY       + R  F V  Y GEI     LD      H++ ++ +D G P +++++ TV +++++S   P    + +     S +   +D N++
Sbjct:   70 RHGDLLEVNLQNGILFVNSRIDREELCGRSAECSIH-----LEVIV--------DRPLQVFHVEVEVKDINDNPPVFPMTVKTIRFPESRLLDSRFPLEGASDADIGVNALLSYKLSSSEFFF-------LDIQTNDELSESLSLVLGKSLDREETAEVNLLLVATDGGKPELTGTVQILIKVLDVNDNEPTFAQSVYKVKLLENTANGTLVVKLNASDADEGSNSEIVYSLGS----DVSSTIQTK-FTIDPISGEIRTKGKLDYEE--AKSYEIQVTATDKGTPSMSGHCKISLKLVDINDNTPEVSITSLSLPISENASLGTVIALITVSDRDSGTNGHVTCSLTP-HVPFKLVSTFKNY---YSLVLDSALDRESVSAYELVVTARDGGSPSLWATTSVSIEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSAWDADAQENALVSYSLVERRVGERALSSYVSVHAESGKVYALQPLDHEEVELLQFQVTARDAGVPPLGSNVTLQVFVLDENDNAPALLAPRAGTAAGAVSELVPWSVGAGHVVAKVRAVDADSGYNAWLSYELQLGTGSARIPFRVGLYTGEISTTRALDEADSPRHRLLVLVKDHGEP-ALTATATVLVSLVESGQAPKASSRAWVGAAGS-EATLVDVNVY 699          

HSP 2 Score: 66.6254 bits (161), Expect = 1.251e-9
Identity = 76/319 (23.82%), Postives = 137/319 (42.95%), Query Frame = 1
Query: 1507 IRISIPENIPIGSEIIRIS---TIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRE----TKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHY-SFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFT-------VSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTL----SCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRG 2406
            +R S+PE    G+ + RI+    ++L +     F +    +   + ++  NG L  N   DRE       E +  ++V+    +       V + + DINDN PVF     +   PE+  +D       A D D+G N  +SY    ++S+  F+F        +S    + L   LD ++     + +VA D G+P  ++ +  + I VLD N++ P F +  + + L    +  T  +  N   ++D D+   N+++ Y L +      ++ F ID ++G I    K           +  EI+V+  D   P   G
Sbjct:   31 LRYSVPEEAKHGTFVGRIAQDLGLELAELVPRLFRVASKRHGDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVIVDRPLQV---FHVEVEVKDINDNPPVFPMTVKTIRFPESRLLDSRFPLEGASDADIGVNALLSY----KLSSSEFFFLDIQTNDELSESLSLVLGKSLDREETAEVNLLLVATDGGKP-ELTGTVQILIKVLDVNDNEPTFAQSVYKVKLLENTANGTLVVKLN---ASDADEG-SNSEIVYSLGSDVSSTIQTKFTIDPISGEIRTKGK-----LDYEEAKSYEIQVTATDKGTPSMSG 332          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A0R3T381 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS1452 PE=4 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 2.145e-64
Identity = 241/815 (29.57%), Postives = 384/815 (47.12%), Query Frame = 1
Query:  268 QHYN----IFAIHPST----GFLQTIRSIDREALCHASNNCDCLKRK-----------CVLELTIFASDLIQSNK--PPERIYKTICIEDINDNSPSF------PELTQTIEIN----EKSPIGTELELHSAQDRDS-SDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYD---PIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEW--PN-------------SKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVE--ENTPPN-YLDYFTVFDNDEDANGKIECEILEWG---EYFNLKKSTANI-------PITYEIYLSQILD-----------YEKQSMIALIIQCQDGGKP----NLTSKKRIAVNVIDVNDNRVYF---------PQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEY-AFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVS-YVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFAL--TLSCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIK-PL-----------EFKSLFKIDKLTGTIAMTVKEND--CNFKTNNKEKV-EIKVSVFDPTKP 2394
            QH N     F   PST     +L T++ IDRE LC     CDC               C + L I A   I S K   P  I   ICI D NDN P+F      P    T  IN    E + +G   +L    D D+  +  I  Y + C E   ++ FS+     Y +N   +L +  +   ++D   P+ CT+ A+D   S S+++ + ++D+N+H P W  PN               + I I E++   +++   +A D D VYGK++YSI         +  +G LF +DS TG++ L    D+E  +++E  + I+  DNG   LS+P   +  ++D NDN P+I  + G    E  EN+  + Y+DY TV D D  + GKIEC IL+ G   ++F L +   N+       PI  E  ++               Y + + + + + C D         L+++  + V ++D NDN  +F          +  I +SI E +P G+ ++RI+  D D    + +++ HS     + ID  +G +TT  +FDRE +     F+V V +   VN + +  + + I D NDN PVF +     +PE+  VD  +  + A D D+GENGTV+ +   NQ  N    FT+   G + L   LD +++  ++++I+A D+G P ++SS+    + V D N+ PP FE    +   T+ C TQ+       +TD D  PENT +NY + N+K P            +  SLF I   TG + +  +  +   NF   +   V  +K++ FDP +P
Sbjct:   85 QHQNHLRIWFPKEPSTLSSPWYLVTLQQIDRERLCQTEPGCDCHTGNSHPNRLGSGPDCSIPLRIVA---IPSKKIGLPSVIDLPICIADENDNPPTFRSPSSAPHFGSTPTINVHFKEDAQVGELAKLPPGNDADAYPEHTINSYTLSCPET--DVPFSLV----YDINTPERLDLRVDKQLKFDGQWPLHCTVNAFDGQHSGSLQMKIHLDDVNNHQPVWKQPNILNSAIILVNETVDTWIIEIPESVPPFTVLLQLKAIDEDPVYGKLTYSIDG-------EKKTGLLFDVDSRTGEVCLVAKQDYEMSVKKETTIPILVTDNG--GLSTPGKLIFHLKDVNDNRPLIRFSGGEKQAEVVENSQSDVYIDYVTVTDTDSGSYGKIEC-ILKPGMISDHFQLTRIGDNLWAFLAVKPIDREALVTTTSATAVASANNNRYYSRGTRVGITVICNDNPGAIKEHQLSAEATVQVTIVDENDNPPHFVSLGGTNGDSESVIDVSISEGLPPGTPVVRITAEDPDIGDTLTYAL-HSHGNKKLAIDPISGLITTQSVFDREEEAVLTGFKVFVFDGGPVNHSISADLRVIILDQNDNSPVFHSQTVLIVPEDKPVDSLLHTINATDADVGENGTVTLFFAQNQ--NSPNPFTLFPDGRLFLTRPLDRERREHYELSIIAADKGSP-ALSSTLAFVVQVEDVNDSPPRFELAVGSSLKTVPC-TQSYVALDMTATDADSLPENTVINYKILNVKGPFGDSSNQRTDSDKGVSLFYIQPDTGALFLHSQNGEIQANFDPCDHTGVYRLKITAFDPNRP 875          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A0R3WFB5 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS9559 PE=4 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 3.482e-64
Identity = 233/797 (29.23%), Postives = 378/797 (47.43%), Query Frame = 1
Query:  298 STGFLQTIRSIDREALCHASNNCDC-----------LKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSF------PEL----TQTIEINEKSPIGTELELHSAQDRDS-SDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYD-PIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEW-PNS--------------KYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSI--GRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVE--ENTPPN-YLDYFTVFDNDEDANGKIECEILEWG---EYFNLKKSTANI-------PITYEIYLSQILD------------YEKQSMIALIIQCQDG-GKP---NLTSKKRIAVNVIDVNDNRVYF--PQKT-------IRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEY-AFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVS--YVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPF--FALTLSCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIK-PL-----------EFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKV---EIKVSVFDPTKP 2394
            S  +L T + IDRE+LC     CDC               C L L + A    ++  P   I  TICI D NDN PSF      P      T +I   E + +G    L +  D D+  +  +  Y + C E   ++ FS+  D       ++ L V + + F    P+ CT+TA+D     SM+L + ++D+N+H P W P S              ++ + I E++   +++   +A+D D VYGK++YS+  G+           G LF IDS TG+++L G  DFE    R   V ++  DNG   LS+P   +  ++D NDN P+I  + G    E  EN+  + Y+D+ TV D D  A G++EC  L+ G   ++F L + + N+       PI  E   S                Y + + + + + C D  G P    L+++  + V ++D NDN  +F  P ++       I +++ E +P G+ +IRI+  D D    + ++++   N   ++ID ++G +TT  +FDRE       F+V V +    N + +  + + I D NDN PVF +    ++PE+  VD  +  +   D D GENGTV+  + Q  +  N    FT+   G + L   LD ++   +++TI+A D+G P ++SS+ T  + V D N+ PP FE     F  T+ C TQ+       +TD D  P NT +NY + N+K PL           +  SLF I+  TG I    + ++ +   +  ++     + V  FDP +P
Sbjct:  105 SPWYLVTRQKIDRESLCQTEPGCDCHLGNSHPNRLGTGPDCALPLRLVAVPPKKAGLP-SVIDLTICIADENDNPPSFRSSSSAPHFGTSPTVSIHFKEDAQMGELTRLPTGYDADAYPEHTVSSYSLNCPET--DVPFSLVYD--ISTPERLDLRVDKPLKFAGQWPLHCTVTAFDGQHRGSMQLKIHLDDVNNHKPVWKPPSILNSAITVINETADEWALEIPESIPPFTVLLQLKASDEDPVYGKLTYSMEGGKK---------GGLLFDIDSRTGEVRLVGKQDFETAGNRAVTVPLLVTDNG--GLSTPGKLIFYLKDINDNRPLIRFSGGEKQAEVVENSQSDVYIDFITVSDADSGAYGQVEC-YLKPGVVSDHFQLTRISDNLWAFQAVKPIDREALASTTATTTITTSAQNNRFYARGTRVGVTVVCNDNPGAPKDYQLSAEATVQVTIVDENDNPPHFVGPGRSTANAVPIIDVAVSEGLPPGTPVIRIAAEDPDVGDVLTYALLPCGNKK-LSIDPSSGLITTQSVFDREDMPILTGFKVFVFDGGAANHSISADLRVTILDQNDNSPVFHSQTVLTVPEDKPVDSLLHVINVTDADAGENGTVTLFFTQHQRSPNP---FTLHPDGRLFLTRPLDRERHEHYELTIIAADKGNP-ALSSTLTFVVQVEDVNDSPPRFELAVGSFLKTVPC-TQSYVALDMAATDADSLPMNTVINYRILNVKGPLGDSAGQKGNTEKDNSLFYIEPDTGAILFHGQNSEMSTSVDPCDRTGVYRLTVMAFDPHRP 878          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A3Q4MGQ4 (Si:ch73-379j16.2 OS=Neolamprologus brichardi OX=32507 PE=4 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 6.703e-63
Identity = 196/642 (30.53%), Postives = 321/642 (50.00%), Query Frame = 1
Query:  283 FAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTL--TAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPN-YLDYFTVFDNDEDANGKIECEILEWGEYFNLKKS----------------TANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKS--EVAFSIVHSSNC---SFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDA-HYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEF 2121
            F ++P  G L   + IDRE LCH S         C++EL +   +      P E  Y  + I D+ND+SPSF E  QT E+ E+S  GT LELH+A+D D+   +I  Y +  +++ F++  S   +++      +  ++ +N   R    +  L  TA D      S ++ + + V D ND+ P +    Y I I EN+ + + +    ATD D    G++ YS+ + + R I +     +F +DS++G++ L G LDFE+     Y + + A D GTP L+S    ++ I+D NDN P I +      V E++ P   +   +V D D   NGKI   I + G  F+LK S                   IPI   + L + LD E + +  L++   DGGKP+ +    I ++V+DVNDN   F + T  + + EN P G+ I++++  DLD+ S  E+ +S+  + N        +D N G +   ++ D E+++ Y  ++Q  +K +        V+++I D+NDN P  +   +S +IPE+  +   +  +  ID D G NG V      ++  +    T  N   I     LD +KQ I+ VTIVA+D G P S++S  ++ I V D N++ PE+
Sbjct:   77 FEVNPDNGVLLVRKKIDREELCHGSG-------ACMIELKMLVEN------PLEIHYVAVEITDVNDHSPSFSEKQQTFEVGEQSSPGTRLELHAARDPDAGINSIRTYSLSSNDH-FDIEISQSDEEK------IPFLILKNSLDREKKHKHFLFVTAVDGGKPPRSGTLNVSITVLDTNDNRPTFKQDTYQIEIFENVSVGTTVANVNATDPDEGTNGELEYSLSKTLARRIYE-----IFELDSVSGEITLKGGLDFED--SEVYKLDVQASDKGTPPLTSRCRVIVKIKDVNDNRPEIEVTSLSNTVTEDSKPGKVISLISVTDKDSGVNGKIISRITQ-GIPFDLKPSYKENTYSIVTIKDRGKEGKIPI---LVLLKTLDRETKKIHKLLLSAIDGGKPSKSGTAEIFIDVLDVNDNMPVFNEDTYSVLVNENTPTGTTIVKVNASDLDEGSNGELIYSLGSNVNHRIRELFRVDPNTGEIIIQDVLDFESEESYEIDIQASDKGSAPLRTDKSVLVKIVDLNDNAPQIEVTSFSKAIPEDARLGTTVALISVIDKDSGLNGKVICSFNEEVPFKLSLSTHDNMYSISTKSPLDREKQAIYDVTIVAKDAGTP-SLTSVKSITIIVSDVNDNRPEW 686          

HSP 2 Score: 113.235 bits (282), Expect = 9.259e-22
Identity = 107/417 (25.66%), Postives = 197/417 (47.24%), Query Frame = 1
Query: 1198 EENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTAN---IPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKS--EVAFSIVHSSNCSFVNI---DTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDA-HYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQI---------SNQRFYFTVSNYGE------IRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNL-FPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVS 2373
            E+++P   L+     D D   N  I    L   ++F+++ S ++   IP    + L   LD EK+    L +   DGGKP  +    +++ V+D NDNR  F Q T +I I EN+ +G+ +  ++  D D+ +  E+ +S+  +       I   D+ +G +T     D E  + Y  +VQ  +K     T   +VI++I D+NDN+P  +    S ++ E++     I  +   D D G NG +       I          N     T+ + G+      + L   LD + + IH++ + A D G+P S S +  +FI VLD N++ P F +  +++ ++  T T    +   ++D D+   N ++ Y L +      + LF++D  TG I +   ++  +F++    +++I+ S
Sbjct:  146 EQSSPGTRLELHAARDPDAGIN-SIRTYSLSSNDHFDIEISQSDEEKIPF---LILKNSLDREKKHKHFLFVTAVDGGKPPRSGTLNVSITVLDTNDNRPTFKQDTYQIEIFENVSVGTTVANVNATDPDEGTNGELEYSLSKTLARRIYEIFELDSVSGEITLKGGLDFEDSEVYKLDVQASDKGTPPLTSRCRVIVKIKDVNDNRPEIEVTSLSNTVTEDSKPGKVISLISVTDKDSGVNGKIISRITQGIPFDLKPSYKENTYSIVTIKDRGKEGKIPILVLLKTLDRETKKIHKLLLSAIDGGKP-SKSGTAEIFIDVLDVNDNMPVFNEDTYSVLVNENTPTGTTIVKVNASDLDEG-SNGELIYSLGSNVNHRIRELFRVDPNTGEIII---QDVLDFESEESYEIDIQAS 553          

HSP 3 Score: 67.3958 bits (163), Expect = 1.731e-7
Identity = 78/303 (25.74%), Postives = 143/303 (47.19%), Query Frame = 1
Query: 1507 IRISIPENIPIGSEIIRIST-IDLDKKS--EVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNV-NFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGE-----IRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTL----SCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVS 2373
            +R SIPE +  G+ +  ++  + LDK S  +    +V  S  +F  ++ +NG L   +  DRE     +    +  K  V N  +   V + I+D+ND+ P F +   +F + E +S    +    A D D G N   +Y   +  SN  F   +S   E     + L + LD +K++ H + + A D G+P   S +  V ITVLD+N++ P F++  + + +    S  T   + N   +TD D+   N ++ Y L          +F++D ++G I +   +   +F+ +   K++++ S
Sbjct:   33 LRYSIPEEMKEGTIVGNVAKDLGLDKTSLADRLLRVVSGSKDAFFEVNPDNGVLLVRKKIDREELCHGSGACMIELKMLVENPLEIHYVAVEITDVNDHSPSFSEKQQTFEVGEQSSPGTRLELHAARDPDAGINSIRTY---SLSSNDHFDIEISQSDEEKIPFLILKNSLDREKKHKHFLFVTAVDGGKP-PRSGTLNVSITVLDTNDNRPTFKQDTYQIEIFENVSVGTTVANVN---ATDPDEG-TNGELEYSLSKTLARRIYEIFELDSVSGEITL---KGGLDFEDSEVYKLDVQAS 324          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A0R3SEA0 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS3077 PE=4 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 1.919e-62
Identity = 226/797 (28.36%), Postives = 372/797 (46.68%), Query Frame = 1
Query:  298 STGFLQTIRSIDREALCHASNNCDCLKRK-----------CVLELTIFASDLIQSNKP--PERIYKTICIEDINDNSPSF------PELTQTIEIN----EKSPIGTELELHSAQDRDS-SDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYD---PIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEW--PN-------------SKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVE--ENTPPN-YLDYFTVFDNDEDANGKIECEILEW--GEYFNLKKSTANI-------PITYEIYLSQILD------------YEKQSMIALIIQCQDGGKP----NLTSKKRIAVNVIDVNDNRVYFPQ---------KTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEY-AFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVS-YVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFAL--TLSCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIK-PLEFK-----------SLFKIDKLTGTIAMTVKEND--CNFKTNNKEKV-EIKVSVFDPTKP 2394
            S  +L T++ IDRE LC     CDC               C + L I A   I S K   P  I  +ICI D NDN P+F      P    T  IN    E + IG   +L    D D+  +  +  Y + C E    + FS+  D    +N   +L +  +   ++D   P+ CT+TA+D   S +++L + ++D+N+H P W  PN               + + I E++   +++   +A D D VYGK++YSI         +  SG+LF +DS TG+++L    D+E  + +   + I+  DNG   LS+P   +  ++D NDN P+I  + G    E  EN+  + Y+DY TV D D D+ GK+EC +      ++F L +   N+       PI  E+  +                Y + + + + + C D         L+++  + V ++D NDN  +F             I +SI E +P G+ +++I+  D D    + ++++   N     ID  +G +TT  +FDRE +     F+V   +  +VN + +  + + I D NDN PVF +     +PE+  VD  +  + A D D GENGTV+ +   NQ  N    FT+   G + L   LD +++  +++ I+A D+G P ++SS+ T  + V D N+ PP FE    +   T+ C    +  ++  +TD D  PENT +NY + ++K P               SLF I   TG + +  +  +   NF   +   V  + ++ FDP +P
Sbjct:  103 SPWYLVTLQQIDRERLCQTEPGCDCHTGNSHPNRLGSGPDCSIPLRIVA---IPSKKVGLPSVIDLSICIADENDNPPTFLSPSSAPHFGSTPTINVHFKEDAQIGELAKLPPGNDADAHPEHTVSSYTLSCPET--GVPFSLVHD----INSPDRLDLRVDKPLKFDGQWPLHCTVTAFDGQHSGNLQLKIHLDDVNNHKPVWKQPNILNSAVTLINETADTWVVEIPESVPPFTVLLQLKAIDEDPVYGKLTYSING-------EKKSGHLFDVDSRTGEVRLVTKQDYEISVNKATTIPILVTDNG--GLSTPGKLIFHLKDVNDNRPLIRFSGGERQAEVVENSQSDVYIDYVTVTDTDSDSYGKVECHLKRGTISDHFQLTRIGDNLWAFQAVKPIDREVLATTTSTAAIASSASNNRFYSRGTRVGITVVCNDNPGAIKEHQLSAEATVQVTIVDENDNPPHFVGLASTNGDSVPIIDVSISEGLPPGTPVVQITAEDPDVGDTLTYALLPHGNKKLA-IDPISGLITTQSVFDREEEAVLTGFKVFAFDGGSVNHSISADLRVNILDQNDNSPVFHSQTVLIVPEDKPVDSLLHTINATDADAGENGTVTLFFAQNQ--NSPNPFTLYPDGRLFLTRPLDRERRENYELAIIAADKGSP-ALSSTLTFVVQVEDVNDSPPRFELAVGSSFKTVPCTQPYVALDMT-ATDADSLPENTVINYRILSVKGPFGDSSNQRTESDKDVSLFYIQPDTGALFLHGQNGEVPANFDPCDHTGVYRLTITAFDPNRP 876          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A068Y764 (Protocadherin gamma b17 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000529700 PE=4 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 2.261e-62
Identity = 226/804 (28.11%), Postives = 372/804 (46.27%), Query Frame = 1
Query:  307 FLQTIRSIDREALCHASNNCDC-----------LKRKCVLELTIFASDLIQSNKP--PERIYKTICIEDINDNSPSF------PELTQT----IEINEKSPIGTELELHSAQDRDS-SDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYD---PIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEW-PNS--------------KYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPN-YLDYFTVFDNDEDANGKIECEILEWG---EYFNLKKSTANI-------PITYEIYLSQILD------------YEKQSMIALIIQCQDGGKP----NLTSKKRIAVNVIDVNDNRVYF---------PQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEY-AFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVS--YVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPF--FALTLSCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIK-PL-----------EFKSLFKIDKLTGTIAMTVK--ENDCNFKTNNKEKV-EIKVSVFDPTKPLFRGSTILQI 2424
            +L T++ IDRE LC     CDC           +   CVL L + A   I S K   P  I  TICI D NDNSPSF      P    +    +   E + IG    + +  D D+  +  +  Y + C E   ++ FS+     Y ++   +L +  +   ++D   P+ CT+TA+D   S SM+L + ++D+N+H P W P S              ++ + I E++   +++   +A+D D +YG+++YS+             G LF IDS TG+++L    D+E        V ++  DNG  S+       +   + N      +    I +V EN+  + Y+DY TV D D    G++EC  L+ G   ++F L +   N+       PI  E   S I              Y   + + + + C D         L+++  I V ++DVNDN   F             I ++I E +P G+ ++RI+  D D    + ++++   N   ++ID  +G +TT  +FDRE       F+V V +  + N + +  + + I D NDN PVF +    ++PE+  VD  +  +   D D GENGTV+  + Q  Q +N    FT+   G + L   LD ++   +++TI+A D+G P ++SS+ T+ + V D N+ PP+FE P   F  T+SC TQ+       +TD D  P+NT +NY + N+K P+           E  S F I+  TG +    +  E   +    N+  V  + +  FDP +P   G+  + +
Sbjct:  108 YLVTLQRIDRERLCQTEPGCDCRLGNSYPNRLGMGPDCVLPLRLVA---IPSKKVGLPLVIDLTICIADENDNSPSFRFSSSAPRFGASPVVSVHFKEDAQIGESTRIPAGYDSDAYPEHTVSSYSLNCPEK--DVPFSLV----YDISTAERLDLRVDKPLKFDGQWPLHCTVTAFDGKHSGSMQLKIYLDDVNNHKPVWEPPSILNSAITLINETSDEWALEISESVPPFTVLLQLKASDEDPMYGRLTYSMEG-------GKEGGLLFDIDSKTGEVRLVSKQDYEIIGNGAVTVPLLVADNGGLSIPGKLIFYLKDVNDNRPLIRFSGGEKIAEVVENSQSDVYIDYITVSDADSGVYGQVEC-YLKPGVISDHFQLTRIEDNLWVFQAVKPIDRESLASTIATTTITTSTQRNRLYAPGTRVGITVACNDNPGALKEYQLSAESTIQVTIVDVNDNPPQFIGLEKSTKNAVSIIDVAISEGVPPGTPVVRIAAEDPDVGDTLTYALLPFGNKK-LSIDPVSGLVTTQSVFDREDMPILTGFKVFVFDGGDANHSVSADLRVTILDQNDNSPVFHSQTVLTVPEDKPVDSLLHVINVTDADAGENGTVTLFFTQHQQPANP---FTLHPDGRLFLTRPLDRERHGHYELTIIAADKGIP-ALSSTFTLLVQVEDVNDSPPQFELPVGSFLKTVSC-TQSYVALDIAATDADSLPKNTVINYRILNVKGPIGDLAGQKGTTEEDNSPFYIEPDTGALLFHGQNSEMPTSVDPCNRTGVYRLTIMAFDPHRPELNGNATVTL 888          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: ENSAMXT00000016369.2 (pep primary_assembly:Astyanax_mexicanus-2.0:8:8904389:8910149:1 gene:ENSAMXG00000015901.2 transcript:ENSAMXT00000016369.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 194.126 bits (492), Expect = 9.693e-51
Identity = 175/636 (27.52%), Postives = 295/636 (46.38%), Query Frame = 1
Query:  280 IFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENI----------FNLSFSIFR---DKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPN-YLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRIST--IDLDKKSEVAFSIVHSS-----NCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF--------DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLD 2097
            +F ++ + G L     IDRE +C  S++C  +  K  LE             P E  Y T+ I DIND++P FPE  + +EI+E +  G   +L +A+D DS   ++  Y +  +E+             + F I +   D++    H++ L                L       S +M +IV V D+ND+ P +    Y +++ EN  + + +    ATDAD    G+V +S G  +  ++ +     LF +D +TG++ + G +DFE++ Q  Y + I A D  +  L++  +  I I D NDN P I +    + + EN+ P   +   +V D D   NGK+ C + E   +  ++ S  NI   Y +  +  LD EK S   + +  +D G P L+S K I V V DVNDN   F        +PEN   G  +  +S   +DLD+   +++ IV  +     + SF+NI+   G +   + FD E    Y F +   +    + +  V V + I D NDN PV          A     I  N +    + +VRA D D+G NG + +  + ++S+   +      G+IR         + +H++ I+ +D G  +S+S++ TV I +++
Sbjct:   68 LFRVNRNDGVLHVNGKIDREEVCERSSSC-LINLKIALE------------NPLEIHYITVEIVDINDHAPIFPEKEKRLEISENAVAGARFQLQAARDADSGVNSVQLYKLSQNEHFRIDIKDRGEDGKIPFLILQKPLDRETSSKHKIHL--------------TALDGGRPQKSGTMEIIVDVIDVNDNVPVFTKDAYSVKLSENAPIGTAVIQVNATDADEGTNGEVFFSFGHDVDSNLLR-----LFDLDPVTGEIVVKGPIDFEQKYQ--YEIDIQASDKASAPLTTEKSIFIQIVDVNDNAPEIEVTSLSVAIAENSKPGTTVALISVSDLDSGMNGKVSCSVPEDIPFSLMQSSQKNI---YSLTTTSSLDREKTSQYDITLTAKDAGHPPLSSIKTITVFVSDVNDNSPEFSLNPYTFYVPENNVPGMSMFSVSAHDLDLDENGVISYHIVRDTAEENKHLSFLNINPETGEIYALKRFDFENIKSYQFNIVASDSGTPSMSSNVTVNVFILDQNDNVPVILYPVSSNGSAEGVEEISRNVNAGHLVTKVRAYDADIGYNGWLLF-SLQEVSDHSLFGLDRYTGQIRTLRSFTETDEALHKLVILVKDNGN-VSLSATATVIIKIVE 664          

HSP 2 Score: 131.339 bits (329), Expect = 1.044e-30
Identity = 144/528 (27.27%), Postives = 236/528 (44.70%), Query Frame = 1
Query:  784 LIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDF---EERLQRE----YIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-PNYLDYFTVFDNDEDANGKIECEILEWGEYF--NLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCSFVNIDTNNGY-LTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNY----GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNL----FPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTI 2301
            + V++ DINDH+P +P  +  + I EN +  +      A DAD+    V           + K      F ID    D   +G + F   ++ L RE    + + + A D G P  S     ++D+ D NDN P+   +   + + EN P    +      D DE  NG++      +G     NL +     P+T EI +   +D+E++    + IQ  D     LT++K I + ++DVNDN       ++ ++I EN   G+ +  IS  DLD     +V+ S+      S +     N Y LTT    DRE   +Y   +   +  +   +    + + +SD+NDN P F  + Y+F +PEN      +  V A D DL ENG +SY  V   + +  + +  N     GEI      D +    +Q  IVA D G P SMSS+ TV + +LD N++ P    P  +   +   + I +N+      +  +    +     +LL +++ +   SLF +D+ TG I
Sbjct:  113 ITVEIVDINDHAPIFPEKEKRLEISENAVAGARFQLQAARDADSGVNSVQ----------LYKLSQNEHFRID--IKDRGEDGKIPFLILQKPLDRETSSKHKIHLTALDGGRPQKSGTMEIIVDVIDVNDNVPVFTKDAYSVKLSENAPIGTAVIQVNATDADEGTNGEV---FFSFGHDVDSNLLRLFDLDPVTGEIVVKGPIDFEQKYQYEIDIQASDKASAPLTTEKSIFIQIVDVNDNAPEIEVTSLSVAIAENSKPGTTVALISVSDLDSGMNGKVSCSVPEDIPFSLMQSSQKNIYSLTTTSSLDREKTSQYDITLTAKDAGHPPLSSIKTITVFVSDVNDNSPEFSLNPYTFYVPENNVPGMSMFSVSAHDLDLDENGVISYHIVRDTAEENKHLSFLNINPETGEIYALKRFDFENIKSYQFNIVASDSGTP-SMSSNVTVNVFILDQNDNVPVILYPVSSNGSAEGVEEISRNVNAGHLVTKVRAYDADIGYNGWLLFSLQEVSDHSLFGLDRYTGQI 624          

HSP 3 Score: 58.5362 bits (140), Expect = 3.561e-8
Identity = 73/282 (25.89%), Postives = 124/282 (43.97%), Query Frame = 1
Query: 1567 IDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNV-NFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQIS-NQRFYFTVSNYGE------IRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLS----CQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVS 2373
            ID     E  F IV ++      ++ N+G L  N   DRE   E +    +  K  + N  +   + + I DIND+ P+F +      I EN           A D D G N     VQ+ ++S N+ F   + + GE      + L   LD +  + H++ + A D GRP   S +  + + V+D N++ P F K  +++ LS      T  I  N   +TD D+   N ++ +   +        LF +D +TG I   V +   +F+   + +++I+ S
Sbjct:   48 IDQRTLKERGFRIVSTTGEPLFRVNRNDGVLHVNGKIDREEVCERSSSCLINLKIALENPLEIHYITVEIVDINDHAPIFPEKEKRLEISENAVAGARFQLQAARDADSGVNS----VQLYKLSQNEHFRIDIKDRGEDGKIPFLILQKPLDRETSSKHKIHLTALDGGRP-QKSGTMEIIVDVIDVNDNVPVFTKDAYSVKLSENAPIGTAVIQVN---ATDADEG-TNGEVFFSFGHDVDSNLLRLFDLDPVTGEI---VVKGPIDFEQKYQYEIDIQAS 317          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: ENSAMXT00000047131.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:10724525:10735555:1 gene:ENSAMXG00000031113.1 transcript:ENSAMXT00000047131.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.282 bits (495), Expect = 1.326e-50
Identity = 184/645 (28.53%), Postives = 318/645 (49.30%), Query Frame = 1
Query:  220 NLNL-TRGKNLKKYELIQHYN--IFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKT-ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISF-RYDPIQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSI---GRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENT-PPNYLDYFTVFDNDEDANGKIECEILEWGEY-FNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSN-----CSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFS-------IPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSS 2070
            +LN+ T   + ++++++   N   F ++  TG L     IDRE +C +++       KC+L +   A +       P  +Y+  I + D+NDNSP FP  T  + I+E + IG    L  A+D D     +  Y +  +E+    S  +  DKQ   +   +L++ + +   ++  I  TLTA D      S ++ +++ V D+ND+SP +    Y  ++KEN+ L + I +  A+D D  +   + YS    G+ + +D        LFTI++ +GD+ +NG +D+EE    E  + + AKD G+P  S+    ++++ D NDN P I +   +  V+E+T P   +    V D D   NG +   +L  G + F L+ S  N    Y + ++  LD E  S   + +   D G P L+S   I V++ DVNDN  +F    I   + EN  +G ++I++S  DLD  + +EV++S++ +S+      + +NI+T NG + + + F+ ET     F+VQ  +      +    V + I D NDN PV  A YS +       IP +     F+ ++RA+D D G N  +SY  + +      +   S+ GEIR    +  +    H + +   D G P S+S++
Sbjct:   45 DLNIPTEDLDARQFQIVSGSNKRYFEVNRKTGALFVSERIDREEICSSND-------KCILNIEALAQN-------PHNLYRIEIRVLDVNDNSPHFPVDTFKLSISEHASIGERFPLPVAEDNDIGSNGLKDYKLTNNEH---FSVDVQSDKQ---SVYAELVLQKALDREKHSLISLTLTAVDGGKPPKSGTLNIVIDVMDVNDNSPVFSMPLYKAKVKENVSLGTKILSVSASDLDQGINSDIVYSFLGHGKSIYKD--------LFTINAESGDIVVNGRIDYEENQAIE--LRVQAKDKGSPPQSTHCKVLLEVLDENDNAPDIVMTPLMDSVKEDTKPATAVALVAVSDRDGGKNGIVH--VLIKGSFPFKLELSYKN---HYSLVVNGPLDREILSQYNIPLIATDEGVPPLSSSSVINVHISDVNDNAPHFSANIITAYLKENSQVGGQLIKVSADDLDLGENAEVSYSLLDTSSDVGPISTMININTRNGEIYSMQSFNYETTKRLQFQVQATDSGTPPLSSNATVNVFILDENDNSPVILAPYSEAGSVNTENIPYSAEAGYFVAKIRAVDADSGYNALLSY-HITEPKGNNLFRVGSSSGEIRTKRRMSDNDLKTHPLVLTVCDHGEP-SLSAT 652          

HSP 2 Score: 107.842 bits (268), Expect = 3.004e-23
Identity = 103/407 (25.31%), Postives = 191/407 (46.93%), Query Frame = 1
Query: 1243 DNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCSF---VNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKP-VFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPSTDKDKSPENTKMNY-LLD---NIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIILE 2433
            DND  +NG  + + L   E+F++   +    +  E+ L + LD EK S+I+L +   DGGKP  +    I ++V+DVNDN   F     +  + EN+ +G++I+ +S  DLD+   S++ +S +      +     I+  +G +  N   D E        VQ  +K +   +   KV+L + D NDN P +       S+ E+T     +  V   D D G+NG V +V +      +   +  N+  + +   LD +  + + + ++A D+G P  +SSS+ + + + D N++ P F        L   +Q   + +  S D     EN +++Y LLD   ++ P+   ++  I+   G I         N++T  + + +++ +    T PL   +T+   IL+
Sbjct:  153 DNDIGSNGLKDYK-LTNNEHFSVDVQSDKQSVYAELVLQKALDREKHSLISLTLTAVDGGKPPKSGTLNIVIDVMDVNDNSPVFSMPLYKAKVKENVSLGTKILSVSASDLDQGINSDIVYSFLGHGKSIYKDLFTINAESGDIVVNGRIDYEENQAIELRVQAKDKGSPPQSTHCKVLLEVLDENDNAPDIVMTPLMDSVKEDTKPATAVALVAVSDRDGGKNGIV-HVLIKGSFPFKLELSYKNHYSLVVNGPLDREILSQYNIPLIATDEGVP-PLSSSSVINVHISDVNDNAPHFSANIITAYLKENSQVGGQLIKVSADDLDLGENAEVSYSLLDTSSDVGPI--STMININTRNGEI---YSMQSFNYETTKRLQFQVQAT-DSGTPPLSSNATVNVFILD 550          

HSP 3 Score: 95.9005 bits (237), Expect = 1.242e-19
Identity = 121/468 (25.85%), Postives = 206/468 (44.02%), Query Frame = 1
Query:  781 RLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQRE----YIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-PNYLDYFTVFDNDEDANGKIECEILEWG-----EYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDK-KSEVAFSIVHSSNCSFVNIDTNNGY-LTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHY-SFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNY----GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPF 2133
            R+ ++V D+ND+SP +P   + + I E+  +        A D D         IG   ++D  K  +   F++D  +    +   L  ++ L RE      +T+ A D G P  S     VID+ D NDN P+ ++      V+EN      +   +  D D+  N  I    L  G     + F +   + +I +   I      DYE+   I L +Q +D G P  ++  ++ + V+D NDN        +  S+ E+    + +  ++  D D  K+ +   ++  S    + +   N Y L  N   DRE   +Y   +   ++     + +  + + ISD+NDN P F A+  +  + EN+ V G + +V A D DLGEN  VSY  ++  S+     T+ N     GEI      + +     Q  + A D G P  +SS+ TV + +LD N++ P    P+
Sbjct:  112 RIEIRVLDVNDNSPHFPVDTFKLSISEHASIGERFPLPVAEDND---------IGSNGLKDY-KLTNNEHFSVDVQSDKQSVYAELVLQKALDREKHSLISLTLTAVDGGKPPKSGTLNIVIDVMDVNDNSPVFSMPLYKAKVKENVSLGTKILSVSASDLDQGINSDIVYSFLGHGKSIYKDLFTINAESGDIVVNGRI------DYEENQAIELRVQAKDKGSPPQSTHCKVLLEVLDENDNAPDIVMTPLMDSVKEDTKPATAVALVAVSDRDGGKNGIVHVLIKGSFPFKLELSYKNHYSLVVNGPLDREILSQYNIPLIATDEGVPPLSSSSVINVHISDVNDNAPHFSANIITAYLKENSQVGGQLIKVSADDLDLGENAEVSYSLLDTSSDVGPISTMININTRNGEIYSMQSFNYETTKRLQFQVQATDSGTP-PLSSNATVNVFILDENDNSPVILAPY 562          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh2ab5 (protocadherin 2 alpha b 5 [Source:ZFIN;Acc:ZDB-GENE-041118-4])

HSP 1 Score: 193.741 bits (491), Expect = 1.830e-50
Identity = 192/680 (28.24%), Postives = 320/680 (47.06%), Query Frame = 1
Query:  184 EIKELDIYQMGINLNLTRGKNLKKYELIQHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKT-ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPI-QCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGK-VSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPN-YLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSN--CSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYS-------FSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNN-------HPPEFEKPFFALTL 2148
            +IKEL++    I   +T  K  +KY        F ++  TGFL     IDRE +C  +  C      C+                P ++Y+  I + D+NDN+P+F E + T++I E +  G  L L  A D D     +  Y  K S N +   FS+   K  + +    L++ + +     P+   TLTA D  S   S +  ++V V DIND++P +    Y   + EN+   + +    ATD D    + + YSI +   RD  +     +F IDS TG + + G ++FEE     + +   A D G P L++    ++++ D NDN P + +   +  V+E+  P   L   +V D D   NG ++C I+     F L+ +  N    Y + ++  LD EK S   + +   D G P L+S   I V+V DVNDN    P+  I++ + EN  IGS I  +S  D D    +++ +S++  S    S VNI++++G + + + F+ E  + + F+VQ  +      +  V V + I D NDN P   A YS        +IP +     F+ ++RA+D D G N  +SY Q+++      +   S+ GE+R    +  +    H + I+  D G P S+S++ ++ + V+++         H P  E+ F  L L
Sbjct:   46 DIKELELRMFQI---VTGSK--RKY--------FEVNLKTGFLYVNEKIDREDICSKTLKCTVSVEACI--------------NNPLKLYRIEINVMDVNDNAPTFSEKSLTLDIAENALPGLRLTLPHATDLDVGKNTVSTY--KLSPNDY---FSLATTKGAEHSVSADLVLQKALDREKQPVTHLTLTAVDGGSPPKSGTSLIVVNVLDINDNAPVFSRPLYKTTVSENVHAGTTVVVLNATDIDEGMNREIRYSIIK---RDQDEIL--EIFDIDSKTGVITVKGKINFEE--HNAFEIRAQASDKGQPPLAAHCKVLVEVLDLNDNAPELTVTSLLPSVKEDAKPGTALALVSVTDGDGGTNGDVDC-IVSNKTPFKLETNYKNY---YSLIVNGPLDREKHSQYNVTLIATDKGTPPLSSSVVITVHVSDVNDNAPRLPETVIKVYVKENSQIGSVIYTVSAFDPDVGDNAKITYSLMEYSTPISSLVNINSDSGDIHSLQSFNYEEMNAFHFKVQATDSGVPPLSSNVSVNVFILDENDNSPGILAPYSEQGSVNTENIPYSAEAGYFVAKIRAVDADSGYNALLSY-QISEPKGNNLFRIGSSSGEVRTKRRMSDNDLKTHPLIILVSDNGEP-SLSATVSIDVVVVENTGDIQTKFKHVPLKEESFSDLNL 680          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: ENSAMXT00000033326.1 (pep primary_assembly:Astyanax_mexicanus-2.0:8:9197095:9223080:1 gene:ENSAMXG00000016031.2 transcript:ENSAMXT00000033326.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 194.512 bits (493), Expect = 2.293e-50
Identity = 179/657 (27.25%), Postives = 303/657 (46.12%), Query Frame = 1
Query:  250 KKYELIQHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKT-ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFR-YDPIQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSL-SSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRIST--IDLDKKSEVAFSI----VHSSNC-SFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-------DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHML-----DIDKQNIHQVTIVARDQGRPISMSSSTTVFITVL---DSNNHPPEFEKPF 2133
            +K  +I     F I+ ++G L     IDRE +C +S         C L L I   D       P  I++  + I D+NDN+P FP    ++EI+E +  GT   L SA+D D    ++  Y +  S+      FS+  + +   +   +L++ + +     D  +  LTA D      S +  L++K+ D+ND++P +  S   + + EN  + +I+    ATDAD+ + G+V++  G+     I      NLF++DS TG++++ G +D+E+     Y +T  A+D GTP++  S    V   +  ++ P +   +      E+      +   +  D D D NG++  ++   G  F LK +       Y +     LD E      +++   D G P L+S+K   V++ DVNDN   F Q +  + IPEN   G+ I+ +S    DL   + + +SI    +H S   S+V I+  NG + T    D E  + +  EVQV +      +  V V + + D NDN PV        D+    ++P +  V   + ++   D D G N  + Y       +  F+   +N GE+R    L     D  +++ +   +V +D G+P   S ST+V ITV     S +  P+  KPF
Sbjct:   66 RKVRIISDSEYFEINAASGALVIREIIDRERMCESS-------AACYLHLQIVLQD-------PLEIHRVRVDILDVNDNAPQFPARNSSLEISEAAAPGTRFRLESARDPDVGVNSLRTYQLAPSD-----CFSLRVETKSDGSKFPELVLEKALDRETQDSFRLLLTAVDGGQPEKSGTTLLLIKILDVNDNAPVFDQSVKRVSLLENSPVGTIVAKLNATDADSGMNGEVTFLFGKYTPNRI-----HNLFSVDSKTGEIRVTGEVDYEQ--TSVYDITFEARDGGTPAMEGSCNVKVEITDVNDNTPEVTLTSLSSPISEDAKTGTVIALISAKDLDSDKNGQLTLKV-SPGLPFKLKSAFGE---HYTLVTDGRLDRETVPEYTVVVTATDAGTPPLSSQKTFVVSLSDVNDNAPLFSQSSYSVDIPENNSPGTPIVAVSASDPDLGDNARLTYSILASTIHGSPVSSYVYINPENGNIFTMRSIDYEQMNAFKIEVQVHDAGTPPHSSNVTVHVFVIDQNDNSPVILYPAHSDDSGLQLTVPRSAPVGHLVNKIVGFDPDSGHNAWLFYSITGD--DAAFFRIGANTGELRTTRKLADEDQDGRERSAYSFVVVVQDNGQP---SKSTSVPITVSVEEKSIDAVPDSHKPF 687          

HSP 2 Score: 84.7297 bits (208), Expect = 4.039e-16
Identity = 71/279 (25.45%), Postives = 126/279 (45.16%), Query Frame = 1
Query: 1345 EIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSI-------VHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKP-VFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGE-IRLFHMLDIDKQNIHQVTIV--ARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFAL 2142
            E+ L + LD E Q    L++   DGG+P  +    + + ++DVNDN   F Q   R+S+ EN P+G+ + +++  D D     EV F         +H    +  ++D+  G +      D E    Y    +  +        +  V + I+D+NDN P V     S  I E+      I  + A D D  +NG ++     ++S    +   S +GE   L     +D++ + + T+V  A D G P  +SS  T  +++ D N++ P F +  +++
Sbjct:  195 ELVLEKALDRETQDSFRLLLTAVDGGQPEKSGTTLLLIKILDVNDNAPVFDQSVKRVSLLENSPVGTIVAKLNATDADSGMNGEVTFLFGKYTPNRIH----NLFSVDSKTGEIRVTGEVDYEQTSVYDITFEARDGGTPAMEGSCNVKVEITDVNDNTPEVTLTSLSSPISEDAKTGTVIALISAKDLDSDKNGQLTL----KVSPGLPFKLKSAFGEHYTLVTDGRLDRETVPEYTVVVTATDAGTP-PLSSQKTFVVSLSDVNDNAPLFSQSSYSV 464          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: ENSAMXT00000037053.1 (pep primary_assembly:Astyanax_mexicanus-2.0:8:9197095:9222047:1 gene:ENSAMXG00000016031.2 transcript:ENSAMXT00000037053.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 193.741 bits (491), Expect = 2.558e-50
Identity = 179/657 (27.25%), Postives = 303/657 (46.12%), Query Frame = 1
Query:  250 KKYELIQHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKT-ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFR-YDPIQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSL-SSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTI--DLDKKSEVAFSI----VHSSNC-SFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-------DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHML-----DIDKQNIHQVTIVARDQGRPISMSSSTTVFITVL---DSNNHPPEFEKPF 2133
            +K  +I     F I+ ++G L     IDRE +C +S         C L L I   D       P  I++  + I D+NDN+P FP    ++EI+E +  GT   L SA+D D    ++  Y +  S+      FS+  + +   +   +L++ + +     D  +  LTA D      S +  L++K+ D+ND++P +  S   + + EN  + +I+    ATDAD+ + G+V++  G+     I      NLF++DS TG++++ G +D+E+     Y +T  A+D GTP++  S    V   +  ++ P +   +      E+      +   +  D D D NG++  ++   G  F LK +       Y +     LD E      +++   D G P L+S+K   V++ DVNDN   F Q +  + IPEN   G+ I+ +S    DL   + + +SI    +H S   S+V I+  NG + T    D E  + +  EVQV +      +  V V + + D NDN PV        D+    ++P +  V   + ++   D D G N  + Y       +  F+   +N GE+R    L     D  +++ +   +V +D G+P   S ST+V ITV     S +  P+  KPF
Sbjct:   66 RKVRIISDSEYFEINAASGALVIREIIDRERMCESS-------AACYLHLQIVLQD-------PLEIHRVRVDILDVNDNAPQFPARNSSLEISEAAAPGTRFRLESARDPDVGVNSLRTYQLAPSD-----CFSLRVETKSDGSKFPELVLEKALDRETQDSFRLLLTAVDGGQPEKSGTTLLLIKILDVNDNAPVFDQSVKRVSLLENSPVGTIVAKLNATDADSGMNGEVTFLFGKYTPNRI-----HNLFSVDSKTGEIRVTGEVDYEQ--TSVYDITFEARDGGTPAMEGSCNVKVEITDVNDNTPEVTLTSLSSPISEDAKTGTVIALISAKDLDSDKNGQLTLKV-SPGLPFKLKSAFGE---HYTLVTDGRLDRETVPEYTVVVTATDAGTPPLSSQKTFVVSLSDVNDNAPLFSQSSYSVDIPENNSPGTPIVAVSASDPDLGDNARLTYSILASTIHGSPVSSYVYINPENGNIFTMRSIDYEQMNAFKIEVQVHDAGTPPHSSNVTVHVFVIDQNDNSPVILYPAHSDDSGLQLTVPRSAPVGHLVNKIVGFDPDSGHNAWLFYSITGD--DAAFFRIGANTGELRTTRKLADEDQDGRERSAYSFVVVVQDNGQP---SKSTSVPITVSVEEKSIDAVPDSHKPF 687          

HSP 2 Score: 84.7297 bits (208), Expect = 3.176e-16
Identity = 71/279 (25.45%), Postives = 126/279 (45.16%), Query Frame = 1
Query: 1345 EIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSI-------VHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKP-VFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGE-IRLFHMLDIDKQNIHQVTIV--ARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFAL 2142
            E+ L + LD E Q    L++   DGG+P  +    + + ++DVNDN   F Q   R+S+ EN P+G+ + +++  D D     EV F         +H    +  ++D+  G +      D E    Y    +  +        +  V + I+D+NDN P V     S  I E+      I  + A D D  +NG ++     ++S    +   S +GE   L     +D++ + + T+V  A D G P  +SS  T  +++ D N++ P F +  +++
Sbjct:  195 ELVLEKALDRETQDSFRLLLTAVDGGQPEKSGTTLLLIKILDVNDNAPVFDQSVKRVSLLENSPVGTIVAKLNATDADSGMNGEVTFLFGKYTPNRIH----NLFSVDSKTGEIRVTGEVDYEQTSVYDITFEARDGGTPAMEGSCNVKVEITDVNDNTPEVTLTSLSSPISEDAKTGTVIALISAKDLDSDKNGQLTL----KVSPGLPFKLKSAFGEHYTLVTDGRLDRETVPEYTVVVTATDAGTP-PLSSQKTFVVSLSDVNDNAPLFSQSSYSV 464          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 179.489 bits (454), Expect = 2.665e-46
Identity = 194/740 (26.22%), Postives = 322/740 (43.51%), Query Frame = 1
Query:  196 LDIYQMGINLNLTRGKNLKKYELIQHYNIFAIHPSTG-FLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPI-QCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVY-GKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNG---------------TPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTI--DLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPST------------DKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAM 2307
            +D+     NL LT    L K E      +  ++P TG      R +DREALC   +  D    +C +++ +     +Q     + I   I +EDINDN+P+F     T+ + E +P G    +  A D DS    + +Y++  S+     +F +   +         L+V +++      + +  L A D  S   S S  L + V D ND+SP +  ++  + I EN  + + +    A+D D     +V Y +G              LF +D  +G + +NG L+ EE     Y + I+A D G                 + +SPT  + DI    +    I+    +     N P   +   TV D D  ANG + C I      F LKK T   P  Y +   + LDYE ++   + I+  D G  +L+    + + ++D NDN   F + T ++S+PEN  IG  +I +S    D+DK +E+ + +   +   F ++D   G ++  E  DRE K  Y+F +   ++          VI+ + D+NDN+P F  A + F + EN      +G V   D+D GENG V  + +    N++ +      G IR     D ++++ + + + A D G P+  SS+  V I V+D N++ P        + L   + T  K + P T            D D    N ++ Y +    P    +LF ID + G I +
Sbjct:   58 VDLRLADYNLELTYKVMLSKAEDAAP-PLVRVNPRTGELFAAGRKMDREALCGGQDPGD----ECHVDVQVGVLP-VQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREE--SPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHV-----NLP---VALITVSDPDIGANGAVTCYIYNPEVPFQLKKLT--YPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMF-HMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVR-LSILGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVR-SSTVKVVIHVMDINDNSP--------IVLMPPSNTTYKFVVPRTLPGTIVTEVSAVDNDAE-INAELRYHIVGGNP---HNLFHIDPVIGNITL 764          

HSP 2 Score: 105.916 bits (263), Expect = 2.127e-23
Identity = 107/364 (29.40%), Postives = 160/364 (43.96%), Query Frame = 1
Query: 1036 LDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEEN-TPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANI----PITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-----DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITV 2091
            LD+E +   EY+V I A D G  SLS   +  I + D NDN P+       + V EN     +L   +  D D D N ++         YF L      +    P T  I L++ LD EK++  +  I  +D G P L     + VNV+DVNDNR  F        + EN+P  S +  ++  D D+     V  SI+ + N    +ID  +G + +N  FDRE +  Y  EVQ  +      + TVKV++ + DINDN P+      +  Y F +P  T     +  V A+DND   N  + Y  V    +  F+      G I L   L      +H++ +   D G  +   +   V + V
Sbjct:  451 LDYETK--NEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMV--------YF-LGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPR-TLPGTIVTEVSAVDNDAEINAELRYHIVGGNPHNLFHID-PVIGNITLMEPLTETHHGLHRLVVRVSDIGIAVQHHAVALVHVFV 801          

HSP 3 Score: 101.293 bits (251), Expect = 6.545e-22
Identity = 104/386 (26.94%), Postives = 175/386 (45.34%), Query Frame = 1
Query: 1243 DNDEDANGKIECEILEWG----EYFNLKKS-TANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKS--EVAFSIVHSSNCS--------FVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKD------------NVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVS-YVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLF--PSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMT 2310
            D D +ANG    E+L         F L  + TAN      + + + LD E++ +  + ++  DGG P  +    + +NV D NDN   F Q  + + IPEN P+G+ ++++   D D  S  EV + +  S+  +           +D N+G +T N + +RE    Y   +   +K              V   +     + I DI    PV    Y   I E + V+  +  +   D D+G NG V+ Y+   ++  Q    T  N   +     LD + +N + V I A D G   S+S + +V I +LDSN++ P F +P + +++  +   I K+L    +TD+D   +N +M Y L    P    ++F +D  TG I++T
Sbjct:  179 DPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDI--VAPVNGVIY---ISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGA-TSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVP-ENNVIGKHLITVSATDRDMD-KNAEMVYFLGPDAP----TMFHMDPETGIISLT 552          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 150.214 bits (378), Expect = 3.432e-37
Identity = 163/650 (25.08%), Postives = 283/650 (43.54%), Query Frame = 1
Query:  250 KKYELIQH--YNIFAIHPSTGFLQTIRSIDREALCHASNNC----DCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLN---SSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXX------XXXXXXXXXVEENTP-PNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPIT--YEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHS-----SNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF------DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNI----HQVTIVARDQGRPISMSSSTTVFITV 2091
            + + L++   +++  +  + G +     IDRE  C  + +C    D L   C L   +F           + ++  + + DIND++P F      +EI+E   +GT + L  A+D D    A+  Y +  +E  F L+     D        VK  + R     Y      LTAWD      S +  + + V D ND+SP +  +   + ++E+    +++ T  ATD D    G+V YS    +  ++ +     LF +D  TG + L G LD E  L  EY ++I A+D G  S+ +    ++ +ED NDN P       +      + V E     +++   TV D D   NG + C  L    +F L      +P    Y +  +  LD E+ +   L+++  DGG P   + ++  V ++D NDN   F + T   S+ EN   G+ +  ++  D D +    +A+++V S     S  ++V+I+ ++G +      D E      F+VQ  +           V +RI D NDN PV       +      +P +  +   +  VRA D+D   NG +SY  V    N+R  F ++  G     +   +         H + ++ RD+G P ++S++  + I V
Sbjct:   62 RHFRLMRRDDFSLVHVEEADGTVSAREVIDREQQCGQAPSCVIRFDVL---CTLPRGLF-----------QLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENER-FGLALRARTDGAKYAELVVKSRLDREQEGEY---TLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRR-----LFQLDPKTGKLSLKGQLDHE--LNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACH-LRGHPHFKL------LPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQ--GNERNLFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSP-ALSATAAIEIRV 676          

HSP 2 Score: 87.4261 bits (215), Expect = 1.123e-17
Identity = 130/533 (24.39%), Postives = 220/533 (41.28%), Query Frame = 1
Query:  790 VKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLF--TIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEEN-TPPNYLDYFTVFDNDEDANGKIECEI-----LEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNR------VYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGY-LTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNY-------GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNL------FPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTI 2301
            V++ DINDH+P++  S+ ++ I E++ L + +    A D D     V  +  R    D  + F   L   T  +   ++ +   LD E+  + EY + + A D G P  S  T   I + D NDN P+       + V E+ TP   L      D DE  NG++          E    F L       P T ++ L   LD+E  S   + IQ +D G  ++ +  ++ V+V D+NDN            +   + + E     S +  ++  D+D       +     +  F  +   + Y + TN   DRE   +Y   ++  +          +  +R+ D NDN+P F  + Y  S+ EN S   ++  V A D D   NG ++Y   N + ++    +VS Y       G I     LD +        + ARD G P  + ++ TV + ++D N++ P    P             D  L        + D D S  N +++Y    I     ++LF+I++L G +
Sbjct:  124 VELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLD-----VGGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQ--EGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLD------PKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAY---NVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVP-PLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSD-SEANGELSY---RIVQGNERNLFRINRLGGEV 635          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.214 bits (378), Expect = 8.881e-37
Identity = 138/534 (25.84%), Postives = 245/534 (45.88%), Query Frame = 1
Query:  790 VKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGK-VSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPN----YLDYFTVFDNDEDAN--GKIECEIL-----EWGE-YFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDN---VNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVN-------QISNQRFYFTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNL-FPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMT 2310
            + V D+ND+ P +   +  + ++EN     +I T  ATDAD      V+YS+          + S   F +D+ +G ++ +  LD EER    Y++T+ A D    + +  + AV D  D +        +     V E+  P+         TV   D D+   G++   +      +W +  F L       P+T  + +++ LD E ++   L  +  DGG   L +  R+ VNV+D NDN       ++   +PE+ P G+ ++RIS  D D+   +E+ FSI          +  N+G L+     DRE +  Y   V+V ++        +  V+V L ++D+NDN P F +  S   PE++ V   +  V+A+D D G N  V Y                   F ++   GE+RL   LD + +  + +T++A D+GRP  ++S+ T+ +TV D+N++ P F +  +   ++       + L   + D D+   N ++ Y + +  P      F++D + GT+A+ 
Sbjct: 1504 ISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSV---------LSGSEGAFVVDAASGVLRASRRLDREERAS--YLLTVRASDGTHATDARLSVAVRDANDNSPRFSRHAYSFD---VAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLH------PVTGALNVTRPLDRESRACYVLRARATDGG--GLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVG-NDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRP-PLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEG-ANGELRYDIASGDP---TGDFRLDPVLGTLAVA 2009          

HSP 2 Score: 149.058 bits (375), Expect = 2.102e-36
Identity = 190/721 (26.35%), Postives = 310/721 (43.00%), Query Frame = 1
Query:  283 FAIH----PSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKT---ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSF---SIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVY-GKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-PNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQG-RPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDK--NLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIA-MTVKENDCNFKTNNKEKVEIKVSVFDPTKP 2394
            F +H    P    L+    +DRE             R  +  LTI ASD   + KP  R       + + D+ND++P F        ++E +P G+ ++  +A D DS   A ++Y +    ++   S    +       K++ +V   V  NIS +    Q   TA+         L V + D+ND  P +  +KY     EN L    + +  A D+D    G V Y+       D+P  +   +F +DS+TG +    +LD EE    EY + + A+D G+P L S     + + D NDN P+    +    + EN P    +   T  D D  ANG +  + L  G+    + +     +T  +     LD E++++  L +   DGG     S   + + V D  D    F +      + EN+  G+ +  +S   LD  + V + IV        +I+ + G + T    DRE +  Y   V V     V    +V V+  + D+N++ PVFD A Y  SI E+  V+     VRA D D G+NG V Y ++ +  N    F +   G++ + + LD + +  + +T+ A D G  P  +SSS TV +TVLD N++ P F    +     C+ Q +        +TD D    N  + Y  +  KP   +  F++D  TG IA + V + +   +          V   D  +P
Sbjct:  279 FVLHAPGVPGLRVLKVASQLDRE-------------RIPMYNLTILASD---NGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPK-TAY-------TSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFD----PDMPAQYR-EMFRLDSLTGKVTTLKSLDREE--LEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQ-LTAGDAARFQVNA----VTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYLIVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRV-VANSGGVAGEASVSVL--VHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKY-EIGE-GNGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEP--LSSSVTVNVTVLDVNDNKPLFNSSSYVFHF-CEEQEVGSLVGAVQATDADAG-SNGGVTYSFE--KP---QVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRP 949          

HSP 3 Score: 141.354 bits (355), Expect = 4.825e-34
Identity = 170/685 (24.82%), Postives = 291/685 (42.48%), Query Frame = 1
Query:  460 ICIEDINDNSPSFPE-LTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSY--------SIGRIMVRDIPKTFSGNL-FTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXX-----XXXXXXXVEENTPPNYLDYF-TVFDNDE-DANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKP-NLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSY-VQVNQISNQRFYFTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSN-NHPPEFEKPFFALTLSCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIILENER 2442
            + + D+NDN+PSFPE     +   E + +G ++ L +A DRD     +  +  K                    N + +L+  R ++ R      T    D  ++ S  L V+  D    SP     + Y R++ N+ +        A D    + K +Y         +G  + RD+     G L    D  TG +     LDFE R  R+Y +++ A D G P LS   TAVI + D NDN P I             V+E+  P  +    TV D D   ANG++   I+   E  +       +P    + ++  LD E+  M  L I   D GKP   ++   + V V DVND+   F       ++ E  P GS +  ++ +D D    +++ +SIV  ++  + ++D + G +TT+   DRE        +   ++     T    + + + D+ND  P+F    Y  +  EN+    F+  V A D+DLGENGTV Y    +  +  R  F + +  G++     LD ++   + + + A+D+G P  + S+  V + V D N NHP  +   +FA  L  +          +TD D+   N  + Y L         + F+++ +TG ++  V     +     +   +++V+  D      R   I+ I + + +
Sbjct:   11 VVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSG----------------NEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAED--GGSP-----RRYGRLQVNVTVQ------DANDNPPAFEKPAYRASVAEDSPVGAAL-RDLLHRGRGPLAVPFDPKTGMVSTRQPLDFEAR--RQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSP-PLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRG-ANGTVRYQLTAGD----AARFQVNAVTGAVSTRV-----SLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQ 652          

HSP 4 Score: 137.502 bits (345), Expect = 7.228e-33
Identity = 146/582 (25.09%), Postives = 257/582 (44.16%), Query Frame = 1
Query:  460 ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYD-MKCSENIF--NLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLD-----SIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNY-LDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGK---PNLTSKKRIAVNVIDVNDNRVYF--PQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIV---------HSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFE 2124
            I +ED+NDN P F      +E+ E +  G  +   SA D D    A++ Y  +  SE  F  + +  + R  + +L+ + +       S+       T+ A D   ++  RL V V D ND+SP +    Y   + E+   D     ++I T  A DAD+  +G+V+Y++      D    ++   F +  +TG + +   LD E R    Y++   A D G   L++     +++ D NDN P +  +    +V E+ PP   L   +  D+DE  N ++E  I                    ++ +++ LD E+QS   L+++  D  +     L+S  R+++ + DVNDN   F  P+  +    PE+ P+G+ +  +  +D D  + S V +++            +      ++T  G +      DRE +  YA  V  V+K     T T  + + + D NDN P F    Y  +I E+      + R+ A D D G NG + Y   +      F       G + +   LD ++   +++ + ARD G P + S + +V +T+ D N+  P F+
Sbjct: 1504 ISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGVLRASR-RLDREER------ASY-----LLTVRASDGTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSD----WADGAFGLHPVTGALNVTRPLDRESRAC--YVLRARATDGG--GLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDG-----QLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSAL---APEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLD-PVLGTLAVARPLDRERTASYELAVRARDGGGP-ARSDTASVRVTLSDVNDCSPAFQ 2055          

HSP 5 Score: 136.346 bits (342), Expect = 1.528e-32
Identity = 184/753 (24.44%), Postives = 325/753 (43.16%), Query Frame = 1
Query:  295 PSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPP--ERIYKTICIEDINDNSPS-----FPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISF-------RYDPIQCTLTAWD----LNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGN---LFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGT-PSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEI-----LEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNR-VYFPQKTIRISIPENIPIGSEIIRISTIDLDKKS--EVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDA-HYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVS-NYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFP--STDKDKSPENTKMNYLLDNIKPLEFKSLF---------KIDKLTG-TIAMTVKENDCNFKTNNKEKVEIKVSVFD--PTKPLFRGST 2412
            P TG + T + +D EA           +R+  L L   A+D      PP   R    I + D+NDN P+      P   ++  ++E +  GT   L +  D DS            +    ++S     ++ + + H   +   R +         R      T+ A D    +  S++  L+V VND+NDH+P +  S Y   + E     S +    A DAD+ +  K+ YSI            SGN    F++D  TG +  +G +D E  +    ++ I A+D G  P  +  +  V  ++  ++ P           VE + P  ++   +  D+D   NG +          ++ E F L        +T ++   + LD E+     L++Q QD G P L S  ++ V V D+NDN  V++P +    SI EN P G+ +  ++  D D+ +   V + +       F  ++   G ++T    DRE +  Y  +V  ++  ++       V + ++D  D  P F    YSF + EN +    +G V A   DL  N  V+Y+ V+   +QR  F++  + G I   + +D ++Q  +Q+ +VA   G    ++   +V + V D NNH P F++  + +++  + + ++   F   +TDKD S +N ++ Y +      E   +F         ++D+ T    ++TV   D   +  +   V + V+V D    KPLF  S+
Sbjct:  172 PKTGMVSTRQPLDFEA-----------RRQYTLSLR--AAD---GGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADS----------PTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSI-----------VSGNDLGWFSVDESTGLVTTDGKVDRE--VASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDS------LTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYF-ASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARF-QVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDL--NANVTYLIVS--GDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGG----VAGEASVSVLVHDVNNHAPVFDRASYEVSI-AEDEPVNSRFFSVRATDKD-SGKNGEVKYEIGEGNGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSS-SVTVNVTVLDVNDNKPLFNSSS 866          

HSP 6 Score: 132.494 bits (332), Expect = 2.508e-31
Identity = 167/641 (26.05%), Postives = 258/641 (40.25%), Query Frame = 1
Query:  235 RGKN-LKKYELIQHY-NIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINE---------KSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQV--KLIVTRNISFRYDPIQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSI------GRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPN-YLDYFTVFDNDEDANGKIECEIL-----------EWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKS--EVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDG-FIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARD 2040
            +G+N L  Y ++      F +  ++G L+  R +DRE            +R   L LT+ ASD   +     R+  ++ + D NDNSP F     + ++ E         ++ IGT L    A D DS  F  + Y +  SE+      S + D  + L H V   L VTR +  R       L A   +    +++ RL V V D ND++P   N      + E+    + +    ATD D  V  ++ +SI      GR  V        GN        G + +   LD E +     +V +  +    P+  S    V  I    ++      +       E++P    +      D D   N  +E  +                 F L        +T E+ L + LD E +   AL +   D G+P LTS   +AV V D NDN   FP++    +I E+ P G+E++R+S  D D+ +  E+ + I          +D   G L      DRE    Y   V+  +      +DT  V + +SD+ND  P F  + Y+    ENT      I +V A D+DLG +G V+Y            F+VS  G + L   LD + Q  H + I A D
Sbjct: 1545 QGQNALVTYSVLSGSEGAFVVDAASGVLRASRRLDRE------------ERASYL-LTVRASDGTHATD--ARL--SVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVL----AGDADSGPFGEVTYALAPSED------SDWADGAFGL-HPVTGALNVTRPLD-RESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAV--------GN-------DGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNT------VTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGG--AFSVSPDGHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 7 Score: 131.339 bits (329), Expect = 4.666e-31
Identity = 186/756 (24.60%), Postives = 313/756 (41.40%), Query Frame = 1
Query:  238 GKNLK-KYELIQHYNI--FAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYK--TICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFR--YDPIQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEY--FNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIH---QVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNL-FPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDP-TKPLFRGSTI-LQIILENE 2439
            G N K +Y ++   ++  F++  STG + T   +DRE                 + L I A D       P+  Y   T+ + D+ND  P F +        E S  G  +   SA D D  +   ++Y+       F+        + ++L+     + T     R   +     + A D  S    S+ ++ V V D+ND+ P +   +Y+  I EN    + + T  ATD D    G V Y   ++   D  +      F ++++TG +    +LD EER    Y + + A D G     SP    I + D  D PP    +     V EN  P  L   +V  +  D N  +   I+   +   F+++ S         I+ +  +D E+Q+   L +    GG   +  +  ++V V DVN++   F + +  +SI E+ P+ S    +   D D  K  EV + I   +      I   +G L      DRET++EY+  V  ++      + +V V + + D+NDNKP+F+ + Y F   E   V   +G V+A D D G NG V+Y       N            +R+F    + +Q        ++VA D GRP  +    TV + V D N++PP+F K  +  ++S     + + L   ++D D+   N  + Y ++          F +D  TG I +       +          + VS  D  T PL    T+ +Q++ EN+
Sbjct:  371 GLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASS-------------VVLNISAQD---QGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYN-------FDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRY---QLTAGDAAR------FQVNAVTGAVSTRVSLDREERAV--YQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTL-VGSVSASTLDLNANVTYLIVSGDQRGSFSIEWSGG------RIFTANAIDREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGI-FPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEG-VNGALRYAINEGNE---GGKFTVDASTGQITLL-----GSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDEND 1072          

HSP 8 Score: 127.872 bits (320), Expect = 6.448e-30
Identity = 184/748 (24.60%), Postives = 321/748 (42.91%), Query Frame = 1
Query:  268 QHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYK-TICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPI--QCTLTAWD---LNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFS-----GNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDA--NGKIECEILEW--GEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVN--IDTNNGYLTTNEMFDRET----KDEYAFEVQVVEKDNVN---FTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTV-SNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNL--FPSTDKDKSPE-NTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQI 2424
            Q+  +F +   TG + T++S+DRE L                 L + A D  + + P     K T+ + D+NDN P F  +     I E  P GT +   +A D D      ++Y +   +             ++++N     + TR    R +    Q  +TA D   L + S   + + V D  D  P +    Y   + EN+   +++ +  A+  D +   V+Y    I+  D   +FS     G +FT ++I          D EE  Q  Y + ++A   G    +S +  V D+ +        +       + E+ P N   +F+V   D+D+  NG+++ EI E   GE F +           ++Y+   LD E +   +L +   D G   L+S   + V V+DVNDN+  F   +      E   +GS +  +   D D  S     + +S     VN  +D+  G + +  +FDRE         +F   VV  D        D   V + + D+NDN P F  + Y  S+ E+ S    + RV A D D G NG + Y  +N+  N+   FTV ++ G+I L   LD ++   + + + A D G    +++S TV + VLD N++PP F +   ++  + ++  + + L    ++D+D  P  + +   +  N       + F ID+ TG++ +  +    +F+T    +  + VS  D  +P    +TIL +
Sbjct:  492 QYREMFRLDSLTGKVTTLKSLDREELEE-------------YPLVVQAQD--RGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDA-----------ARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLD-LNANVTY---LIVSGDQRGSFSIEWSGGRIFTANAI----------DREE--QAFYQLRVVANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVS---IAEDEPVNSR-FFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDG-------QLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSN--GGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYA-INE-GNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTS-PLAASCTVAVQVLDENDNPPRFTESLLSVD-ALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNT-----HATFAIDRSTGSVFLARR---LDFETQRLYR--LNVSAEDGGRPPRSSATILVV 1170          

HSP 9 Score: 125.176 bits (313), Expect = 3.839e-29
Identity = 134/509 (26.33%), Postives = 218/509 (42.83%), Query Frame = 1
Query:  460 ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNI-SFRYDPIQCTLTAWDLNSSSSMR----LIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGT-PSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEY--FNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRIST--IDLDKKSEVAFSIVHS-SNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILR-----ISDINDNKPVFDAHYSFSIPENTSVDGF-------IGRVRAIDNDLGENGTVSYV 1914
            + + D+NDN P F   +      E+  +G+ +    A D D+     + Y  +  +  F L     R    ++  +  LI      SF +     ++ A D      ++    + V V D+ND+ P++  S Y   + E+    + +    A+D D  V G + Y+I         +   G  FT+D+ TG + L G+LD EE     Y + + A D+GT P  +S T AV  +++ ++ P        +  +E       L   T  D D   +G +   I+    +  F + +ST ++      +L++ LD+E Q +  L +  +DGG+P  +S   + V+V D NDN   F    +  SI ENIPIG+ +I ++    D D   E+ +SI       +   ID  +G + T    DRE      FEV V   D      T +  L+     ++D NDN P       F  P    VDG        +G ++A D D  EN  V Y 
Sbjct:  850 VTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSF-----SVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAIN--------EGNEGGKFTVDASTGQITLLGSLDREE--TASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSV------FLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGL-FEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAP------RFVTPTAILVDGLRAAAGSVVGTLQASDPDEAENAAVRYA 1330          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.436 bits (363), Expect = 5.595e-35
Identity = 139/567 (24.51%), Postives = 245/567 (43.21%), Query Frame = 1
Query:  457 TICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFR--YDPIQCTLTAWDLNS----SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVY-GKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTV-SNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEK 2127
            T+ +ED NDN P F        + E +PIG+++ L +A D D+   AII Y ++              D  + +N     I+T     R   +     +TA D       SSS  L+V V D+NDH+P + N+ Y      +    + +    A DAD    G + +S+            +   F++D   G +     L   +  + +  +T+   D G P  S+ TT V          P            E+ PP          +   A G +   +   G   NL    A  P + E+ + + LD+E Q    L+++ +D G P  ++  ++ V+V+D+NDN   F        +PEN P    I+ ++ +D D     +V +SI+  +  +   ++ N+G + +    DRE    Y   V+  ++ +     TVKV++ ++D NDN P F   +S  + E+ +V   + RV  +D D G N  +++     + +    F++  + GEI +   L+ + ++ + V + A D     + + ST V I V D N++ P F +
Sbjct:   13 TVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGG------------DGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSL---------SGSASAGFSVDPRRGVIHAARAL---QGPRDDLTLTVRVSDGGAPPRSAVTT-VTVRFRDAGEFPRFAPGPRSFSFREDQPPGTTITVVAARSSRRA-GPVSYHLASGG---NLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPP-RTIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITF----SLLDPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDP----AWTVSTDVTIVVDDVNDNAPRFGQ 541          

HSP 2 Score: 110.538 bits (275), Expect = 1.426e-24
Identity = 164/774 (21.19%), Postives = 310/774 (40.05%), Query Frame = 1
Query:  277 NIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPER--IYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYD------PIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTF-----SGNLFTI------DSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTA----VXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTT-VFITVLDSNNHPPEF-EKPF-FALTLSCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMT---------------VKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIILENERYHKNVNE 2463
            N+F ++P++G ++++ ++DRE +                ELT+ A+D      P +   +   I + D NDNSP F ++  +  + E + +G  +   S  D D    A I + +       +L FSI            ++ V+R ++ R D       ++ +  AW +    S  + + V+D+ND++P +  + YYI   E    ++++    A+DAD    G+V +      +R   + F     SG + ++      D   G    N N         +Y   + A D G P LSS  T     V+   +                V   T    LD   V D D D NG+I   ++                    ++L   L  +  S+ ++ ++ +D G+P L+S+    ++V + N     F    + +S+PEN P GS + R++  D D      + +SI         +I   +G +      D ET+  Y   V   +      T+   V + ++D+NDN P+ +A  Y   IPEN      +  + A+D D   N    Y   +  ++   +      G +     LD + +  +++T+ A +   P +   ST  V + +   N + P F ++ + F ++ S        ++F +TD+D   + T    L    +       F +++ TG I ++               + +N  + +  + ++V + V++ D   P          +  +  YH  V+E
Sbjct:  381 NVFRVNPNSGEIRSVSTLDRENVAS-------------YELTVKATD---RGSPTQHCTVKVLISVTDENDNSPRFTQIF-SAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDP----SLPFSIHPSTG-------EITVSRRLN-REDRSGYAVKVRASDPAWTV----STDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFF-----FMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLN---------KYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGT--RILDMSAV-DPDRDVNGQIAYSVVGGNASRRFDVDAGGF-----LHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEAD--LFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNY--PDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVF-ATDRDAGIDGTVFYMLFGESR----SKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDP---------PVFSSALYHGRVSE 1081          

HSP 3 Score: 99.7525 bits (247), Expect = 2.854e-21
Identity = 138/595 (23.19%), Postives = 237/595 (39.83%), Query Frame = 1
Query:  388 VLELTIFASDLIQSNKPP--ERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSEN--IFNLSFSIFRDKQYKLNHQVKLIVTRNISFR--YDPIQCTL-TAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVS-YSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEY----FNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVI--DVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEV-AFS-IVHSSNCSFV-NIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGEN-GTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPE 2118
            +  +T+ A D     +PP   R    I + + N  +P F      + + E  P G+ L   +A D D+     I Y +   +   +F++S         + +  V L+   +      Y+   C     W   +  S  + + V D+ND+ P    S YY  I EN    + +    A DAD+    V+ YS+              +LF ++  TG +   G LD+E +   E  V      N   +    T  V       +      + R    V   + P      +VF  D DA        + +GE     F++ + T       EI +S  LD E+++   L +  ++ G         + VNV   D ND  V F        + E   +G+ ++ +S  D D       FS ++ S N     +I+ + G +      DRE+   Y   V  V+      T T  V++ + D+NDN P F    S  + EN      +  + A D DL  N G  ++  +      R YF++S+ G ++    +D +++    + +   D G P  ++S+ T+ ++VLD N++P E
Sbjct:  720 IFSVTVEARD---RGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDIS---------RASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSG-VSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSL---------DDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAF---NYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTG------EIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDPPV-FSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGP-FLLTSSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSP-PLTSTVTLHLSVLDQNDNPSE 1280          

HSP 4 Score: 82.0333 bits (201), Expect = 6.179e-16
Identity = 60/234 (25.64%), Postives = 102/234 (43.59%), Query Frame = 1
Query: 1420 GKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNV-NFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTV-SNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHP 2112
            G+P LT    + V V D NDN   F    +R ++PE+ PIGS++  ++  D D       S          +++ + G + T    DRE ++ Y  EV  ++       + +  +++ ++D+ND+ P F +A Y    P +      +  V A D D G NG + +      S     F+V    G I     L   + ++  +T+   D G P   S+ TTV +   D+   P
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAG---FSVDPRRGVIHAARALQGPRDDL-TLTVRVSDGGAP-PRSAVTTVTVRFRDAGEFP 230          

HSP 5 Score: 73.559 bits (179), Expect = 2.798e-13
Identity = 91/365 (24.93%), Postives = 153/365 (41.92%), Query Frame = 1
Query: 1333 PITYEIYLSQILDYEKQSMIALIIQCQDGGK-PNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTV-SNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPSTDKDKSPENTKMNY-LLD---------NIKPLEFKSLFKIDKL-TGTIAMTVKENDCNFKTNNKEKVEIKVSVFD 2382
            P T +I  +  LD E +    L +   DGG  P L+S   + V V DVND+   F         P + P G+ +  ++  D D     ++ FS+  S++  F ++D   G +       +  +D+    V+V +      +    V +R  D  +         SFS  E+      I  V A  +     G VSY  +    N    F V    GE+ +   LD + Q+ +++ + ARD G P   S+   + + VLD N++ PEF    F   +   T      +  + DKD S  N +++Y ++D         N    E +S+  +D+    +  +TVK  D    T +   V++ +SV D
Sbjct:   76 PSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGF-SVDPRRGVIHAARAL-QGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEFPRFAPGPRSFSFREDQPPGTTITVVAARSSR--RAGPVSY-HLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFP-PFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVLTAVDKD-SGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHC-TVKVLISVTD 432          

HSP 6 Score: 66.2402 bits (160), Expect = 4.510e-11
Identity = 107/514 (20.82%), Postives = 201/514 (39.11%), Query Frame = 1
Query:  457 TICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQC---TLTAWDLNSS---SSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSI-GRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQR------------------EYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD---KKSEVAFSIVHSSNC--SFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKP------VFDAHYSFSIPENTSVDGFIGRVRAIDNDL 1887
            +I + D+NDN P          I E +P GT + +  A D DS   A+  Y +   E              + LN +  ++ T+     Y+  Q    T+ A++   +   S+ ++ V++  +N++ P +   +Y   + E+  + + + +  ATD D  + G V Y + G    +          F+++  TG++ ++  LD E                       E +V +   D   P + S   + +     ++   +     G+   + ++PP +  +  +  +               G  F++   T        I ++  LD E   +  L +   D G+P  T    + V + DVNDN  +    + +++  EN P G  ++ +   D D    K    F ++ S      + ++ +++G L T    DRE K E+   V + +  +   T TV + L + D NDN        V   ++    P      GFIG VR  D D+
Sbjct:  847 SISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADL-----------FVLNQKTGVLTTQGF-LDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKG---------FSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDPPVFS---SALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGN------------AGRAFSINAHTG------LIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSSAKVT--ENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSL-SSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSEARDVRVHVNYFGSPFP-----GGFIGDVRPRDPDI 1310          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004043.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.05 bits (362), Expect = 7.024e-35
Identity = 139/567 (24.51%), Postives = 245/567 (43.21%), Query Frame = 1
Query:  457 TICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFR--YDPIQCTLTAWDLNS----SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVY-GKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTV-SNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEK 2127
            T+ +ED NDN P F        + E +PIG+++ L +A D D+   AII Y ++              D  + +N     I+T     R   +     +TA D       SSS  L+V V D+NDH+P + N+ Y      +    + +    A DAD    G + +S+            +   F++D   G +     L   +  + +  +T+   D G P  S+ TT V          P            E+ PP          +   A G +   +   G   NL    A  P + E+ + + LD+E Q    L+++ +D G P  ++  ++ V+V+D+NDN   F        +PEN P    I+ ++ +D D     +V +SI+  +  +   ++ N+G + +    DRE    Y   V+  ++ +     TVKV++ ++D NDN P F   +S  + E+ +V   + RV  +D D G N  +++     + +    F++  + GEI +   L+ + ++ + V + A D     + + ST V I V D N++ P F +
Sbjct:   13 TVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGG------------DGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSL---------SGSASAGFSVDPRRGVIHAARAL---QGPRDDLTLTVRVSDGGAPPRSAVTT-VTVRFRDAGEFPRFAPGPRSFSFREDQPPGTTITVVAARSSRRA-GPVSYHLASGG---NLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPP-RTIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITF----SLLDPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDP----AWTVSTDVTIVVDDVNDNAPRFGQ 541          

HSP 2 Score: 109.768 bits (273), Expect = 2.014e-24
Identity = 163/774 (21.06%), Postives = 310/774 (40.05%), Query Frame = 1
Query:  277 NIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPER--IYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYD------PIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTF-----SGNLFTI------DSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTA----VXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTT-VFITVLDSNNHPPEF-EKPF-FALTLSCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMT---------------VKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIILENERYHKNVNE 2463
            N+F ++P++G ++++ ++DRE +                ELT+ A+D      P +   +   I + D NDNSP F ++  +  + E + +G  +   S  D D    A I + +       +L FSI            ++ V+R ++ R D       ++ +  AW +    S  + + V+D+ND++P +  + YYI   E    ++++    A+DAD    G+V +      +R   + F     SG + ++      D   G    N N         +Y   + A D G P LSS  T     V+   +                V   T    LD  +  D D D NG+I   ++                    ++L   L  +  S+ ++ ++ +D G+P L+S+    ++V + N     F    + +S+PEN P GS + R++  D D      + +SI         +I   +G +      D ET+  Y   V   +      T+   V + ++D+NDN P+ +A  Y   IPEN      +  + A+D D   N    Y   +  ++   +      G +     LD + +  +++T+ A +   P +   ST  V + +   N + P F ++ + F ++ S        ++F +TD+D   + T    L    +       F +++ TG I ++               + +N  + +  + ++V + V++ D   P          +  +  YH  V+E
Sbjct:  381 NVFRVNPNSGEIRSVSTLDRENVAS-------------YELTVKATD---RGSPTQHCTVKVLISVTDENDNSPRFTQIF-SAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDP----SLPFSIHPSTG-------EITVSRRLN-REDRSGYAVKVRASDPAWTV----STDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFF-----FMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLN---------KYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGT--RILD-MSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGGF-----LHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEAD--LFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNY--PDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVF-ATDRDAGIDGTVFYMLFGESR----SKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDP---------PVFSSALYHGRVSE 1081          

HSP 3 Score: 99.3673 bits (246), Expect = 3.404e-21
Identity = 138/595 (23.19%), Postives = 237/595 (39.83%), Query Frame = 1
Query:  388 VLELTIFASDLIQSNKPP--ERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSEN--IFNLSFSIFRDKQYKLNHQVKLIVTRNISFR--YDPIQCTL-TAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVS-YSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEY----FNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVI--DVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEV-AFS-IVHSSNCSFV-NIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGEN-GTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPE 2118
            +  +T+ A D     +PP   R    I + + N  +P F      + + E  P G+ L   +A D D+     I Y +   +   +F++S         + +  V L+   +      Y+   C     W   +  S  + + V D+ND+ P    S YY  I EN    + +    A DAD+    V+ YS+              +LF ++  TG +   G LD+E +   E  V      N   +    T  V       +      + R    V   + P      +VF  D DA        + +GE     F++ + T       EI +S  LD E+++   L +  ++ G         + VNV   D ND  V F        + E   +G+ ++ +S  D D       FS ++ S N     +I+ + G +      DRE+   Y   V  V+      T T  V++ + D+NDN P F    S  + EN      +  + A D DL  N G  ++  +      R YF++S+ G ++    +D +++    + +   D G P  ++S+ T+ ++VLD N++P E
Sbjct:  720 IFSVTVEARD---RGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDIS---------RASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSG-VSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSL---------DDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAF---NYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTG------EIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDPPV-FSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGP-FLLTSSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSP-PLTSTVTLHLSVLDQNDNPSE 1280          

HSP 4 Score: 82.0333 bits (201), Expect = 6.773e-16
Identity = 60/234 (25.64%), Postives = 102/234 (43.59%), Query Frame = 1
Query: 1420 GKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNV-NFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTV-SNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHP 2112
            G+P LT    + V V D NDN   F    +R ++PE+ PIGS++  ++  D D       S          +++ + G + T    DRE ++ Y  EV  ++       + +  +++ ++D+ND+ P F +A Y    P +      +  V A D D G NG + +      S     F+V    G I     L   + ++  +T+   D G P   S+ TTV +   D+   P
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAG---FSVDPRRGVIHAARALQGPRDDL-TLTVRVSDGGAP-PRSAVTTVTVRFRDAGEFP 230          

HSP 5 Score: 73.1738 bits (178), Expect = 3.120e-13
Identity = 91/365 (24.93%), Postives = 153/365 (41.92%), Query Frame = 1
Query: 1333 PITYEIYLSQILDYEKQSMIALIIQCQDGGK-PNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTV-SNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPSTDKDKSPENTKMNY-LLD---------NIKPLEFKSLFKIDKL-TGTIAMTVKENDCNFKTNNKEKVEIKVSVFD 2382
            P T +I  +  LD E +    L +   DGG  P L+S   + V V DVND+   F         P + P G+ +  ++  D D     ++ FS+  S++  F ++D   G +       +  +D+    V+V +      +    V +R  D  +         SFS  E+      I  V A  +     G VSY  +    N    F V    GE+ +   LD + Q+ +++ + ARD G P   S+   + + VLD N++ PEF    F   +   T      +  + DKD S  N +++Y ++D         N    E +S+  +D+    +  +TVK  D    T +   V++ +SV D
Sbjct:   76 PSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGF-SVDPRRGVIHAARAL-QGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEFPRFAPGPRSFSFREDQPPGTTITVVAARSSR--RAGPVSY-HLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFP-PFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVLTAVDKD-SGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHC-TVKVLISVTD 432          

HSP 6 Score: 65.855 bits (159), Expect = 6.055e-11
Identity = 107/514 (20.82%), Postives = 201/514 (39.11%), Query Frame = 1
Query:  457 TICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQC---TLTAWDLNSS---SSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSI-GRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQR------------------EYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD---KKSEVAFSIVHSSNC--SFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKP------VFDAHYSFSIPENTSVDGFIGRVRAIDNDL 1887
            +I + D+NDN P          I E +P GT + +  A D DS   A+  Y +   E              + LN +  ++ T+     Y+  Q    T+ A++   +   S+ ++ V++  +N++ P +   +Y   + E+  + + + +  ATD D  + G V Y + G    +          F+++  TG++ ++  LD E                       E +V +   D   P + S   + +     ++   +     G+   + ++PP +  +  +  +               G  F++   T        I ++  LD E   +  L +   D G+P  T    + V + DVNDN  +    + +++  EN P G  ++ +   D D    K    F ++ S      + ++ +++G L T    DRE K E+   V + +  +   T TV + L + D NDN        V   ++    P      GFIG VR  D D+
Sbjct:  847 SISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADL-----------FVLNQKTGVLTTQGF-LDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKG---------FSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDPPVFS---SALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGN------------AGRAFSINAHTG------LIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSSAKVT--ENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSL-SSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSEARDVRVHVNYFGSPFP-----GGFIGDVRPRDPDI 1310          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 183.341 bits (464), Expect = 7.374e-47
Identity = 191/706 (27.05%), Postives = 326/706 (46.18%), Query Frame = 1
Query:  256 YELIQHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTF-SGN---LFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGE--YFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDK--KSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTV-SNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNL--------FPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTV 2313
            Y L    N F ++  TG ++T+  +D E              K    + I A D   +   P      I ++D+NDN+P F        + E   +G+ +   +A D D    A + Y +   +  +   F++  D Q  +  + K    R     Y   Q  L A D  S   S    + +++ D+ND+ P + +++Y   + E++ + + + T  A+D D                D+  +F SGN    FT+D++TG + ++ +LDFE+R    Y + +   D G+P L+  +  +I++ D NDNPP+ + +     V+ENTP       +  D D   NG +   I++  +   F +  ST  I I      ++  DYE ++   L +Q +D G P      ++ + + DVND+   F        IPE+  IGS ++ ++  DLD   +  + + ++  +     NID N+G +  +   DRET   Y+ +V+  +  + + + + +V + + DINDN P+F   Y F + E++S    IG+V A D D   NG V Y     +S+    F++ ++ G I L   LD +K+  + VT+ A+D G P S SS T V + V D N++PP+F K  +       T T+ +NL          +TD D S  N K++Y   +I        F +D+ TG I   V
Sbjct:  106 YSLFSGENKFMMNSKTGEIRTVTPLDHET-------------KDSYTMRISAFDGKHTTFVP-----LITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSY---FTV--DSQGVI--RTKGAFDRETKASY---QVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNA-----------DLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQR--SSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT--QVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISI------AKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYA----LSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTP-SRSSLTVVKVMVDDVNDNPPQFAKSLY-------TCTVGENLAAGVAVCYVTATDAD-SGANGKISY---SILSGNENMAFAMDRFTGEITTRV 746          

HSP 2 Score: 176.022 bits (445), Expect = 1.689e-44
Identity = 180/638 (28.21%), Postives = 291/638 (45.61%), Query Frame = 1
Query:  283 FAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPP--ERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSD-----FAIIK------YDMKCSENIFNLSFSI-FRDK-QYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKS--EVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIV--ARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFA 2139
            F +   TG +   RS+D E            +    L L++          PP  +  +  I + DINDN P F        + E +P GT++   SA DRDSS      F IIK      + +  S  I +++ S  + +K +Y L  Q +    R +  +YD  Q T               + + D+NDHSP +  S Y  +I E+ ++ S + T  ATD D      S   GR+  R I     G  F ID+ +G ++++  LD E      Y + + A+D G+ S SS T   I ++D NDN PI          E ++P + +      D D+ +NG +   + +  + F++  ST        I L   LDYEK++   + +  +DGG P+ +S   + V V DVNDN   F +     ++ EN+  G  +  ++  D D  +  ++++SI+  +      +D   G +TT    DRET   Y+  +   +   V F     V + I+D NDN+P F     F+I E++     +G++ A D D+G NG V+Y  ++   NQ   F +     I L     +D++ I   T+V  A D G P   S + ++ ++VLD N++ P FEK  F+
Sbjct:  319 FTLDAVTGVVTVSRSLDFEQ-----------RSSYALGLSV-----TDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQV---SATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQAR---DRGVPVKYDTAQVT---------------IFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLD------SGPRGRLEYRLISGNVKG-AFNIDANSGSIRVSSELDRE--TTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTSTG------LITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIIS--GNQGNSFQLDPRSGI-LSVRSTLDRETIPSYTLVVKASDAGSP-QQSITASIHVSVLDVNDNAPRFEKSLFS 900          

HSP 3 Score: 164.851 bits (416), Expect = 4.660e-41
Identity = 198/733 (27.01%), Postives = 325/733 (44.34%), Query Frame = 1
Query:  277 NIFAIHPSTGFLQTI-RSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPE-RIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYK-LNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGNL--FTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-PNYLDYFTVFDNDEDANGKIECEILEW--GEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVA--FSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTV-SNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIILEN 2436
             +F I  STG + T  R  DRE+             +    LT+ A D   +N+  + R    I ++D NDN+P FP  +    I E +P   ++ + +A DRDS   A I Y +   EN F ++      +    L+H+ K           D     ++A+D   ++ + LI  V+D+ND++P +  S Y   + E++ + SI+    A D D  +  ++SYS+            SG+   FT+DS  G ++  G  D E +    Y V + A+D G+PS S   T  I+I D NDN P+ +  +    V+E+      +   T  D D   N  +            F L        +T  + +S+ LD+E++S  AL +   D G P LT    + +NV D+NDN   F     +  + EN P G++   +S  D D  +  A  F I+  ++     ID + G ++  +  D E K  Y   VQ  ++      DT +V + I D+ND+ PVF  ++YS  IPE+T +   +  V A D D G  G + Y  ++   N +  F + +N G IR+   LD +    + + + ARD     S SSST V I + D N++ P F+ P+        +         +TD D S        L DN        +F I+  TG I +  +          K +  + V+  D   P     T++++++++
Sbjct:   10 GMFTIDSSTGSITTTGRKFDRES-------------ESRYRLTVLAQD--AANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTP-AAQVAIVTATDRDSGTNAAITYSLFSGENKFMMNSKTGEIRTVTPLDHETK-----------DSYTMRISAFDGKHTTFVPLIT-VDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSL-----------VSGDTSYFTVDS-QGVIRTKGAFDRETKAS--YQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDA------VTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQ---VSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLIS--GNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDG-GSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTD------VFSINTSTGLITLKTQ-----LDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDD 677          

HSP 4 Score: 164.081 bits (414), Expect = 7.926e-41
Identity = 203/710 (28.59%), Postives = 324/710 (45.63%), Query Frame = 1
Query:  238 GKNLK-KYEL-IQHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYK--TICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSS---SSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQRE----YIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDED--ANGKIECEILEWGEYFNLK-KSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTL-SCQTQTIDKNLFPSTDKDKSPENTKMNY-LLDNIKPLEFKSLFKIDKLTGTIAMTV 2313
            G+N K  YEL +   + F ++P+TG + T R +DRE              +    L + A D     KP +      T+ I D+NDNSP F +   T+ + E +  G+ +    A D D+     + Y +  S N  N     FR         V  +V R     Y+    T++A D       S+  + + V D ND+SP + +++    I E + + S +    ATD D     +V YSI    VR     F+ N            +NG L  ++ + RE    Y +TI A D G+P ++S     + + D NDNPP+ N    I  V EN+  +     TV  +D D  AN  +   I+   +    K  ST+ +     I  +  LD+E++S   L +   D      T+K  + + VI++ND    F Q+    S+ EN P  + ++++S  D D    +++SIV   +    +ID  +G ++T ++ DRE    YA +V+V +  N   ++   V ++I D NDN P FD + YS SI EN++   F  ++ A D D G N  ++Y   N   N  F    S+ G I L   LD + ++ + + I ARD G P   +SS T+ +TV+D N+H P         ++   Q +        ++D D    N ++ + LL N    E KS+F +D  TG I+  V
Sbjct: 1129 GENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDRE-------------DQASYSLRVTAMD---HGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSI-ISGNHGNA----FRIDSTTGRITVVGVVDREALASYN---LTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSI----VRGDTSAFAIN-----------AMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQS-TSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGV-----IMTTTPLDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITY---NLSRNDAFMIGASS-GVITLAQPLDRENKSTYDLAIQARDHGTP-PQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTG-LNAELTFSLLSN----EHKSVFTLDNTTGDISTKV 1780          

HSP 5 Score: 144.436 bits (363), Expect = 7.953e-35
Identity = 174/648 (26.85%), Postives = 288/648 (44.44%), Query Frame = 1
Query:  256 YELIQ--HYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPP--ERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKV-SYSIGRIMVRDIPKTFSGN---LFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEW--GEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQ-RFYFTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLS 2151
            Y +I   H N F I  +TG +  +  +DREAL                 LTI A D   S  PP     +  I + D NDNSP F     +  I+E   IG+ + + +A DRD    A + Y      +I     S F          VK  + R     Y     T+ A D  S   +S   L V VND+ND+ P + +  Y   ++EN    + + T  A D+D     V  YSI            SGN    F I+S +G +     LDFEE+ Q  Y + + A D+     ++ T   I + + ND  P          V EN+P +      V  +D D+ G +   I+     + F++ + +        I  + +LD E  S+ A+ ++  D G P L++   + + ++D NDN   F   +   SI EN    S   +++  D D+ +    +   S N +F+ I  ++G +T  +  DRE K  Y   +Q  +        ++ + + + DIND++P+ ++     S+ EN   +  + R+ A D D G N  +++   + +SN+ +  FT+ N  G+I     LD ++Q ++ + I   D+G P S+SS   V I V+D +++ P F+   + +T+S
Sbjct: 1240 YSIISGNHGNAFRIDSTTGRITVVGVVDREALAS-------------YNLTISAKD---SGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFY------SIVRGDTSAFAINAMNGVLTVKKEINRETVPTY---TLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSI-----------ISGNDEKRFKINSTSGVIMTTTPLDFEEKSQ--YGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTS-TSVVKVSASDRDSFGSLSYSIVGGKDSDKFSIDQRSG------IISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAFM-IGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTF---SLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNP-SLSSVADVIIDVIDEDDNCPRFQPTEYNVTIS 1834          

HSP 6 Score: 135.191 bits (339), Expect = 6.722e-32
Identity = 150/544 (27.57%), Postives = 244/544 (44.85%), Query Frame = 1
Query:  283 FAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASD----LIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRN-ISFR-YDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDY-FTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDND 1884
            FAI+   G L   + I+RE +                 LTI ASD    ++ S+K       T+ + D+NDN P F   +    + E S   T +   +A D D    A+++Y +    +          +K++K+N    +I+T   + F         +TA D   ++   + ++V ++ND +P +    Y   ++EN    + +    A+D D+ +G +SYSI  +  +D  K      F+ID  +G +     LD E  L   Y + +   D G P LS+ T   I I D NDN P  + +     + EN+ P+   +     D DE  N +I    L   + F +  S+        I L+Q LD E +S   L IQ +D G P   S   I V VID+ND+R      ++R S+ EN P  + ++RI   D D    +E+ FS++ + + S   +D   G ++T    DRE +  Y   + V +K N + +    VI+ + D +DN P F    Y+ +I E+      I +V A D D
Sbjct: 1355 FAINAMNGVLTVKKEINRETVP-------------TYTLTIRASDRGSPMMTSDKE-----LTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGND----------EKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDS-FGSLSYSI--VGGKDSDK------FSIDQRSGIISTADVLDRE--LVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYN-LSRNDAFMIGASSG------VITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDID 1852          

HSP 7 Score: 129.413 bits (324), Expect = 3.426e-30
Identity = 173/666 (25.98%), Postives = 289/666 (43.39%), Query Frame = 1
Query:  457 TICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFS---IFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGN---LFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNY-LDYFTVFDNDEDANGKIECEILEW--GEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCS-FVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSF-SIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVAR-----DQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQ---TQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKP 2394
            TI ++DINDNSP F +      ++E S  G ++   +A D D S    ++Y +  + ++F+++ S   I    Q     + + +VT        P + +LT           + V V+D+ND+ P++  S Y   + ENL     +    ATDAD+   GK+SYSI            SGN    F +D  TG++     LD E      Y +TI A D       + TT V       ++           ++ E++P    +   T  D D   NG +   I+    G  F L       P +  + +   LD E      L+++  D G P  +    I V+V+DVNDN   F +      I E+  + S ++++   D D+ S  A ++  S   S    ID+  G++ +    D ET   Y   V   +  + + + T +V + I ++NDN P F +     SIPE+ +++  + ++ A D+D G   T   V+ N  S+  F    S+ G I +   L  D++     T+V R      QG  +  +++    I VLD N++ P F    +A +L       QT+ K    +TD+D+  EN K+ Y L     +   S F+++  TG +  T K         ++    ++V+  D  KP
Sbjct:  570 TIALQDINDNSPIF-QGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTV----------VKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSI-----------LSGNENMAFAMDRFTGEITTRVPLDRETIAS--YSLTINADDGSLVRFMAATT-VNISIADENDNQPTFTGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLD------PRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTIDS-TGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSD-GTPLTFDIVEGNAGSS--FKIDQSS-GLISVAKRL--DRETTANYTLVVRATETGSQGESVYNNAT----IRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAK--VTATDRDEG-ENAKVTYELS----VGDTSKFEVNPATGLV--TTKR---PLDREDQASYSLRVTAMDHGKP 1181          

HSP 8 Score: 60.077 bits (144), Expect = 5.227e-9
Identity = 56/186 (30.11%), Postives = 88/186 (47.31%), Query Frame = 1
Query: 1597 FSIVHSSNCSFVNIDTNNGYLTT-NEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTL 2148
            +SI+  ++     ID++ G +TT    FDRE++  Y   V   +  N        V++ + D NDN P F  + Y F+I ENT     +  V A D D G N  ++Y   +  S +  +   S  GEIR    LD + ++ + + I A D G+  +        ITV D N++      PFFAL++
Sbjct:    1 YSIMDGNDQGMFTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPA-AQVAIVTATDRDSGTNAAITY---SLFSGENKFMMNSKTGEIRTVTPLDHETKDSYTMRISAFD-GKHTTF----VPLITVDDVNDN-----APFFALSV 172          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO33360 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSF3])

HSP 1 Score: 168.318 bits (425), Expect = 9.848e-45
Identity = 145/467 (31.05%), Postives = 235/467 (50.32%), Query Frame = 1
Query:  790 VKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXV---EENTPPNYLDYFTVFDNDEDANGKIECEILEW--GEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRIS--DINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDND-LGENGTVSYVQVNQISNQRFYFTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRP-ISMSSSTTVFITVLDSNNHPPEFEKPFFALTL 2148
            + + DIND+ P++P     I I E     ++I T QATDAD+ +  K+ YSI          T S   FT+D  TG ++ +  LD E     EY +TI   D+G P L++   A++ I   ++N  +   ++ +  V   E  T   ++      D DE  N +I   + +    + F++  +T  I I       Q +DYE++S  +  +   DGG+  LT    + + +IDVNDNR YF      + + EN+ IG+ + +++  DLD     +V FSI+  ++    +ID N G +TTN+  D E   EY   +Q  +  +     +   +L +S  +INDN PVF    YS SI ENT+V   I RV+A D D +  +  + Y  +N  SN    FTV  + G +R    LD +    + +TI   D G P ++ + + TV ITVLD N++ P F++  +++++
Sbjct:    1 ISILDINDNRPKFPQPYNKIEITEGTRESTMILTLQATDADSGMNAKLVYSI--------LNTTSNGTFTVDPHTGVLRTSQRLDRET--VTEYTLTITVHDSGDPMLNAAQPAIVSITVLDENDNVPVFDQEVYSVSIPENITVGAHILLLNARDKDEGVNAEIRYFLKDAIVSKRFSMNDTTGQITI------KQAVDYEERSSYSFEVFASDGGEARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVENVAIGTTVTQLTASDLDSSLNGKVLFSILEGNSDGKFSIDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPVFSQKIYSASIDENTTVGHVILRVQATDRDHVNSSSILVYSILNTTSNGT--FTVDPHTGVLRTSQRLDRETVTEYTLTITVHDSGDPMLNAAQTATVSITVLDENDNVPVFDQEVYSVSI 449          

HSP 2 Score: 135.191 bits (339), Expect = 1.493e-33
Identity = 139/484 (28.72%), Postives = 219/484 (45.25%), Query Frame = 1
Query:  460 ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDM--KCSENIFNLS--FSIFRDKQYKLNHQVKLIVTRNISFR--YDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLS-SPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGE--YFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKK--RIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD---KKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDN--VNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFI 1857
            I I DINDN P FP+    IEI E +   T +    A D DS   A + Y +    S   F +     + R  Q +L+ +     T  I+     DP+        LN++    + + V D ND+ P +    Y + I EN+ + + I    A D D  V  ++ Y +   +V           F+++  TG + +   +D+EER    Y   + A D G   L+ S +  +  I+  ++ P  +     +  VE       +   T  D D   NGK+   ILE      F++ ++T        +  ++ LDYE  +   L+IQ  D G P L S +   + V+V+++NDN   F QK    SI EN  +G  I+R+   D D     S + +SI+++++     +D + G L T++  DRET  EY   + V +  +  +N   T  V + + D NDN PVFD   YS SIPEN +V   I
Sbjct:    1 ISILDINDNRPKFPQPYNKIEITEGTRESTMILTLQATDADSGMNAKLVYSILNTTSNGTFTVDPHTGVLRTSQ-RLDRETVTEYTLTITVHDSGDPM--------LNAAQPAIVSITVLDENDNVPVFDQEVYSVSIPENITVGAHILLLNARDKDEGVNAEIRYFLKDAIV--------SKRFSMNDTTGQITIKQAVDYEER--SSYSFEVFASDGGEARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVENVAIGTTVTQLTASDLDSSLNGKVLFSILEGNSDGKFSIDQNTG------VVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPVFSQKIYSASIDENTTVGHVILRVQATDRDHVNSSSILVYSILNTTSNGTFTVDPHTGVLRTSQRLDRETVTEYTLTITVHDSGDPMLNAAQTATVSITVLDENDNVPVFDQEVYSVSIPENITVGAHI 459          

HSP 3 Score: 107.457 bits (267), Expect = 2.096e-24
Identity = 119/435 (27.36%), Postives = 203/435 (46.67%), Query Frame = 1
Query:  283 FAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASD--LIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGNL---FTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSS--PTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANI-PITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKR--IAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEII 1554
            F + P TG L+T + +DRE +            +  L +T+  S   ++ + +P      +I + D NDN P F +   ++ I E   +G  + L +A+D+D    A I+Y +K  + I +  FS+  D   ++  +  +      S+ ++          L  SSS+R+ +   D+ND+ P +  ++YY+++ EN+ + + +    A+D D+ + GKV +SI             GN    F+ID  TG +  N +LD+E+    EY + I A D G P L+S  P    + + + NDN P+ +       ++ENT   ++    V   D D        IL +         T  + P T  +  SQ LD E  +   L I   D G P L + +   +++ V+D NDN   F Q+   +SIPENI +G+ I+
Sbjct:   61 FTVDPHTGVLRTSQRLDRETVT-----------EYTLTITVHDSGDPMLNAAQPA---IVSITVLDENDNVPVFDQEVYSVSIPENITVGAHILLLNARDKDEGVNAEIRYFLK--DAIVSKRFSM-NDTTGQITIKQAVDYEERSSYSFEVFASDGGEARLTGSSSVRITII--DVNDNRPYFLPTRYYVQLVENVAIGTTVTQLTASDLDSSLNGKVLFSI-----------LEGNSDGKFSIDQNTGVVTTNKSLDYED--VTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPVFSQKIYSASIDENTTVGHV-ILRVQATDRDHVNS--SSILVYSILNTTSNGTFTVDPHTGVLRTSQRLDRETVTEYTLTITVHDSGDPMLNAAQTATVSITVLDENDNVPVFDQEVYSVSIPENITVGAHIL 460          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 171.014 bits (432), Expect = 5.841e-43
Identity = 189/657 (28.77%), Postives = 294/657 (44.75%), Query Frame = 1
Query:  391 LELTIFASDLIQSNKPPERIYK--TICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSEN-IFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYD-PIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVY-GKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQRE----YIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-PNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK---SEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVI-LRISDINDNKPVFDAHYSF-SIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEK-PFFALTLSCQTQTIDKNLFP-STDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMT 2310
            L LT+ A D      PP   Y   TI + DINDNSP F   +  + + E +PIG      S  D DS     + + +  +   +FNL      D         KLI   N +  Y  P+Q         SS++M L +KV D+ND+SP + N  Y   + E    DS I    ATD D+   G++SY+                   +D+    ++  G +  + +L RE    Y + +IA D+GTP  SS     + ++D NDN P          V+EN P   YL   +  D+DE +NG +          F + K T       +I  SQ+LD E ++     I   DGG      K ++ V V DVND    F +    +++ E++P+GS ++ +   D D++   S++ + IV       +N  T  G LT     DRE    +   V   +K      +T+  I + + D+NDN PVF    +F ++PE   +   +  V A+D+D G+NG V Y  VN  ++  F    +  G I     LD +  N + + + A D G+    +S   V I V D+N++ P F+K P   +T   +   I+ N+       D S  N+++ Y +D+  P   ++ FKI+  TG I  T
Sbjct:  773 LYLTVQAKD---KGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNL------DSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAM-LELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDS---------------KVDTSKFGLRNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQFIVDKQTG------KITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVT--GVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETT-GVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPI--ITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSP---RAHFKINSETGLIQTT 1390          

HSP 2 Score: 155.992 bits (393), Expect = 2.907e-38
Identity = 201/739 (27.20%), Postives = 324/739 (43.84%), Query Frame = 1
Query:  283 FAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRN---------ISFRYDPIQCTLTAWD-LNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGK-VSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNY-LDYFTVFDNDEDANGKIECEILEWGEY--FNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRF--YFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEK-PFFALTLSCQTQTIDKNLFPSTDKDKSPE-NTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIILEN 2436
            F I+ +TG + T+R++D E           +  + VL ++  A+D+ +  +       TI +ED NDN P+F +      I E  PI T +    A D DS   + I Y +                  +K+N +  LI T +          S +        T  D L +++++++I++  D+ND++P++  S+    + E+   +  + +  A D DT  G  V Y   RI+  D  K      F++D  TG +KL G+LD+E+  Q  Y + I A D G+P L+S     + + D NDNPP    +  I  V EN P    +   T +D D  +N ++   I    E   F++ K +        I  + ILD EK+    L +       P   S   + +NV+D NDN   F    + + +PEN P    I  ++  DLD    ++V +SI+  +      I  + G L+T    DRETK  Y   VQ  +     +T    + + I D NDN PVF  + YS +I E T     I  + A D D G NG + Y     +SN  +  Y   S  G +      +   +  +    +A+DQG+   M+    V I + D NNH P+F K P+        + +    +  +TD D     N K+ Y LD+ K     SLF ++  TG++  +       F    + +  + +   D   P  RG  I+QI++ N
Sbjct: 1272 FKINETTGVISTLRALDFE-----------VTNRYVLRVS--ATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQS----------PRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQ--DLNDNAPKFV-SRNLTYVMEDEPFNFQVTSITALDPDTGQGGNVEY---RIVSPDTGK------FSLDLKTGVLKLIGSLDYEDVPQ--YTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSG------LIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSP-ARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYT----LSNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAI-VPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSK--NSTSLFVVESNTGSVRTS-----AGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGN 1954          

HSP 3 Score: 146.747 bits (369), Expect = 1.956e-35
Identity = 164/635 (25.83%), Postives = 282/635 (44.41%), Query Frame = 1
Query:  283 FAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPP--ERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLT----AWDLNSSSSMRLI-VKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTP-SLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPI---TYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFD-RETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFAL 2142
            FAI PS+G + T   +DRE +               + LT+   D      PP  +     + + D NDN P F + +    + E SP G+ +    AQD D  + ++I Y +      F      F D +       K +VT + +  ++ +Q + T    A D    S    + V + D+ND+ P +  S Y +   EN  +   I   +A D D+      ++I R ++    +  +  +F++D  +G + L   LD E   Q  Y++T+ A D G   S++     +  ++  ++ P            E +   + + +      D+  N ++   I         K +T NI +   T  +YL   +D+EK   + L +Q +D G P L     + + VID+NDN   F   +I + +PE+ PIG     +S  D D      V+FS++ +    F N+D+N G L+  ++ D   +   Y   VQ  +  +   + T  + L++ D+ND  PVF +  Y+  + E T  D  I  V A D D GENG +SY   +++   +  F + N G+I +   LD +    + + ++A D G P   SSS  V + V D N++ P F++  +A 
Sbjct:  441 FAIDPSSGMITTATDLDREQIPQ-------------VVLTVLVHD---RGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTPF------FLDPR-------KGLVTNSRTLDHE-VQSSYTFQVAATDGGGRSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSP----KFAITRFIIE---QGNADEVFSVDG-SGLITLAKLLDRET--QDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSIS--------KGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLF-NLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSK--FGLRNGGKIFIKSKLDREDIEEYNLKVIAIDHGTP-RRSSSADVKVIVDDVNDNNPHFQQASYAF 1023          

HSP 4 Score: 139.813 bits (351), Expect = 2.375e-33
Identity = 176/692 (25.43%), Postives = 300/692 (43.35%), Query Frame = 1
Query:  280 IFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFP---ELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISF-------RYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNY-LDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDK-KSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPST--DKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMT 2310
            IF IHP+TG +     +D EA           KR  +  + + A D   S++        I + D+NDN+P       L  + ++ E + IGT++   S  D DS     +   ++  +  F++ F +  D+      Q     T +  F       + DP + T  ++ +N          V D+ND +P++    Y  R+ EN  +++++    A D D  +G  S  +  I      +++  + F ID  +G +    +LD E+  Q   ++T++  D G+P LS   + ++++ D NDN P  N +     + EN+P    +      D D   N  I   IL     F L       P    +  S+ LD+E QS     +   DGG    +    + V++ D+NDN+  F   +  +   EN  IG  I ++  ID D  K  +   I+   N   V     +G +T  ++ DRET+D Y   V+ V+    +  +   V + + D+ND  P+F  A Y+F+I E++     IG V AI  D G N  V Y  +++  N      +++ G + L   +D +K     +T+ A+D+G P  +     V I V+D N++ P+F      + L   T  I    +  +  D D          LL N       +LF +D  TG +++T
Sbjct:  220 IFGIHPTTGVIVNNVRLDYEA-----------KRSYL--IVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRIN----------VGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQD--FGSNSELVYTIANTTESRSYL-HWFAIDPSSGMITTATDLDREQIPQ--VVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTPFFLD------PRKGLVTNSRTLDHEVQSSYTFQVAATDGG--GRSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVY-SISK-GNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTP-PLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTP-IGHTFYTVSVFDADSGVLGRVSFSLLSNP-----GTLFNLDSNTGALSLT 866          

HSP 5 Score: 125.176 bits (313), Expect = 8.112e-29
Identity = 148/599 (24.71%), Postives = 251/599 (41.90%), Query Frame = 1
Query:  277 NIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERI--YKTICIEDINDNSPSFPELTQ---------------------------TIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQ--YKLNHQVKLIVTR---NISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATD--ADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDY-FTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDN----RVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKS--EVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKD--EYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISN 1935
             +F I  +TG + T + +DRE                  +L I  +D   S  PP+       + + D+NDN P F  L++                           T  +   S  G  +   SA D+DS   A IKY           SF I    Q  YK++    +I  R   ++  R   IQ  + A D       R +V V  I    P++    Y+ ++ EN ++ + + T + TD  A    G++SY+I            + N F I   +G + +N  LD+E +  R +++ + A D+  PS        I++ D ND  P+   +  +    E  P   +    +  D D  ANG++   I    +    K S A    T  I   + LD+E      + ++  D G P + +   + + V+D+NDN    RV  P     + + EN+P+ S +  I+  D D  +   ++F+++  +      ID  +G+LTTN  FD E     +Y+  ++  +  N   +  + +I+ ++D ++  P F+   Y F +P N  +  F+G+V A D D G+ G V +V  N  SN
Sbjct: 2115 GVFTIDSTTGEITTAKLLDRETTAS-------------FDLVIRGTD---SGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKY-----------SFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMD-QGVPPQRALVYVRIIITREPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIE-----------NSNYFRIGQRSGVISVNKPLDYETK--RRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDD----KGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPND---VQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFYNPTSN 2665          

HSP 6 Score: 125.176 bits (313), Expect = 8.535e-29
Identity = 163/638 (25.55%), Postives = 286/638 (44.83%), Query Frame = 1
Query:  361 NCDCLKRKCVLE---LTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIV-TRNISF---RYDPIQCTLTAWDLNSSSS---MRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTP-SLSSPTTA---VXXXXXXXXXXXXXXXXXXXXXVEEN-TPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHS----SNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLS---------CQTQTIDKN 2178
            N   +  K VL+   ++ +   +++ + PP+     + ++D+NDNSPSF   T    +  ++      +L  A D D    +   Y +  S N+ N+ F +   +    +    L+V   +I     R D     ++A D  + ++   +RL + V D ND+ PE+ N  Y   I EN+ + + I    A+D D     ++ YSI        P+     +F I   TG +  N  LD+E +  R Y++ + A+D G+   LSS       V+D+ D N    +     G   V EN T    +   +V D D   NG++   +     YF++K    N      I + Q LD E      L   C D G P  T++K   +NV DVND    F + T    + EN  + + +  ++ +D D    SE+ ++I ++    S   +  ID ++G +TT    DRE   +    V V ++ +   +D   VI+ ++D NDN P F+ + Y+ S+ EN+     + ++ A D D+GEN  + Y   + ++    +F     G +     LD + Q+ +   + A D G     S + TV +++ D N++ P F+   +++            CQ + ID++
Sbjct:   10 NAGVITTKTVLDREKVSAYNLTIVEFSTPPKSYTVLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQKL-IAVDSDFGSNSTQSYTI-VSGNVGNV-FKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSI---ETHSDPQA----IFGIHPTTGVIVNNVRLDYEAK--RSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESI--IAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILY---SILTPNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGG---GRSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRD 627          

HSP 7 Score: 116.701 bits (291), Expect = 3.486e-26
Identity = 189/720 (26.25%), Postives = 313/720 (43.47%), Query Frame = 1
Query:  208 QMGINLNLTRGKNLKKYELIQHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERI-YKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVT-RNISF----RYDPIQCTLTAWDLN---SSSSMRLI-VKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSP--TTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNY-LDYFTVFDNDEDANGKIECEIL--EWGEY-FNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKS--EVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMS-SSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNL-FPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTI 2301
            Q G N ++T       Y ++     F+++  TG L  +  +DRE           +  + +L   + ASD    N+  E I Y  I + D+NDN P F   T    + EK PIG+ +    A D D  D   ++Y +               D  +K+N    +I T R + F    RY      ++A D+      +S +L+ + V D ND+ P +  +     I EN+ +++ + T +A D D+ +  ++ Y+I     R          F I+S TG ++    +D EE    EY + + A D           T  +  I    ++     ++R +  V E+ P N+ +   T  D D    G +E  I+  + G++  +LK        T  + L   LDYE      L I   D G P LTS +   V V+DVNDN   F +     ++ EN P G+ +++++  D D  S  E+ +SI         +ID ++G + TN + DRE KD Y   V            +  V + + D NDN P F     +  +PEN+     I  +   D D G N  V Y  ++  ++  F    S  GE+     LD + +  +Q+++ A+D   P   + ++ T+FI   D N++PP F++  ++ T+S  T      L   ++DKD S  N  + Y L N    +   ++ ID  TG +
Sbjct: 1148 QQGPNSDIT-------YMIVAGPKAFSLNQVTGVLTLVSPLDRE-----------VTHRHILH--VVASDK-GGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNT----------DGTFKINETTGVISTLRALDFEVTNRY---VLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPR--------AHFKINSETGLIQTTHPIDREE--ISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLK--------TGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSPAR-LIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRST-GELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIE--DQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKD-SGSNGNIVYTLSN----DTYGVYSIDSRTGIV 1806          

HSP 8 Score: 112.849 bits (281), Expect = 4.863e-25
Identity = 167/694 (24.06%), Postives = 285/694 (41.07%), Query Frame = 1
Query:  202 IYQMGINLNLTRGKNLKKYELIQHYNI---FAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIY---KTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFR-DKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLI---VKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT---VYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSS-PTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEW--GEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSE--IIRISTIDLDKKS--EVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIG----------------------------RVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDID-KQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFF 2136
            IY + +  +L  G N K    I   N    F I  STG L T   +DRE              K   +L++ A D+     PP        TI IED NDN P F +   +  I+E +P GT +   +A D+DS     I Y +       N ++ ++  D +  + +      T +I   Y+   C   A D      M ++   +K+ D N+H+P++  + Y + I  N    +++    ATDADT     GKV+Y +      D  K  S +LF ++S TG ++ +    F    Q  + + IIA+D+G+P L       ++     +D P  +N     + + EN+      Y T       ++ ++   I+    G  F +   T  I +      +  LDYE      L +     G  +L     + +NVID NDN   F    +   + E+        +++++  D+D  +  +V +SI   +      ID+  G +TT ++ DRET   +   ++  +      +   +V + ++D+NDN P+FD     +I E+T     +                             RV A D D G N  + Y      S+Q  Y   ++ G I     +D+  + +  Q+ + A DQG P        V++ ++ +    P+FE P +
Sbjct: 1664 IYTLTVQ-DLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTKLDRET-------------KASYQLSVQAKDI----TPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLS------NDTYGVYSIDSRTGIVYSAARFET-SIKQEYN-FFCI--AKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRL------DDSKN-STSLFVVESNTGSVRTSAG--FSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENS--KVGSYITTVRARASSDAQVTYSIISGNKGRAFYVDPFTGVISVAS----ADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVP---PQRALVYVRIIITRE--PKFELPSY 2309          

HSP 9 Score: 102.064 bits (253), Expect = 9.273e-22
Identity = 169/631 (26.78%), Postives = 264/631 (41.84%), Query Frame = 1
Query:  283 FAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKT----ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNI-SFRYDPI-QCTL--TAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVY-GKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGE--YFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFV-NIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGE--NGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEF 2121
            F I+  TG +QT   IDRE +   S             L + A+D  Q+    +R+Y T    I I+D+NDN+P F     T  + E  P   ++   +A D D+                 N+ + I      K +  +K  V + I S  Y+ + Q TL  +A DL S   +S     V V D+ND+ PE+    +   + EN    + +    A D D+    +++YSI        P     + F+ID  +G +  N  LD E++    Y +T+ A     P   S T+  I++ D NDNPP        + V EN+P   +   TV D D   N K+   I+       F + +ST  +  T +      LD E ++   L +Q +D   P  T+   I + + D NDN   F Q     +I E  P G+ I+ ++  D D  S        S++   V +ID+  G + +   F+   K EY F     ++        V V ++I D N++ P F    Y   I  NTS    +  V A D D  +  NG V+Y   +  ++   +   SN G +R         Q  H + I+A D G P  +     V I + +  + PP F
Sbjct: 1378 FKINSETGLIQTTHPIDREEISEYS-------------LKVRATD--QAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTY-VMEDEPFNFQVTSITALDPDTGQGG-------------NVEYRIVSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSI--------PSGVEMDKFSIDKHSGLIVTNSILDREKK--DTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSPARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTK------LDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSP-PLRGYGIVQIVIGNIQDDPPRF 1962          

HSP 10 Score: 99.7525 bits (247), Expect = 4.995e-21
Identity = 170/690 (24.64%), Postives = 285/690 (41.30%), Query Frame = 1
Query:  397 LTIFASDLIQSNKPPERIYKT--ICIEDINDNSPSFPELTQT---IEINEKSPIGTELELHSAQDRDSSD----FAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKEN--LLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGN---LFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIE----------CEILEWGEYFNLKKSTANIPITYEIYLSQILDYE------------------KQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-----AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSN-YGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFP--STDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTV 2313
            L I A D      PP R Y    I I +I D+ P F  L QT   + I E S +G+ +   + + R SSD    ++II  +   +  +   +  I       L+++     T+N  FR   +  T   W ++ +  M L + V D ND+SP +  S    ++ E+        +    ATD D+   GKV+YSI           ++GN   +FTIDS TG++     LD E     + +  I   D+G P  S+    V  +    ++ P +      +++ E+T    +   +V   D D   ++             IL          S A I  ++ I  S  +DY+                  + S I + +Q  D G P    +  + V +I   + +   P    ++  PEN  +G+ ++ +   D      +     +  N ++  I   +G ++ N+  D ETK  +   V  ++    +    V V + +SD+ND KPVF      A +S  IP  T     +  V A D D G NG V +    Q  + +  F +    G IR    LD +    H V++ A D+G P  M +  +V I VLD N++PP F  P        +   ++  L+   +TD+D S  N ++++    +     + LF IDK +G +   +
Sbjct: 1930 LYIIAED---HGSPPLRGYGIVQIVIGNIQDDPPRF--LNQTPARVSIPENSKVGSYIT--TVRARASSDAQVTYSIISGNKGRAFYVDPFTGVISVASADALDYES----TKN--FRLH-LVATPQGW-VSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSI-----------WTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLV--IRGTDSGIPPKST-NCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAV-VTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVP--PQRALVYVRIIITREPKFELPSYFGKV--PENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGT----IVVNVSAADKDSGANGRVWFAI--QSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSP-PMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRD-SGANARLSF---TVIGGTGQGLFLIDKFSGWLTTNI 2574          

HSP 11 Score: 93.2041 bits (230), Expect = 5.194e-19
Identity = 75/294 (25.51%), Postives = 129/294 (43.88%), Query Frame = 1
Query: 1264 GKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKS--EVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF--DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQ--VTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEK 2127
            G+I   I E   YF + + +  I +      ++ LDYE +    L++   D   P+   +  + +NV DVND +  F Q        E IP+G+ ++ +S  D D  +   V F+I    +     ID   G + T    D ET   +   V+  ++ +      V V +R+ D+NDN PVF         + EN  ++  +  + A D D G N  +S+  +   + Q  +      G +      D +   ++Q  +TI A D G P  +SS+ T+ + V D + + P F +
Sbjct: 2338 GRISYNI-ENSNYFRIGQRSGVISV------NKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGG-TGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNP-PLSSNITIIVNVADEDEYDPSFNR 2622          

HSP 12 Score: 72.7886 bits (177), Expect = 8.000e-13
Identity = 84/301 (27.91%), Postives = 136/301 (45.18%), Query Frame = 1
Query:  265 IQHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRD-----KQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSS---SSMRLIVKVNDINDHSPEW----PNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAV 1131
            I++ N F I   +G +   + +D E            KR+ +L   + A D    +KP  R+   I + D+ND  P F +     + +E  P+GT +   SA D+DS     + + ++  ++    SF+I R       Q  L+H+   I T ++S R         A D  S    + + + ++V D+ND+ P +    PN    +++ ENL L+S ++   ATD D      S +  R+    I  T  G LF ID  +G +  N   D+E     +Y +TI A D G P LSS  T +
Sbjct: 2344 IENSNYFRIGQRSGVISVNKPLDYET-----------KRRFLL--VVSAIDDTAPSKP-VRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDD--KGSFAIDRKTGVIRTQRALDHET--IKTHHVSVR---------ATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPND---VQVLENLPLNSRLYEINATDRD------SGANARLSFTVIGGTGQG-LFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITII 2607          

HSP 13 Score: 67.3958 bits (163), Expect = 3.889e-11
Identity = 167/701 (23.82%), Postives = 283/701 (40.37%), Query Frame = 1
Query:  283 FAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTI---EINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFR------YDPIQCTLTAWDLN-SSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYG---KVSYSIGRIMVRDIPKTFSGN---LFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNY-LDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDK----KSEVAFSIVHSSN-CSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF--DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYF-TVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNL---FPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTI 2301
            F++   TG L+ I S+D E +   +             L I A+DL     PP   Y+ +    + D + + PE T+ +    ++E  P GT +   +A DRDS   A + Y +     +           ++ ++    LIVT +I  R      +  +  T  ++    SS+S+R  + V D ND+ P++ +    +++ EN     +I+T    D D  YG   KV YSI            SGN    FTI   TG++     LD E +    Y +++ AKD   P  ++     I IED NDNPP+   +     + E TPP   +   T  D D  +NG I   +    + + +    +   I Y    ++     KQ      I    G  P + +   + + + D N++   F +    + I  N    + +  ++  D D       +V + +  S N  S   +++N G + T+  F    +  +A  +   +  +        V + I +I D+ P F        SIPEN+ V  +I  VRA       +  V+Y  ++    + FY    +    +     LD +     ++ +VA  QG  +S++    + I V+D N++ P F        L+  T            +TD D S  N K+ Y   +I       +F ID  TG I
Sbjct: 1484 FSLDLKTGVLKLIGSLDYEDVPQYT-------------LHISATDL---GSPPLTSYQ-LFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEM----------DKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVR--INVMDRNDNPPKFISPVVTLKVPENSPA-RLIYTLTVQDLD--YGNNTKVLYSI-----------MSGNTDGAFTIGRSTGELSTTTKLDRETKAS--YQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSN--DTYGVYSIDSRTGIVYS--AARFETSIKQEYNFFCIAKDQGQDPKM-AIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRA---RASSDAQVTYSIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGW-VSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVD-SGTNGKVTY---SIWTGNEAGVFTIDSTTGEI 2126          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 167.162 bits (422), Expect = 1.010e-41
Identity = 166/621 (26.73%), Postives = 294/621 (47.34%), Query Frame = 1
Query:  481 DNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFR--YDPIQCTLTAWDLNSSS---SMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVY-GKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYL-DYFTVFDNDEDANGKIECEILEWGE--YFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKS--EVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDA-HYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFP--STDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTI 2301
            +N P F  L +   ++E + +GT +   SA D DS    +I+Y M  S+N+ + ++       + ++    +I T+    R   D     + A D    S    M L + V D+ND+ P +  + Y   I E+  +   +   +A+DAD+   G+V Y I       +      + F+I  ++G + +   LD E+     Y + + A+D G P  S+  T  I + D ND  P  +       + E+ P N L       D D+ +NG++  EI+   +  +F++ +      I  E+ + Q LDYE   +  L++  QD G+P L ++  + + +IDVNDN   F     +  IPEN  +G E  R+   D D  +  E+ FS + + +  F +I+ N G ++  E  DRE   ++ F ++  +K       T ++ + + DINDN P F    Y  SI EN+     + +V+AID D G    V Y  V+   + R  F ++  G I L   L+ + ++++  ++ A D      +SS+  V++ V DSN H PEF++  ++  +  +  ++  ++    +TD+D    N K++Y +  + P      F +D+ TG I
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATY-------FSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCI-------LNSDGDNSAFSIGEVSGAVTVMKKLDREK--VPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINR------INGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQN-DLPF-SINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVV-YSIVSSSGHDRC-FRINPQGLITLSCTLNYNTKHVYVFSVSASDG----MLSSTALVYVNVTDSNTHAPEFKRRSYSAEVK-EDASLGTSVLTVLATDRDTG-SNAKISYSIATLVP-----EFSVDETTGVI 598          

HSP 2 Score: 111.694 bits (278), Expect = 1.145e-24
Identity = 97/381 (25.46%), Postives = 170/381 (44.62%), Query Frame = 1
Query: 1348 IYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNL-FPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIILEN--------ERYHKNVN 2460
            I LS  L+Y  + +    +   DG    L+S   + VNV D N +   F +++    + E+  +G+ ++ +   D D  S    S   ++     ++D   G + T    DRE  D Y FEV   +           V + I+D+NDN PVF    Y   + E+    G +  V A D D+G+N  + Y   +    Q  +   S  G IR    LD +    +++T+VA DQG P    +S  V + + D  + PP FEKP + +T+   T      +   +  +D SPE   M  ++    P     +F I+  TG I   +K    +++T ++ ++ ++ ++     P F  +T++ + L++        E +H N+N
Sbjct:  498 ITLSCTLNYNTKHVYVFSVSASDG---MLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPG-QASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSP----QVFDINPNTGAIQTLMK---LDYETQSEYRLTVRATL----SPFFTETTVM-VYLKDINDNTPVLEAFHMNIN 862          

HSP 3 Score: 110.153 bits (274), Expect = 2.859e-24
Identity = 135/496 (27.22%), Postives = 226/496 (45.56%), Query Frame = 1
Query:  457 TICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQC-TLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVY-GKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENT-PPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLS-QILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRI--STIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDA-HYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVN 1923
            TI + DINDN P F +      I E S  GT +    A D DS    +          ++++  S   D+ +++N Q  + ++  +++    +   +++A D   SS+  + V V D N H+PE+    Y   +KE+  L + + T  ATD DT    K+SYSI  +    +P+      F++D  TG +K  G+LD E+     + VT  A D+G P L + +   I I D NDN P+         V E+  P   +   +  D D   N +I       G+     + T  I  T  I  + + LD E      L +   D G P   +  ++ V + DV D+   F +    +++PE+ P  S +I +   + DL  ++ + +SIV  ++    +I+ N G + T    D ET+ EY   V+        FT+T  V++ + DINDN PV +A H + ++ E         ++ A D D+ +  T   ++ N
Sbjct:  429 TITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNV----------VYSIVSSSGHDRCFRINPQGLITLSCTLNYNTKHVYVFSVSASDGMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATL----VPE------FSVDETTGVIKTAGSLDREKVDTYRFEVT--ATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGD----GQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSPQVFDINPNTGAIQTLMKLDYETQSEYRLTVRATLSP--FFTETT-VMVYLKDINDNTPVLEAFHMNINVQEGKVPPEARYKIPAYDPDVSDKLTFKVMEGN 895          

HSP 4 Score: 51.2174 bits (121), Expect = 2.614e-6
Identity = 98/435 (22.53%), Postives = 176/435 (40.46%), Query Frame = 1
Query:  466 IEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKC---------SENIFNLSFSIFRDK--QYKL-----NHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGN-----LFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANI-----PITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETK 1692
            + D N ++P F   + + E+ E + +GT +    A DRD+   A I Y +           +  +   + S+ R+K   Y+      +H +  +  +  SF Y                     + + D+ND+ P +    Y  +++E++     +    A+DAD         IG+     I  +F+ N      FTIDS  G ++    LD E     EY +T++A D GTP   +     + +ED  D+PP+       + V E+TPP      TV    +D +        E G  +++ +  +       P T  I     LDYE QS   L ++      P  T +  + V + D+NDN        + I++ E         +I   D D   ++ F ++  +   +V ++  +G L+ N+   + +K
Sbjct:  533 VTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAK--SFVY---------------------IHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDAD---------IGKNA--QIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRET--IPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRS-PVITVKAKSQDLSP-------ETGMMYSIVRGNSPQVFDINPNTGAIQTLMKLDYETQSEYRLTVRATL--SPFFT-ETTVMVYLKDINDNTPVLEAFHMNINVQEGKVPPEARYKIPAYDPDVSDKLTFKVMEGNAKEWVTLNATSGELSVNKKLIQASK 920          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO30364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T100])

HSP 1 Score: 154.451 bits (389), Expect = 7.931e-38
Identity = 181/613 (29.53%), Postives = 285/613 (46.49%), Query Frame = 1
Query:  397 LTIFASDLIQSNKPPERIYKTICIE--DINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSS-----SSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGN---LFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTV----FDNDEDANGKIECEIL--EWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKS---EVAFSIVHSSNCSFVNIDTNNGYLTTN----EMFDRETKDEYAFEVQVVEKDNVNFTD---TVKVILRISDINDNKPVFDAH-YSFSIPENTS--VDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSN-YGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFAL 2142
             TI A+D   S  P +    ++ I+  DINDNSP F        + E  P GT + + +A D+D    A + Y +     +    F+I  D           I TR    R +    TLT   ++S+      + R+I+ V D NDH P++  S Y   ++E++ +   +     TD D     +V Y I            SGN   +F+++  TG +     LD E+     Y + I AKD+G P+L S T+ +I IED NDN P+ + +   + + E+    +L    V     D DE ANG+   +I   +  + F +  +T  I I  +      LDYEK S+  L +  QD G P LT    + ++V DV+DN   F +      + EN+  G  +I ++  D+D ++    V + I   +  S   I   +G +T N       +RET   Y  E+QV     VN T+    V  ++ + D+NDN P FD+  Y  S+ E+T    D  I  V+A D D GE+G + +  V+   N+   F + N  G +     LD +  + + + ++A D+G P ++SSS TV ITVLD N++ P  + P   L
Sbjct: 1367 FTIRATD---SGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLS---GVLYTRFAIDPDTGN--------ITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYIS-----------SGNTSLMFSVNETTGIISTTSTLDREQ--NASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESV---FLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKAK------LDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARY--ELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIVS--GNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEP-ALSSSVTVNITVLDMNDNLPILQTPMDVL 1938          

HSP 2 Score: 135.191 bits (339), Expect = 6.244e-32
Identity = 174/694 (25.07%), Postives = 292/694 (42.07%), Query Frame = 1
Query:  475 INDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFS---IFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGN---LFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILE-WGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNC-SFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSN-YGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLS----CQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQI----------ILENERYHKNVNEEINRSNQ 2484
            IND SP F +    + ++E +  G  +   +A DRD    AII Y    +E  F +S S   I  D    L+ + K +   N++         + A   ++++ +   + V D+ D  P + +S   +++ EN  + + +    A D D +   +SYSI            +G+   LFTID++TG+++    LD E   Q E  V   AKD+           V   +  ++ P        I   EE+     +      D D   N  +   I+E   +Y  +   T  I +      S  LD E +      I+  D G P+ +S   +A+ ++D+NDN   F        + EN P G+ ++ ++  D D  +    S V S    +   ID + G +TT E  +RE    Y   ++ V+        T +VI+ ++D ND+ P F  + Y+FS+ E+  V   +GRV   D D+ +N  V Y   +   N    F+V+   G I     LD ++   + + I A+D G P ++ S+T+V IT+ D N++ P F K  + +TL      +TQ +      +TD D+   N +  Y    I   +   +F ID  TG I +  K               + VS  D   P   G+  ++I          +    RY   + E + R + 
Sbjct: 1082 INDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFYSSNGAEAKFYVSRSTGDIIVDS--PLDREFKNVYILNVT------AANIVAGAQDTTTQVH--ITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKD-IGDTISYSIA-----------NGDPYGLFTIDNVTGEIRTVAELDRENVTQYELFVQ--AKDSVNLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVENVTDYVTVNAITGVISLG-----SSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISS--GNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIP-ALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQ---VIATDPDEG-ANGQFTY---KITAGDTDDVFYIDANTGLITIKAK-----LDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHH 1731          

HSP 3 Score: 119.398 bits (298), Expect = 4.089e-27
Identity = 167/708 (23.59%), Postives = 287/708 (40.54%), Query Frame = 1
Query:  274 YNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENI-----FNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLN---SSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQRE----YIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNY-LDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEI-------YLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFS--IVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRL----FHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTI-DKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMT 2310
            Y +F I   TG ++T+  +DRE +                EL + A D +  N   + +   + +ED+NDN P F     TIE  E+SP GT +    A D D  D A + Y +   EN+      N    +      +L+ +V+           +    T+ A D      SS+  + +K+ DIND+SP + N+ YY  ++EN    + +    A+D D     K+SY              SG L+T  +I  D    GN+   E L RE    Y +T+ A D+   +    T  +I + D ND+ P    +     V E+    + +      D D + N ++   I           S+ N  + + +         +  LD E+ +   LII  +D G P L S   + + + DVNDN+  F +    +++ E++ + ++++++   D D+ +   F+  I          ID N G +T     D E    Y   V   +      T    V + +SD++DN PVF    YS  + EN +    +  V A D D   +    Y ++   +    +      G I L       L+ +    +++ + A  +       S     ITVLD N++ P F+   +  ++   T  I D  +   T K +  +  +   ++  I       +F++D  TG +  T
Sbjct: 1235 YGLFTIDNVTGEIRTVAELDRENVTQ-------------YELFVQAKDSV--NLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSI--VENVTDYVTVNAITGVISLGSSQLDREVE-----------EYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSY------------VLSGVLYTRFAIDPD---TGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYI-----------SSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATIL--TVKAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVLTRT 1886          

HSP 4 Score: 116.701 bits (291), Expect = 2.954e-26
Identity = 162/659 (24.58%), Postives = 288/659 (43.70%), Query Frame = 1
Query:  460 ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKL------NHQVKLIVTRNISFRYDPIQCTLTAWDLNS----SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTV-YGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNY-LDYFTVFDNDEDANGKIECEILEWGEY--FNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTL----SCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDC-NFKTNNKEKVEIKV 2370
            I + D+ D+ P F   + T++++E + IGT +   +A D+D  D                +S+SI     Y L        +++ +   +   R +  Q  L     +S    S  ++++V+V D+ND+ P +    Y I   E     + I   +A DAD      V YSI    V ++      +  T+++ITG + L G+   +  ++  +  TI A D+G PS SS  +  I + D NDN P+ N       V EN P    +   T  D D   N K+   +L    Y  F +   T NI         + L+ E+     L ++  D          R+ + V D ND+   F Q     S+ E++ +G  + R++T D D    + V + I   +     +++   G ++T    DRE    Y   +   +           V++ I D+NDNKP+F  + Y+ ++ E+  +   + +V A D D G NG  +Y      ++  FY   +N G I +   LD +K +++ +T+ A+D G P  ++ +  V I V D +++ P F KP ++  L    +     I  N   +TD D    + ++ Y    I+     S+F I + +G I +    + C N +T+ + ++++  
Sbjct: 1180 ITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIGD---------------TISYSIANGDPYGLFTIDNVTGEIRTVAELD---RENVTQYELFVQAKDSVNLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSI----VENVT-----DYVTVNAITGVISL-GSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSY-VLSGVLYTRFAIDPDTGNITT------REPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYID-ANTGLITIKAKLDYEKTSLYNLTVSAQDLGTP-PLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVN---ATDIDAEASHKRVYY---RIESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAA 1795          

HSP 5 Score: 115.546 bits (288), Expect = 6.449e-26
Identity = 156/613 (25.45%), Postives = 269/613 (43.88%), Query Frame = 1
Query:  457 TICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENI--FNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSS---MRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDS-----IIHTFQATDADTVY-GKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLN-GNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP---PNYLDYFTVF---------------------DNDEDANGKIECEIL--EWGEYFNLKKSTANIPITYEIYLSQILDYEKQSM---------IALIIQCQDGGKPNLTSKK----RIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTID--LDKKSEVAFSIV---HSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEF 2121
            T+ ++D+NDN P F  +  T +I E  P GT +   +A D+DS +   + +++   ++   F+++ S       +L+ +     T            T++A+D   SS    ++L V V D ND++P+  +    + I  N+   +     ++ +  A D D    G+++YS+     R          FT++S TG ++++   LD E  L+  Y + I   DNG+P  ++ TT                 +  I+DV +NTP   PN       +                     D D DANGK+   +   E G +F L       P+T E+ + + LD E   M           L I   D   P ++ +K    R+++ V D NDN   F  +     + E    GS +I++S  D  L+ K +V ++I     +  C    +  +  +   N +  +E+K         VE+          V++ + D+NDN PVF+ + Y+  + EN+     + RV A D D G NG ++Y   N   N+   F+++N  GEI +  ++D +  +   +T+ A DQG P S  +   V ITV D N++ P+F
Sbjct:  481 TVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSINGSGLVTTARELDRETIATYT-----------LTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDG---LTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGDSR----------FTLNSATGRLQISPTGLDRE--LKDSYDLIINVTDNGSPPNTNSTTV----------------HVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHG-FFRLD------PVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATP-ISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENRKCEVEKLVRHYNWHKKNCVLCKESKCS-------VER--------TYVVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTN--GNKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQF 1026          

HSP 6 Score: 114.005 bits (284), Expect = 1.927e-25
Identity = 146/626 (23.32%), Postives = 264/626 (42.17%), Query Frame = 1
Query:  394 ELTIFASDLIQSNKPPERIYKT--ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFR-DKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDAN--GKIECEILEWGE----------YFNLKKSTANI----PITYEIYLSQILDYEKQSMIAL------------------------IIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSI-VHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVK---VILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQIS--NQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEF 2121
            E T++  D         R  K   + ++D NDN+P F E     +I E + +GT +   SA D DS   + ++Y    +       FS+   + +  L   +   V R  S+    I   L    L S ++  +I++V DI+D  P +  S Y   I+EN  + S + T +A D D         I   ++ +I    S  +FTIDS TG + +NG++D E    +  +  I  K +  P  +S TT  + +   + N                  P +L    +FD  ED    G++  + L+  +           ++L  + ++     P +  +Y+++ LDYEKQ                             ++  +       ++   + + +I+VNDN+  F + +   ++ E I  G+ I  I+  D D  +  A +  +     ++ +++ +NG ++  ++ D +T  +Y F + V  KD   F   +    V + + D+NDN P F    Y+  I EN      + +V A D D GENG +S+     IS  +   +F+++  G +     LD +    + +T+ A D G   S      + + VLD N++ P+ 
Sbjct:   10 EFTVYVEDDFNGGGLARRGSKFFFLIVDDYNDNAPVFTEQPYMAKIAENARVGTTILKISAIDADSGTNSQVQYKFSNATATQTPFFSLNSVNGELTLGGPLDFEVAR--SYMLVVIAEDLGVPKLESRTT--VIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGDV-------GINNPILYEIISGNSDGVFTIDSNTGVITVNGSIDAE----KTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNR---------------PAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHLVGADSDKFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELRGGQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVV--KDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSF----NISAGDDGGHFSINGSGLVTTARELDRETIATYTLTVSAYDHGVS-SRHKHVQLTVNVLDENDNTPQI 598          

HSP 7 Score: 98.2117 bits (243), Expect = 1.347e-20
Identity = 152/614 (24.76%), Postives = 269/614 (43.81%), Query Frame = 1
Query:  274 YNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASD-LIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWD-----LNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEEN-TPPNYLDYFTVFDNDEDANGKIECEILEWG---EYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIA---VNVIDVNDNRVYFPQKT-IRISIPENIPI-GSEIIRISTIDLDK--KSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF---------DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVA 2034
            Y  FAI P TG + T   ++RE     +             LT+ A D  I++ +   R+   I + D ND+ P F +      + E   +G  +   +  D D +D A ++Y +       +L FS+  +    ++    L   +N S+        +TA D     L S++S  +++ + D+ND+ P +  S Y + ++E++ L + +    ATD D    G+ +Y   +I   D     + ++F ID+ TG + +   LD+E+     Y +T+ A+D GTP L+      I + D +DN P+ +  R   ++ EN T  +++      D D +A+ K     +E G     F + + +    IT     S  L+ E  +   L  Q     + NLT +K +    + V+DVNDN   F  ++ +R  + +  PI  + I+ +   D D+    E+ F+IV  +      +D   G LT     DRE    Y+  V   +K     + +V V + + D+NDN P+          +   +FS+ EN      +G V A D D      + Y  +     Q+++      GE+R    LD +  ++H + + A
Sbjct: 1443 YTRFAIDPDTGNITTREPLNREETGSYT-------------LTLRAVDSAIRAREGTTRVI--ITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNT--SLMFSV-NETTGIISTTSTLDREQNASY-----TLIITAKDHGIPALESNTS--VMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTY---KITAGD-----TDDVFYIDANTGLITIKAKLDYEK--TSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSG--VITLNCTPSGCLNRETHARYEL--QVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPVGVVAAQDLD---TKNLIYYYITNTEEQKYFILNETSGELRTRITLDREDSSVHYLYVKA 2014          

HSP 8 Score: 90.1225 bits (222), Expect = 4.017e-18
Identity = 121/498 (24.30%), Postives = 215/498 (43.17%), Query Frame = 1
Query:  754 WDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGT--PSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDY-FTVFDNDEDANGKIECEILEW--GEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSE-----IIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEM-FDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-------AHYSFSIPEN-TSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNY-GEIRLFHMLDIDKQNIHQ---------VTIVARDQGRPISMSSSTT--VFITVLDSNNHPPEFEKPFFALTLS 2151
            +  N+S ++ LI    ++ND+ P +  S Y   + E +   + I    ATDAD   +G ++Y +         +      F++++  G +     LD++    R+Y  +++ KD G     ++  T  V   +  +++P    +      + EN P   + +  T  D D   NG++   I     G +F++  S         +  ++ LD E  +   L +   D G  +     ++ VNV+D NDN    PQ T  ++I  NI  G+      +  I+ +D D  S    +   S   S   +++  G L  +    DRE KD Y   + V +  +   T++  V + I D+NDN P FD       A Y  ++ E   +++  +  + A D D   NG V+Y   +   ++  +F +    GE+ +   LD +   + +         + I A DQ  PIS   S T  V ITV D+N++ P+F+   +   LS
Sbjct:  369 FSANASVTLTLI----NVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYEL---------RGGQAAYFSVNADNGTISAAQILDYDTL--RQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSD-IAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSINGSGL-------VTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNT---PQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGDSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAY---SLSGDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLS 837          

HSP 9 Score: 87.4261 bits (215), Expect = 2.355e-17
Identity = 137/593 (23.10%), Postives = 233/593 (39.29%), Query Frame = 1
Query:  283 FAIHPSTGFLQTIRSID------------REALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIF--------NLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVY-GKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQRE----YIVTIIAKDNGTPSLSSPT-TAVXXXXXXXXXXXXXXXXXXXXXVEENTPPN--YLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYF---PQKTIR---ISIPEN-IPIGSEIIRISTI--DLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRET-------KDEYAFEVQVVEKDNVN-----FTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSY 1911
            FAI P++G L   +++D            R       +  D   R    E  + A++   S K       T+ + ++NDN P F + +    ++E+   GT +   +A D D   F  + Y+++  +  +         +S +   D      +Q  L+V     F  +    T+T             V + D+ND+ PE+    Y   I ENL   +I+    ATD D+   G++S+        +I     G  F+I+        +G +     L RE    Y +T+ A D+G  S        V  +++ ++ P I +      ++ E        L      D D  +NG++   +      F L  +T  + I+        LD E +    LII   D G P  T+   + V ++DVNDN   F   P +++    I++ E    I   +I I+    D D   +VA+S+       F  +D   G L+  +  DRE+       + +  F + +   D         + TV+V + + D NDN P F +  Y   + E       + +V A D DL   G V Y
Sbjct:  308 FAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGE--EKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELRGGQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVT-------------VTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSF--------NISAGDDGGHFSING-------SGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGDSRFTLNSATGRLQIS-----PTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSL-SGDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIY 864          

HSP 10 Score: 70.4774 bits (171), Expect = 4.244e-12
Identity = 104/386 (26.94%), Postives = 167/386 (43.26%), Query Frame = 1
Query: 1243 DNDEDANGKIECEILEWG--EYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTI---RISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARD--QGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSV 2376
            D D+ ANGKI  ++      + F++        +T EI ++ ++D E      L +Q +D G+P  +S+K  A  VI V D    FPQ +       I EN P+GS I  +     D+K                        ++++ +  R +    A  +   EK  +              IND  P+F+ + Y  ++ E+ S    IGRV A D D G N  + Y   +  +  +FY + S  G+I +   LD + +N++ + + A +   G   +  ++T V ITV D  +  P F      + LS +  +I  N+   T  DK   +T ++Y + N  P     LF ID +TG I  TV E D    T  +  V+ K SV
Sbjct:  946 DRDQGANGKITYKLTNGNKDDAFSINN------VTGEITVAGVIDREAVHTFVLTVQAEDQGEP--SSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAENSPVGSTITMVP----DQK------------------------ISSSTLRPRSSPRAPAALLTAREKRPITL------------INDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFY--SSNGAEAKFYVSRST-GDIIVDSPLDREFKNVYILNVTAANIVAG---AQDTTTQVHITVTDVIDDKPYFNSSSLTVKLS-ENASIGTNVTKITALDKDIGDT-ISYSIANGDPY---GLFTIDNVTGEI-RTVAELDRENVTQYELFVQAKDSV 1271          

HSP 11 Score: 65.855 bits (159), Expect = 8.596e-11
Identity = 70/283 (24.73%), Postives = 126/283 (44.52%), Query Frame = 1
Query:  271 HYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGN---LFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPS 1107
             +  F + P TG L   + +DRE+    S N     R  +L++T        S++    +  +I + D NDNSP F        ++E +  G+ +   SA D+D      ++Y  K    I+N++     D       +V+ +V     + +    C L      S     +++ V+D+ND+ P +  SKY   + EN    + +    A+D D    GK++Y           K  +GN    F+I+++TG++ + G +D E      +++T+ A+D G PS
Sbjct:  754 EHGFFRLDPVTGELSVRKELDRES-PQMSRNAQGDGR-FLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQD------LEYKGKV---IYNIT-----DGDENRKCEVEKLVRH---YNWHKKNCVLCKESKCSVERTYVVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITY-----------KLTNGNKDDAFSINNVTGEITVAGVIDREA--VHTFVLTVQAEDQGEPS 1004          

HSP 12 Score: 63.5438 bits (153), Expect = 5.068e-10
Identity = 62/243 (25.51%), Postives = 119/243 (48.97%), Query Frame = 1
Query: 1432 LTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVN--IDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFD-AHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFY--FTVSNY-GEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFAL 2142
            LT++++  + +I  ND    F +    +++ E+   G  I R++  D D+   +   I +SSN +     +  + G +  +   DRE K+ Y   V            T +V + ++D+ D+KP F+ +  +  + EN S+   + ++ A+D D+G+  T+SY     I+N   Y  FT+ N  GEIR   + ++D++N+ Q  +  + +     +S    V + V D N++PP F  P + +
Sbjct: 1071 LTAREKRPITLI--NDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEG--INAIIFYSSNGAEAKFYVSRSTGDIIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIGD--TISY----SIANGDPYGLFTIDNVTGEIRT--VAELDRENVTQYELFVQAKDSVNLVSDLLKVVVQVEDVNDNPPVFSMPGYTI 1301          

HSP 13 Score: 51.2174 bits (121), Expect = 2.566e-6
Identity = 56/236 (23.73%), Postives = 87/236 (36.86%), Query Frame = 1
Query:  205 YQMGINLNLTRGKNLKKYE---LIQHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFR--YDPIQCTLTAWDLNSSSSMR----LIVKVNDINDHSPEWPNSKYYIRIKENLLLDSII 885
            Y+  +  N+T G   +K E   L++HYN                       H  N   C + KC +E                R Y  I ++D+NDN P F +     ++ E SP GT +    A DRD      I Y +              +D  + +N+    I    +  R        T+ A D    SS +    +++ V D ND+ P++  + Y   I EN  + S I
Sbjct:  858 YKGKVIYNITDGDENRKCEVEKLVRHYN----------------------WHKKNCVLCKESKCSVE----------------RTYVVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGN----------KDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAENSPVGSTI 1045          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: ENSORLT00000036663.1 (pep primary_assembly:ASM223467v1:10:15171740:15179813:-1 gene:ENSORLG00000029341.1 transcript:ENSORLT00000036663.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 194.126 bits (492), Expect = 1.492e-50
Identity = 189/646 (29.26%), Postives = 305/646 (47.21%), Query Frame = 1
Query:  283 FAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKT-ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDP-IQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADT-VYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEEN-TPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPI----TYEIYLSQILDYEKQSMIA----LIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLD--KKSEVAFSIVHSS-----NCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHY-------SFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPF 2133
            F ++  TG L     IDRE LC     C           +I    +I +   P ++Y+  I I D+ND+SP F   +Q I I+E +  G    LHSA+D D    ++  Y +  +E      FS+ R K    N   +L++ +++    +  I  TLTA D  +   S +M +IV V DIND++P +  S Y   ++EN+   + I T  ATD D+ + G+VSYS       ++ +    ++F ID  TG +    N+DFEE    E +V   A DN    ++S    +I++ D NDN P I++   +  V+E+ +    +   +V D D   NG + C+I            + ++P      Y+ Y S ++D E    IA    + I   D GKP L+S   I V V D+NDNR  F +  + I + EN P GS +  +S +D D  +   V +S++H++       + +NI +  G + + + FD E    + F+VQ  +      +  V V + + D NDN P   A Y       S +IP       F+ ++RA+D D G N  +SY       N  F    S+ GEIR    +  +    H + ++  D G P S+S++ ++ + VL+S     + + PF
Sbjct:   76 FEVNLKTGALYVCEKIDREELCGNEAKC-----------SITVEAVINN---PLKLYRIEILILDVNDHSPVFQSESQRINISESTSAGKRFRLHSAEDADYERNSVTAYKLSPNE-----YFSLVRHKGE--NTVPELVLQKSLDRENESLIHLTLTAIDGGTPPKSGTMNIIVNVLDINDNAPVFSQSLYKASVQENVKKGTTIITLNATDLDSGLNGQVSYSFS-----EVGRGKQADIFQIDEKTGIVTNIKNIDFEEDSAFEILVQ--ASDNSLSPMTSDAKLLIEVVDVNDNAPEISVTSLLNSVKEDVSTGTAIALVSVLDKDSGKNGMVTCKI------------SNDVPFKLENNYKNYYSLVVDGELDREIAPQYNISITAADEGKPPLSSTSVIHVQVSDINDNRPLFTENIVNIFMKENSPSGSVLKTVSAVDADIEQNGRVTYSLLHTNINSMPLSTMINIRSETGEIISLQSFDYEKLKTFQFKVQATDSGVPPLSSNVTVNVFVLDENDNSPSILAPYSEHGSVNSENIPYPAEAGYFVAKIRAVDPDSGYNALLSYHLSEPKGNNLFRIGTSS-GEIRTKRRMSDNDLKSHPLLVLVSDNGEP-SLSATVSIEVVVLEST---ADMQTPF 676          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: PCDH17 (protocadherin-17 [Source:NCBI gene;Acc:101168002])

HSP 1 Score: 189.119 bits (479), Expect = 1.752e-48
Identity = 175/634 (27.60%), Postives = 289/634 (45.58%), Query Frame = 1
Query:  277 NIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTIC-----IEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSE-NIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD------TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNG-TPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPN-YLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPE-NIP---IGSEIIRISTIDLDKKSEVAFSIVHS-----SNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF------DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITV 2091
            ++  + P +G + T + IDRE LC  +        KC L + +FA+D            K IC     I+DINDNSPSFP     I+I+E +  GT   L  A D DS +  I  Y +   + N F+L   +  D        V+  + R     +  +   +   +   S SM++ V+V D ND+SP +  S Y I I ENL    I+    ATD D       VY    Y+  RI           +LF+ID  TG +K+ G +DFEE    E+ V   AKD G  P        V   +  +++P I  ++     + E  PP+  +    V D D   NG+++C +L     F L+++  N    Y +   + LD E +    + I  +D G P+L + +   V ++D NDN   F +    + +PE NIP   +GS  I     D+ +   V +SI+ S     S  ++V+++  NG +  +  F+ E    + F+VQ  +  + +   T  V + I D+NDN PV       +      +P N  +   +  V+A+D+D G++G ++Y ++ + ++   +      GE+R  H L  +   + ++ +   D G+P  +S+   + I V
Sbjct:   64 HLVDVDPESGLIFTKQRIDRETLCRRN-------PKCQLSMEVFAND------------KEICMIKIDIQDINDNSPSFPSDHVNIDISENAAAGTRFPLTIAHDLDSGENGIKTYQVTRDDYNTFSLDLKVRGDGTIYPELVVQRPLDREDQSHHTLLLTAIDGGEYPRSGSMQINVRVTDSNDNSPVFEKSSYVIEIPENLPPGKILIDLNATDQDEGSNGQVVYSFTGYASERIQ----------DLFSIDPNTGVIKVQGEIDFEENPIIEFDVQ--AKDLGPNPIPGHCKITVKVQDKNDNSPVITFVSVRQGAISEAAPPDSVIALVRVTDKDSGRNGQLQCRVL-GNVPFRLQENNDNF---YTLLTDRPLDRETRDEYNVTIVARDNGIPSLNNTRSFTVKILDENDNAPRFTKSLYVLQVPENNIPGEYLGS--ILAHDPDVGRNGTVTYSILPSHIGDVSVYTYVSVNPTNGAIYASRSFNYEQTKSFEFKVQAKDGGSPHMESTSTVRVNILDVNDNLPVIILPLLQNDTAEIPVPRNVGIGYIVATVKAVDHDHGDSGHLTY-EITEGNDDHLFEIDPVGGEVRTAHALWEEIAPVVELVVRVTDHGKP-PLSAVAKLIIKV 658          

HSP 2 Score: 102.449 bits (254), Expect = 1.341e-21
Identity = 83/277 (29.96%), Postives = 130/277 (46.93%), Query Frame = 1
Query: 1345 EIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKS--EVAFSIVHSSN---CSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPV--FDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLF--HMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTL 2148
            E+ + + LD E QS   L++   DGG+   +   +I V V D NDN   F + +  I IPEN+P G  +I ++  D D+ S  +V +S    ++       +ID N G +      D E      F+VQ  +          K+ +++ D NDN PV  F +    +I E    D  I  VR  D D G NG    +Q   + N  F    +N     L     LD + ++ + VTIVARD G P S++++ +  + +LD N++ P F K  + L +
Sbjct:  185 ELVVQRPLDREDQSHHTLLLTAIDGGEYPRSGSMQINVRVTDSNDNSPVFEKSSYVIEIPENLPPGKILIDLNATDQDEGSNGQVVYSFTGYASERIQDLFSIDPNTGVIKVQGEIDFEENPIIEFDVQAKDLGPNPIPGHCKITVKVQDKNDNSPVITFVSVRQGAISEAAPPDSVIALVRVTDKDSGRNGQ---LQCRVLGNVPFRLQENNDNFYTLLTDRPLDRETRDEYNVTIVARDNGIP-SLNNTRSFTVKILDENDNAPRFTKSLYVLQV 457          

HSP 3 Score: 74.7146 bits (182), Expect = 4.566e-13
Identity = 84/302 (27.81%), Postives = 134/302 (44.37%), Query Frame = 1
Query: 1501 KTIRISIPENIPIGSEIIRIS------TIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDA-HYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTV------SNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFP--------STDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTN 2343
            K +  S+PE    G+ I  I+      TI+  KKS   F ++ +S    V++D  +G + T +  DRET      + Q+  +   N  +   + + I DINDN P F + H +  I EN +         A D D GENG  +Y QV +     F   +      + Y E+ +   LD + Q+ H + + A D G     S S  + + V DSN++ P FEK  + +        I +NL P        +TD+D+   N ++ Y          + LF ID  TG I +   + + +F+ N
Sbjct:   19 KNLNYSVPEEQGPGTVIGNIAKDAGYGTIERGKKSN--FRVLENSAPHLVDVDPESGLIFTKQRIDRETLCRRNPKCQLSMEVFANDKEICMIKIDIQDINDNSPSFPSDHVNIDISENAAAGTRFPLTIAHDLDSGENGIKTY-QVTRDDYNTFSLDLKVRGDGTIYPELVVQRPLDREDQSHHTLLLTAIDGGE-YPRSGSMQINVRVTDSNDNSPVFEKSSYVI-------EIPENLPPGKILIDLNATDQDEG-SNGQVVYSFTGYASERIQDLFSIDPNTGVIKV---QGEIDFEEN 305          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: si:dkey-30k22.7 (si:dkey-30k22.7 [Source:ZFIN;Acc:ZDB-GENE-090313-302])

HSP 1 Score: 187.193 bits (474), Expect = 2.291e-48
Identity = 166/576 (28.82%), Postives = 277/576 (48.09%), Query Frame = 1
Query:  415 DLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRD--KQYKLNHQVKLIVTRNISFR-YDPIQCTLTAWDLN---SSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTV-YGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGT-PSLSSPTTAVXXXX----XXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEY-FNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVS-NYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITV 2091
            D + +    E I   I +EDIND+SP FP     +E++E SP G+   L  A+D+D   F    Y +       NL+   F D     K    + LI+++ +     D    T+  +D      +  ++L ++V D ND+ P +  ++Y+  I E+  + S +    ATD D    G+V+Y I R       ++   ++F+I+  TG + LN  LDFE +   E I  I A+DNG  P  SS    V  +             ++     +  E  +  +Y+   ++ D D +   KI    LE G+  F LK++       Y + +   LD E++ +  L ++  D G P L+S+  + + V+D ND    F ++   IS+ E++P+GS +I+++  D D+   ++V FSI+ ++    + ID  +G +TT    DRE+++E  F V   +      + T  V + + D+NDN+PVF    YS SIPE++ V   +    A D+D G NG V Y     + +    F +  N G + L   L    Q+ + + IVA D+G P S+SS  T+ + V
Sbjct:  114 DFVAATLTGEVIRVRIEVEDINDHSPVFPSGEVELEVSELSPTGSRFHLEGAEDQDEGLFGTQGYRIIEG----NLTDYFFLDYWSSSKPPLNLDLILSKKLDRETQDVFSLTIEGFDGGIPARTGRLQLKIRVLDENDNPPVFNQTEYHTSIHEDAPVGSFVCQIHATDPDLGDNGRVTYEINR------RQSDLNHVFSINETTGVVYLNQKLDFETQPFHELI--IRARDNGAQPEYSSTFVGVKVLNINDNSPTITVLFLSETGEALVSEAASVGDYVARISLSDPDLEEE-KISV-TLEGGDGKFTLKQTD---DFLYALCVHSELDREEEDLYELRVKATDSGSPPLSSEMVLLLKVLDANDCLPVFEKEVYTISVAEDLPLGSSVIQMTARDADEGPNADVRFSILKTNQDGLIRIDPQSGLVTTAAALDRESQEELWFLVVAADGGEPTLSSTATVSVTLEDVNDNEPVFQQQLYSVSIPEHSDVGSLLFIAHAHDHDSGANGRVRYY----LKHTGGLFAIERNLGTVTLNQSLQGGHQSSYGLEIVAEDEGDP-SLSSILTLLVDV 667          

HSP 2 Score: 107.071 bits (266), Expect = 4.508e-23
Identity = 114/405 (28.15%), Postives = 180/405 (44.44%), Query Frame = 1
Query:  769 SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFT-VFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNV-IDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDL--DKKSEVAFSIVHSSNCSF----VNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNV--NFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFY 1947
            SS M L++KV D ND  P +    Y I + E+L L S +    A DAD      V +SI         KT    L  ID  +G +     LD E   Q E    ++A D G P+LSS  T  + +ED NDN P+       + + E++    L +     D+D  ANG++   +   G  F ++++   +       L+Q L    QS   L I  +D G P+L+S   + V+V     ++ + F     ++ I E     S +I++        + S    +    +   F      +    G+L  +   D E +  + F+V     D    N T T  VI+ + DINDN PVF    Y F++ E +S  G +G V A+D D G+N  +SY+    +S+ +F+
Sbjct:  450 SSEMVLLLKVLDANDCLPVFEKEVYTISVAEDLPLGSSVIQMTARDADEGPNADVRFSI--------LKTNQDGLIRIDPQSGLVTTAAALDRES--QEELWFLVVAADGGEPTLSSTATVSVTLEDVNDNEPVFQQQLYSVSIPEHSDVGSLLFIAHAHDHDSGANGRVRYYLKHTGGLFAIERNLGTVT------LNQSLQGGHQSSYGLEIVAEDEGDPSLSSILTLLVDVDQKAAEDNLAFETLVYQVEIGEAYRKDSRVIQVRAHQTWGARTSNTDLTYSLETEPGFPPAPFRVHPKTGWLYLSNSLDFEAESRFRFQVLATSTDASLENTTATATVIVHVLDINDNAPVFGREVYYFTVSEGSSPQGLVGTVEAVDKDSGKNSQLSYI---LLSDGKFF 835          

HSP 3 Score: 92.4337 bits (228), Expect = 1.462e-18
Identity = 100/422 (23.70%), Postives = 187/422 (44.31%), Query Frame = 1
Query: 1243 DNDEDANGKIECEILEWG--EYFNLK-KSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTI--DLDKKSEVAFSI-VHSSNCSFV-NIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHY-----SFSIPENTSVDGFIGRVRAIDNDL----------GENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPST--DKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIILEN 2436
            D DE   G     I+E    +YF L   S++  P+  ++ LS+ LD E Q + +L I+  DGG P  T + ++ + V+D NDN   F Q     SI E+ P+GS + +I     DL     V + I    S+ + V +I+   G +  N+  D ET+  +   ++  +        +  V +++ +INDN P     +        + E  SV  ++ R+   D DL          G +G  +  Q +      F + +  + E      LD ++++++++ + A D G P  +SS   + + VLD+N+  P FEK  + ++++ +   +  ++   T  D D+ P N  + +   +I       L +ID  +G +              ++E++   V   D  +P    +  + + LE+
Sbjct:  167 DQDEGLFGTQGYRIIEGNLTDYFFLDYWSSSKPPLNLDLILSKKLDRETQDVFSLTIEGFDGGIPARTGRLQLKIRVLDENDNPPVFNQTEYHTSIHEDAPVGSFVCQIHATDPDLGDNGRVTYEINRRQSDLNHVFSINETTGVVYLNQKLDFETQPFHELIIRARDNGAQPEYSSTFVGVKVLNINDNSPTITVLFLSETGEALVSEAASVGDYVARISLSDPDLEEEKISVTLEGGDGKFTLKQTDD-----FLYALCVHSE------LDREEEDLYELRVKATDSGSP-PLSSEMVLLLKVLDANDCLPVFEKEVYTISVA-EDLPLGSSVIQMTARDADEGP-NADVRF---SILKTNQDGLIRIDPQSGLVTTA-----AALDRESQEELWFLVVAADGGEPTLSSTATVSVTLED 566          

HSP 4 Score: 57.3806 bits (137), Expect = 7.800e-8
Identity = 68/292 (23.29%), Postives = 123/292 (42.12%), Query Frame = 1
Query: 1507 IRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFV----NIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYG--------EIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLS---------CQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVK 2316
            + +S+ E +P    I+      L ++S   F  +  S  S+V     ID ++G ++T  + DRE +D+Y F    +        + ++V + + DIND+ PVF        + E +          A D D G  GT  Y  +    N   YF +  +         ++ L   LD + Q++  +TI   D G P + +    + I VLD N++PP F +  +  ++          CQ    D +L          +N ++ Y + N +  +   +F I++ TG + +  K
Sbjct:   48 LTLSVKEGLP-ARTIVGDLGAGLSRRSTGFF--ISESRDSYVFRDLEIDADSGIISTAVVLDRENRDKYDFVAATLTG------EVIRVRIEVEDINDHSPVFPSGEVELEVSELSPTGSRFHLEGAEDQDEGLFGTQGYRIIE--GNLTDYFFLDYWSSSKPPLNLDLILSKKLDRETQDVFSLTIEGFDGGIP-ARTGRLQLKIRVLDENDNPPVFNQTEYHTSIHEDAPVGSFVCQIHATDPDL---------GDNGRVTYEI-NRRQSDLNHVFSINETTGVVYLNQK 317          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: si:ch73-379j16.2 (si:ch73-379j16.2 [Source:ZFIN;Acc:ZDB-GENE-141215-68])

HSP 1 Score: 182.185 bits (461), Expect = 4.799e-47
Identity = 171/626 (27.32%), Postives = 301/626 (48.08%), Query Frame = 1
Query:  283 FAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISF-RYDPIQCTLTAWDLNS---SSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPN-YLDYFTVFDNDEDANGKIECEILEWGEYFNLKKS-TANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSN------CSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF--------DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLD 2097
            F ++ + G L   ++IDRE +C + +        C++ L I A       KP E  Y  + I D+NDNSPSF +  +T++I+E +P G   ++ +A+D D +   +  Y +  +E  FN+      + +        L++ + +   ++   +  LTA D  S   S ++ + V V D ND+SP +    Y   I EN+ + S + T  ATD D  V   V YS G  +    P+ +   +F+I+  +G++ + G +DFE+     Y + + A D G P +++    +I + D NDN P I +      V E++ P   +   ++ D D   NGK+ C  L+    F+LK S   N+   Y + + Q LD E  S   ++I   D G+P L++ K ++++V DVNDN+  F Q  + + + EN   G+ I  +S +D D       + V   +       +F+NI+   G ++  + FD E+   + F V   +  +   +  V V + I D NDN PV          A     IP N +    + +VRA D D+G NG + +  + Q+++   +      G+IR         +  H++ I+ +D G  +S+S++ TV + +++
Sbjct:   76 FEVNENNGVLYVRKNIDREEICESIS-------PCLINLKIVAE------KPMEIHYVAVEIMDVNDNSPSFQDGEKTLDISESTPAGKRFQMPTARDPDVALNTVRMYKLNQNE-YFNVKVREGEEDKIPF-----LVLQKPLDREKHAEHKLILTAVDGGSPPKSGTLNVTVTVLDTNDNSPIFTQEIYSAIINENIKVGSNVITVNATDLDEGVNADVEYSFGGEL---DPQIYE--IFSINKHSGEISVKGEIDFEK--AEVYKLDVHASDKGQPPMNADCRVIIKVLDQNDNLPEIEVTSLSKSVSEDSKPGTVVSLISITDRDSGLNGKVICS-LQDSVPFDLKPSFQENM---YSLVVKQPLDRESVSHYDILITATDCGQPTLSTFKTVSIDVADVNDNKPEFTQNPVELYLTENNTPGNVICSVSALDKDLNENAILTYVVRGDTGQLISAAFLNINPETGEISALKSFDFESVKTFQFHVVATDSGSPPLSSNVTVNVFILDQNDNAPVILYPVSSNGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLF-SLQQVTDHSLFALDRYTGQIRTLRSFTETDEAEHKLLILVKDNGN-VSLSATATVIVKLVE 669          

HSP 2 Score: 90.5077 bits (223), Expect = 5.637e-18
Identity = 88/346 (25.43%), Postives = 149/346 (43.06%), Query Frame = 1
Query: 1297 EYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSIVHSSNCSFVNIDTNNGY-LTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAH-YSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYV---QVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNL----FPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTI 2301
            E F++ K +  I +  EI      D+EK  +  L +   D G+P + +  R+ + V+D NDN       ++  S+ E+   G+ +  IS  D D     +V  S+  S           N Y L   +  DRE+   Y   +   +      +    V + ++D+NDNKP F  +     + EN +    I  V A+D DL EN  ++YV      Q+ +  F       GEI      D +     Q  +VA D G P  +SS+ TV + +LD N++ P    P  +   +   + I +N+      +  +    +     +LL +++ +   SLF +D+ TG I
Sbjct:  291 EIFSINKHSGEISVKGEI------DFEKAEVYKLDVHASDKGQPPMNADCRVIIKVLDQNDNLPEIEVTSLSKSVSEDSKPGTVVSLISITDRDSGLNGKVICSLQDSVPFDLKPSFQENMYSLVVKQPLDRESVSHYDILITATDCGQPTLSTFKTVSIDVADVNDNKPEFTQNPVELYLTENNTPGNVICSVSALDKDLNENAILTYVVRGDTGQLISAAFLNINPETGEISALKSFDFESVKTFQFHVVATDSGSP-PLSSNVTVNVFILDQNDNAPVILYPVSSNGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQQVTDHSLFALDRYTGQI 629          

HSP 3 Score: 90.1225 bits (222), Expect = 7.105e-18
Identity = 88/318 (27.67%), Postives = 146/318 (45.91%), Query Frame = 1
Query: 1285 LEWGEYFNLKKSTA---NIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKK--SEVAFSI---VHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDA-HYSFSIPENTSVDGFIGRVRAIDNDLGENGTV-SYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLS---------CQTQTIDKNL 2181
            L   EYFN+K        IP    + L + LD EK +   LI+   DGG P  +    + V V+D NDN   F Q+     I ENI +GS +I ++  DLD+   ++V +S    +        +I+ ++G ++     D E  + Y  +V   +K         +VI+++ D NDN P  +    S S+ E++     +  +   D D G NG V   +Q +   + +  F  + Y  + +   LD +  + + + I A D G+P ++S+  TV I V D N++ PEF +    L L+         C    +DK+L
Sbjct:  173 LNQNEYFNVKVREGEEDKIPF---LVLQKPLDREKHAEHKLILTAVDGGSPPKSGTLNVTVTVLDTNDNSPIFTQEIYSAIINENIKVGSNVITVNATDLDEGVNADVEYSFGGELDPQIYEIFSINKHSGEISVKGEIDFEKAEVYKLDVHASDKGQPPMNADCRVIIKVLDQNDNLPEIEVTSLSKSVSEDSKPGTVVSLISITDRDSGLNGKVICSLQDSVPFDLKPSFQENMYSLV-VKQPLDRESVSHYDILITATDCGQP-TLSTFKTVSIDVADVNDNKPEFTQNPVELYLTENNTPGNVICSVSALDKDL 485          

HSP 4 Score: 54.299 bits (129), Expect = 7.018e-7
Identity = 72/304 (23.68%), Postives = 137/304 (45.07%), Query Frame = 1
Query: 1507 IRISIPENIPIGSEIIRIS---TIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDE----YAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVF-DAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHM-----LDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFP--STDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVS 2373
            I+ S+PE + +GS +  ++    +D+    +    +V  +  +   ++ NNG L   +  DRE   E        +++V +  +       V + I D+NDN P F D   +  I E+T          A D D+  N TV   ++NQ  N+ F   V    E ++  +     LD +K   H++ + A D G P   S +  V +TVLD+N++ P F +  ++  ++ +   +  N+    +TD D+   N  + Y        +   +F I+K +G I++   + + +F+     K+++  S
Sbjct:   32 IKYSVPEEVKVGSVVGNVARDLGLDISSLKDRRARVVSGNEDAQFEVNENNGVLYVRKNIDREEICESISPCLINLKIVAEKPMEIH---YVAVEIMDVNDNSPSFQDGEKTLDISESTPAGKRFQMPTARDPDVALN-TVRMYKLNQ--NEYFNVKVREGEEDKIPFLVLQKPLDREKHAEHKLILTAVDGGSP-PKSGTLNVTVTVLDTNDNSPIFTQEIYSAIIN-ENIKVGSNVITVNATDLDEGV-NADVEYSFGGELDPQIYEIFSINKHSGEISV---KGEIDFEKAEVYKLDVHAS 323          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: ENSORLT00000005220.2 (pep primary_assembly:ASM223467v1:10:15161680:15164187:-1 gene:ENSORLG00000004171.2 transcript:ENSORLT00000005220.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.956 bits (463), Expect = 5.164e-47
Identity = 183/654 (27.98%), Postives = 305/654 (46.64%), Query Frame = 1
Query:  232 TRGKNLKKYELIQHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKT-ICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDAD-TVYGKVSYSI---GRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTP-PNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTI--DLDKKSEVAFSIVHSSNC-----SFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHY-------SFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPF 2133
            T G  +K   L ++   F +   +G L     IDRE LC           KC L +    S+       P  +++  + I DINDN+P+F E   T+EI+E S +G    L  A D D    ++  Y +  +E+ F+L      ++       ++ +V R     Y+ I   L       + S+ + V V D+ND+SP +    Y +++ EN +L + +    A+D D  V G+V Y+    GR+   D         F +++ TG++ + G+LDFEE   + Y + + A+D G P  S+ +  ++++ D NDN P I+++  +  V E+      +    V D D   NGK  C+I+     F LK +  N    Y +  S  LD E  S   + +   D G P+L+S   I V V DVNDN   F    I + + EN PIG+ + ++  +  DLD+ ++  + ++ + N      S V I++  G +T+ + FD E    + F+VQ  +      +  V V + + D NDN P   A Y       S +IP +     F+ ++RA+D D G N  +SY       N  F    S+ GEIR    +  +    H + ++  D G P S+S++ ++ + VL+S     + + PF
Sbjct:   58 TSGLQIKSGYLKRY---FEVDRESGNLYVNDRIDREELCPN-------MLKCALNIEASLSN-------PRGLHRIEVVITDINDNAPAFVEEVTTVEISESSYVGERYPLARAHDADVGINSVKTYKLSPNEH-FSLDVQSTGEQNVFAELVLQKVVDREKQPHYELILTALDGGKPPKTGSLLIKVNVLDVNDNSPAFSYPLYKVQVVENAVLGTTLLRLAASDLDEGVNGQVVYTFTEKGRLSPDDT--------FFLNNETGEVTVKGSLDFEE--TQAYEIRVQARDKGNPPRSAHSKILVEVIDVNDNVPDISVSSLMSPVSEDAEIGTAVARVQVNDRDGGKNGKTNCKIMN-SVPFQLKSNYKNY---YSLSTSGSLDRETVSEYNITLLATDDGTPSLSSTHIITVQVSDVNDNPPRFLDSQINVYVKENSPIGTTMYKLKAVDADLDENAKSTYQLIKTPNVKAQMTSLVTINSETGEITSLKSFDFEELKTFQFKVQATDFGVPPLSSNVTVNVFVLDENDNSPSILAPYSEHGSVNSENIPYSAEAGYFVAKIRAVDADSGYNALLSYHLSEPKGNNLFRIGTSS-GEIRTKRRMSDNDLKSHPLLVLVSDNGEP-SLSATVSIEVVVLEST---ADMQTPF 674          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000048913.1 (SMESG000048913.1)

HSP 1 Score: 1937.54 bits (5018), Expect = 0.000e+0
Identity = 1030/1034 (99.61%), Postives = 1032/1034 (99.81%), Query Frame = 1
Query:   55 MISLRLNQISHRSLDNFQMXXXXXXXXXXXXGYGNGLSSHCDAEIKELDIYQMGINLNLTRGKNLKKYELIQHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIILENERYHKNVNEEINRSNQGPMDISTNKKYKGPHPETENTQIPEESVDQNXXXXXXXXXXXXXXXXXXXXXXXXVKKRRQADDEQDVNENTIMVREKVNASIQSGNKSDFHEHSVDSYQMPMKKINSQVIRYPTMTDNRKEKHAISDINSSLTPMPSVEPNYQKSILQYEIAKMKDNNTYQSLTINPKFANVDQSFSTVYSFQQNQSLSTRASPIDKNQNIVXXXXXXXXXXXXRSYISVSFV 3156
            MISLRLNQISHRSLDNFQMIFFILTLVVIIVGYGNGLSSHCDAEIKELDIYQMGINLNLTRGKNLKKYELIQHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVT+NISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENL LDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVIDIEDFNDNPPIININRGIIDVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQ QTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIILENERYHKNVNEEINRSNQGPMDISTNKKYKGPHPETENTQIPEESVDQNITIIMVLIFVILFLGIFLITIICFVKKRRQADDEQDVNENTIMVREKVNASIQSGNKSDFHEHSVDSYQMPMKKINSQVIRYPTMTDNRKEKHAISDINSSLTPMPSVEPNYQKSILQYEIAKMKDNNTYQSLTINPKFANVDQSFSTVYSFQQNQSLS+RASPIDKNQNIVNNPNLITNQPNNRSYISVSFV
Sbjct:    1 MISLRLNQISHRSLDNFQMIFFILTLVVIIVGYGNGLSSHCDAEIKELDIYQMGINLNLTRGKNLKKYELIQHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTQNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLPLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVIDIEDFNDNPPIININRGIIDVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQIQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIILENERYHKNVNEEINRSNQGPMDISTNKKYKGPHPETENTQIPEESVDQNITIIMVLIFVILFLGIFLITIICFVKKRRQADDEQDVNENTIMVREKVNASIQSGNKSDFHEHSVDSYQMPMKKINSQVIRYPTMTDNRKEKHAISDINSSLTPMPSVEPNYQKSILQYEIAKMKDNNTYQSLTINPKFANVDQSFSTVYSFQQNQSLSSRASPIDKNQNIVNNPNLITNQPNNRSYISVSFV 1034          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000048913.1 (SMESG000048913.1)

HSP 1 Score: 1903.26 bits (4929), Expect = 0.000e+0
Identity = 999/1003 (99.60%), Postives = 1001/1003 (99.80%), Query Frame = 1
Query:  148 GYGNGLSSHCDAEIKELDIYQMGINLNLTRGKNLKKYELIQHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIILENERYHKNVNEEINRSNQGPMDISTNKKYKGPHPETENTQIPEESVDQNXXXXXXXXXXXXXXXXXXXXXXXXVKKRRQADDEQDVNENTIMVREKVNASIQSGNKSDFHEHSVDSYQMPMKKINSQVIRYPTMTDNRKEKHAISDINSSLTPMPSVEPNYQKSILQYEIAKMKDNNTYQSLTINPKFANVDQSFSTVYSFQQNQSLSTRASPIDKNQNIVXXXXXXXXXXXXRSYISVSFV 3156
            GYGNGLSSHCDAEIKELDIYQMGINLNLTRGKNLKKYELIQHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVT+NISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENL LDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVIDIEDFNDNPPIININRGIIDVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQ QTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIILENERYHKNVNEEINRSNQGPMDISTNKKYKGPHPETENTQIPEESVDQNITIIMVLIFVILFLGIFLITIICFVKKRRQADDEQDVNENTIMVREKVNASIQSGNKSDFHEHSVDSYQMPMKKINSQVIRYPTMTDNRKEKHAISDINSSLTPMPSVEPNYQKSILQYEIAKMKDNNTYQSLTINPKFANVDQSFSTVYSFQQNQSLS+RASPIDKNQNIVNNPNLITNQPNNRSYISVSFV
Sbjct:   14 GYGNGLSSHCDAEIKELDIYQMGINLNLTRGKNLKKYELIQHYNIFAIHPSTGFLQTIRSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTQNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLPLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPSLSSPTTAVIDIEDFNDNPPIININRGIIDVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQIQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIILENERYHKNVNEEINRSNQGPMDISTNKKYKGPHPETENTQIPEESVDQNITIIMVLIFVILFLGIFLITIICFVKKRRQADDEQDVNENTIMVREKVNASIQSGNKSDFHEHSVDSYQMPMKKINSQVIRYPTMTDNRKEKHAISDINSSLTPMPSVEPNYQKSILQYEIAKMKDNNTYQSLTINPKFANVDQSFSTVYSFQQNQSLSSRASPIDKNQNIVNNPNLITNQPNNRSYISVSFV 1016          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000010555.1 (SMESG000010555.1)

HSP 1 Score: 349.362 bits (895), Expect = 1.189e-103
Identity = 247/748 (33.02%), Postives = 385/748 (51.47%), Query Frame = 1
Query:  223 LNLTRGKNLKKYELIQHYNIFAIHPSTGFLQTIRSIDREALCHA---SNNCDCLKRKCVLE--LTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTPS---LSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEK----VEIKVSVFDPTKPLFRGSTILQIIL 2430
            +N+   +N   Y ++   ++ +I+   G ++  R  DRE LC     S +C C +  C +   ++I  + +++SN PP+R    IC+ D NDN P          I E + IG +L L  A D DS   +   YD+KC+ +      ++  +K  +L     L      S       C L A +     +  + V V D NDH P W    + + I EN   ++ I    ATD+D+ Y  + YSI         +    +LF I+   G ++L G LD+E+  ++   +T+   DNG       S+  T  I + D NDN P I I   I  ++EN P  YL   TV D D   NG + C +    +  +L +S  +    Y+I+ S   D+E  S +++ I C D G+P L+S   + + + DV+DN V F +K     + E   IG+ + +I  +D D  S + + +    + +FV +D   G + +N++FDRETKDEY   V V EK + N TD+  ++++I DINDN P FD  YSFS+ E   ++  IG+V A D DL  NGTV Y Q  ++   +F F V   G+IRLF  LD + Q +H + IVA D+G P+S SS+TTV ++V+D N++PP+F+  +F + + C T+ I ++L P TD D   +N +M + L  + P     LF+ID  TG I M + +     KT   EK    +E+K+ VFDPT   F+   +L++ L
Sbjct:   39 INVDGPRNKYHYSIVPESSVVSIN-QEGIIRFKRGTDREWLCKLTDLSASCHCKEAVCKIPFGISIQENSIVKSN-PPKRKQIEICVRDKNDNCPKLQNPIHLTMI-ESAKIGFKLPLQEAVDNDSPLHSKSVYDLKCNADSKKFKLTMIDNKFPQLELISSLDHETTTSH-----TCKLEACEPKCCDTAVVTVTVIDDNDHPPIWTVLSWQVTIPENTPSNTQIMQLSATDSDSTYNVLRYSI---------EGPGQDLFLIEG-PGIIRLLGVLDYEKLEEKTIFLTVKVTDNGLSQSTIKSATGTVTISVSDVNDNRPFIYIKNNIFSIDENVPRMYLGDMTVTDADSGINGDVSCLVAYPEDKISLSESKMSSNTIYDIFTSSSFDHEVSSRVSVKIVCSDNGQPKLSSSVELFLRIKDVDDNNVKFIKKFFATGVDEGKEIGTFLAKIEAVDKDSTSSLEYYLTDKKDLAFVELDRQTGVVRSNQVFDRETKDEYKINVTVREKFSPNKTDSAILLIKILDINDNDPKFDRLYSFSVSERKEINFQIGKVNAEDPDLRNNGTVVYTQ-QRLDEYQFPFFVDQLGKIRLFQRLDYEIQPLHHLIIVATDRGHPVSRSSTTTVIVSVIDENDNPPKFKSRYFEIDIGCHTRVISRDLIPVTDNDTDTKNRQMQFNLQMVTPSYLMKLFRIDNQTGEITMDIDQQ----KTLTCEKLPKLIELKIRVFDPTFTEFKDHCVLKLKL 763          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000002712.1 (SMESG000002712.1)

HSP 1 Score: 211.075 bits (536), Expect = 9.629e-56
Identity = 202/720 (28.06%), Postives = 337/720 (46.81%), Query Frame = 1
Query:  322 RSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRD-SSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTV-YGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKD---NGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEY-FNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYL-TTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFY---FTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPST----DKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFD-PTKPLFRGSTILQIILEN 2436
            + ID E LC  SN C C +  C ++  +  +D    N   + +   + I D+NDN+P F  + QTI + E  P+   + L SA DRD S++  I  Y ++ S N F L  S F     +L  ++     +         + TL A D +S +   LI+ V D ND+ P +  + Y + I EN    S++ T  A D D+   G V Y+I      D+ +TF      I+S +G+++L   L   +R  + Y   ++AKD   N       P    ++  +       I      ++V ENT P  L    V DND   N K+ CE+    +  F L K   N+   Y +   +  D+E   + +  I+C D G P  ++ + + V++ D+N+    F Q    +S+ EN    +++++++  D D  + + +S+      +F  ID  +G++ T N + DRE  +   F     +     FT T K+I+ I D NDN P+F     F++ EN      IGR+ A D D G N  V +V +  ++ ++     F+VS  G I     LD +    + + +  RD+G+   M++ST V + VLD N++ P++  P         T+ I+KN    T    D D   EN ++ Y + N KP   + +F +D+ +G I + VKE D        +++E+ +   D  TKP      +L++I+ N
Sbjct:   74 KRIDLETLCQNSNIC-CGQFLCFIQTKVLVND---RNDFIDSLTVNLQINDLNDNTPLFSTIEQTITLRESLPVNYSMSLESAFDRDFSAENRIESYKLEDSSNKFELDTSKFPQISLRLKSELDYETRKQY-------RLTLKACDRDSCTDKELIIDVQDENDNKPIFTKNFYKVSILENTDTGSLVVTVNAYDKDSGDLGLVMYNIDAPNDLDLIQTFG-----INSNSGEIRLERRLAANQR--KLYTFHVVAKDSDFNNPQKEKVPVEITVEDINNYYPVIAILSTNERVEVRENTLPGNLITIKVSDNDIGMNSKVNCELQTESKIDFQLLKKKENL---YSLASVRSFDFESGQVKSASIKCTDSGSPPKSTDRSVLVHITDMNEYSPEFKQLIYEVSLRENTATNTKVLQLNATDRDGAASIRYSLDEKGK-AFFKIDHMSGWIKTKNVVLDREVIETIVFNAFAHDAYVDPFTATTKIIVTIEDENDNAPIFGVIPEFTVKENMISTRLIGRLTATDADKGNNSQVEFVLLKTLARKQEVQKIFSVSKEGFIETLQSLDRETFESYTLEVGVRDKGK-YPMATSTNVTVKVLDENDNKPQWMNPNPINPEYNITRIINKNELVMTVQAFDTDAG-ENGRIKYRIHNPKPNSKQPVFSLDEDSGEIRL-VKELDF-------DQIELTIIASDSATKPKM---VMLKLIINN 758          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000002712.1 (SMESG000002712.1)

HSP 1 Score: 210.69 bits (535), Expect = 1.086e-55
Identity = 202/720 (28.06%), Postives = 337/720 (46.81%), Query Frame = 1
Query:  322 RSIDREALCHASNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPELTQTIEINEKSPIGTELELHSAQDRD-SSDFAIIKYDMKCSENIFNLSFSIFRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVNDINDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTV-YGKVSYSIGRIMVRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKD---NGTPSLSSPTTAVXXXXXXXXXXXXXXXXXXXXXVEENTPPNYLDYFTVFDNDEDANGKIECEILEWGEY-FNLKKSTANIPITYEIYLSQILDYEKQSMIALIIQCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEIIRISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYL-TTNEMFDRETKDEYAFEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGFIGRVRAIDNDLGENGTVSYVQVNQISNQRFY---FTVSNYGEIRLFHMLDIDKQNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSCQTQTIDKNLFPST----DKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIAMTVKENDCNFKTNNKEKVEIKVSVFD-PTKPLFRGSTILQIILEN 2436
            + ID E LC  SN C C +  C ++  +  +D    N   + +   + I D+NDN+P F  + QTI + E  P+   + L SA DRD S++  I  Y ++ S N F L  S F     +L  ++     +         + TL A D +S +   LI+ V D ND+ P +  + Y + I EN    S++ T  A D D+   G V Y+I      D+ +TF      I+S +G+++L   L   +R  + Y   ++AKD   N       P    ++  +       I      ++V ENT P  L    V DND   N K+ CE+    +  F L K   N+   Y +   +  D+E   + +  I+C D G P  ++ + + V++ D+N+    F Q    +S+ EN    +++++++  D D  + + +S+      +F  ID  +G++ T N + DRE  +   F     +     FT T K+I+ I D NDN P+F     F++ EN      IGR+ A D D G N  V +V +  ++ ++     F+VS  G I     LD +    + + +  RD+G+   M++ST V + VLD N++ P++  P         T+ I+KN    T    D D   EN ++ Y + N KP   + +F +D+ +G I + VKE D        +++E+ +   D  TKP      +L++I+ N
Sbjct:   73 KRIDLETLCQNSNIC-CGQFLCFIQTKVLVND---RNDFIDSLTVNLQINDLNDNTPLFSTIEQTITLRESLPVNYSMSLESAFDRDFSAENRIESYKLEDSSNKFELDTSKFPQISLRLKSELDYETRKQY-------RLTLKACDRDSCTDKELIIDVQDENDNKPIFTKNFYKVSILENTDTGSLVVTVNAYDKDSGDLGLVMYNIDAPNDLDLIQTFG-----INSNSGEIRLERRLAANQR--KLYTFHVVAKDSDFNNPQKEKVPVEITVEDINNYYPVIAILSTNERVEVRENTLPGNLITIKVSDNDIGMNSKVNCELQTESKIDFQLLKKKENL---YSLASVRSFDFESGQVKSASIKCTDSGSPPKSTDRSVLVHITDMNEYSPEFKQLIYEVSLRENTATNTKVLQLNATDRDGAASIRYSLDEKGK-AFFKIDHMSGWIKTKNVVLDREVIETIVFNAFAHDAYVDPFTATTKIIVTIEDENDNAPIFGVIPEFTVKENMISTRLIGRLTATDADKGNNSQVEFVLLKTLARKQEVQKIFSVSKEGFIETLQSLDRETFESYTLEVGVRDKGK-YPMATSTNVTVKVLDENDNKPQWMNPNPINPEYNITRIINKNELVMTVQAFDTDAG-ENGRIKYRIHNPKPNSKQPVFSLDEDSGEIRL-VKELDF-------DQIELTIIASDSATKPKM---VMLKLIINN 757          
The following BLAST results are available for this feature:
BLAST of Protocadherin-9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDHA112.412e-5527.14protocadherin alpha 11 [Source:HGNC Symbol;Acc:HGN... [more]
PCDHA114.366e-5527.14protocadherin alpha 11 [Source:HGNC Symbol;Acc:HGN... [more]
PCDHA126.399e-5125.75protocadherin alpha 12 [Source:HGNC Symbol;Acc:HGN... [more]
PCDHA126.945e-5125.75protocadherin alpha 12 [Source:HGNC Symbol;Acc:HGN... [more]
PCDHA121.137e-5025.75protocadherin alpha 12 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-11.083e-3625.77FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-11.736e-3126.39FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-49.840e-2925.93Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
cdh-13.855e-2624.60CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
hmr-12.090e-2323.51Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kug3.203e-3927.46gene:FBgn0261574 transcript:FBtr0332722[more]
kug3.398e-3927.46gene:FBgn0261574 transcript:FBtr0346077[more]
kug3.398e-3927.46gene:FBgn0261574 transcript:FBtr0332721[more]
ds4.202e-3626.01gene:FBgn0284247 transcript:FBtr0078045[more]
ds4.202e-3626.01gene:FBgn0284247 transcript:FBtr0343249[more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh2ab32.184e-5229.32protocadherin 2 alpha b 3 [Source:ZFIN;Acc:ZDB-GEN... [more]
pcdh2ab92.485e-5029.30protocadherin 2 alpha b 9 [Source:ZFIN;Acc:ZDB-GEN... [more]
si:dkeyp-115d7.21.534e-4927.89si:dkeyp-115d7.2 [Source:ZFIN;Acc:ZDB-GENE-141215-... [more]
pcdh172.007e-4928.66protocadherin 17 [Source:ZFIN;Acc:ZDB-GENE-090608-... [more]
pcdh2ab52.554e-4827.73protocadherin 2 alpha b 5 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vat1l1.403e-4929.23vesicle amine transport 1-like [Source:Xenbase;Acc... [more]
cdkn2aipnl2.779e-4830.83CDKN2A interacting protein N-terminal like [Source... [more]
ENSXETT00000039438.11.862e-4728.14pep primary_assembly:Xenopus_tropicalis_v9.1:3:183... [more]
abhd82.438e-4730.28Xenopus tropicalis protocadherin gamma subfamily A... [more]
ENSXETT00000039400.12.601e-4730.32pep primary_assembly:Xenopus_tropicalis_v9.1:3:184... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdhb49.540e-5126.85protocadherin beta 4 [Source:MGI Symbol;Acc:MGI:21... [more]
Pcdha114.304e-5026.85protocadherin alpha 11 [Source:MGI Symbol;Acc:MGI:... [more]
Pcdh194.724e-5029.21protocadherin 19 [Source:MGI Symbol;Acc:MGI:268556... [more]
Pcdha24.816e-5026.73protocadherin alpha 2 [Source:MGI Symbol;Acc:MGI:2... [more]
Pcdha115.347e-5026.85protocadherin alpha 11 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y5I1|PCDAB_HUMAN2.097e-5427.14Protocadherin alpha-11 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q5DRF3|PCDAB_PANTR9.989e-5326.65Protocadherin alpha-11 OS=Pan troglodytes OX=9598 ... [more]
sp|Q9UN75|PCDAC_HUMAN5.462e-5025.75Protocadherin alpha-12 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q8TAB3|PCD19_HUMAN9.465e-5029.37Protocadherin-19 OS=Homo sapiens OX=9606 GN=PCDH19... [more]
sp|Q5DRF0|PCDA2_PANTR1.039e-4925.94Protocadherin alpha-2 OS=Pan troglodytes OX=9598 G... [more]
back to top
BLAST of Protocadherin-9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3T3812.145e-6429.57Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A0R3WFB53.482e-6429.23Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A3Q4MGQ46.703e-6330.53Si:ch73-379j16.2 OS=Neolamprologus brichardi OX=32... [more]
A0A0R3SEA01.919e-6228.36Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A068Y7642.261e-6228.11Protocadherin gamma b17 OS=Echinococcus multilocul... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000016369.29.693e-5127.52pep primary_assembly:Astyanax_mexicanus-2.0:8:8904... [more]
ENSAMXT00000047131.11.326e-5028.53pep primary_assembly:Astyanax_mexicanus-2.0:20:107... [more]
pcdh2ab51.830e-5028.24protocadherin 2 alpha b 5 [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSAMXT00000033326.12.293e-5027.25pep primary_assembly:Astyanax_mexicanus-2.0:8:9197... [more]
ENSAMXT00000037053.12.558e-5027.25pep primary_assembly:Astyanax_mexicanus-2.0:8:9197... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh112.665e-4626.22protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
si:ch211-199f5.13.432e-3725.08protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000008517.18.881e-3725.84pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000004042.15.595e-3524.51pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000004043.17.024e-3524.51pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461897.374e-4727.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333609.848e-4531.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404705.841e-4328.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482371.010e-4126.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303647.931e-3829.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000036663.11.492e-5029.26pep primary_assembly:ASM223467v1:10:15171740:15179... [more]
PCDH171.752e-4827.60protocadherin-17 [Source:NCBI gene;Acc:101168002][more]
si:dkey-30k22.72.291e-4828.82si:dkey-30k22.7 [Source:ZFIN;Acc:ZDB-GENE-090313-3... [more]
si:ch73-379j16.24.799e-4727.32si:ch73-379j16.2 [Source:ZFIN;Acc:ZDB-GENE-141215-... [more]
ENSORLT00000005220.25.164e-4727.98pep primary_assembly:ASM223467v1:10:15161680:15164... [more]
back to top
BLAST of Protocadherin-9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048913.10.000e+099.61SMESG000048913.1[more]
SMESG000048913.10.000e+099.60SMESG000048913.1[more]
SMESG000010555.11.189e-10333.02SMESG000010555.1[more]
SMESG000002712.19.629e-5628.06SMESG000002712.1[more]
SMESG000002712.11.086e-5528.06SMESG000002712.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001935 ID=SMED30001935|Name=Protocadherin-9|organism=Schmidtea mediterranea sexual|type=transcript|length=3244bp
GACATATTAAGATTTTATTAATTATTCTATTTGATTGTTTAAACGCACTG
ACCGATGATTTCATTGAGATTGAACCAGATTTCTCATCGCTCCCTAGACA
ACTTTCAAATGATATTTTTTATTTTGACTCTCGTCGTCATCATTGTTGGA
TATGGAAACGGTCTCAGTTCTCACTGTGATGCAGAAATCAAGGAGCTTGA
CATTTATCAAATGGGAATAAATTTGAATTTAACTCGTGGGAAAAACTTGA
AAAAATATGAACTGATCCAACATTATAATATTTTTGCAATTCATCCGTCA
ACGGGATTCCTTCAAACGATTCGCTCAATCGACAGAGAAGCGCTTTGCCA
TGCCAGCAATAACTGCGACTGTTTAAAGCGAAAGTGCGTCTTGGAGTTAA
CGATATTTGCTTCGGATTTGATCCAGTCAAACAAACCGCCGGAACGAATA
TATAAAACTATATGCATTGAAGACATCAATGATAATAGCCCTTCGTTTCC
GGAACTGACGCAAACTATTGAGATTAATGAAAAATCCCCAATTGGTACGG
AACTAGAATTGCACTCGGCCCAAGATCGGGATTCATCGGATTTTGCAATT
ATTAAATACGATATGAAATGCTCTGAAAATATCTTCAATCTCTCTTTCAG
TATCTTTAGAGATAAACAATACAAATTGAACCACCAAGTCAAATTAATTG
TGACCCGAAACATATCTTTTCGATATGATCCAATCCAATGCACATTAACG
GCTTGGGATCTAAATTCTAGCTCGTCCATGCGACTGATAGTCAAAGTAAA
TGATATTAATGACCATTCTCCTGAATGGCCGAACTCCAAGTATTATATCC
GGATAAAAGAAAATCTCCTTTTAGATTCAATTATCCATACATTTCAGGCA
ACTGATGCGGACACCGTATATGGTAAAGTCTCATACAGCATTGGAAGAAT
AATGGTTCGGGATATTCCGAAAACATTCTCTGGAAATCTGTTTACGATAG
ACTCAATTACGGGGGATATGAAATTAAATGGAAACCTAGATTTTGAGGAA
CGACTTCAGCGGGAGTACATTGTCACGATTATTGCAAAGGACAATGGTAC
ACCTTCTTTGAGCAGTCCAACGACTGCTGTCATAGACATAGAAGATTTCA
ATGATAACCCCCCAATAATCAACATAAATCGAGGAATAATAGATGTGGAG
GAAAATACTCCCCCCAATTACCTTGACTACTTTACGGTATTTGATAACGA
TGAAGATGCAAACGGAAAAATCGAATGCGAAATTCTCGAATGGGGTGAAT
ATTTTAATTTGAAAAAATCCACTGCAAATATTCCCATTACGTATGAAATA
TATCTCTCGCAAATTCTAGATTATGAGAAACAGTCGATGATTGCTTTGAT
CATTCAGTGTCAGGACGGTGGGAAACCCAACCTTACATCAAAGAAACGAA
TTGCAGTGAATGTAATTGATGTGAATGACAATCGTGTTTATTTCCCCCAG
AAAACCATTCGAATCTCCATTCCAGAAAATATTCCGATCGGTTCAGAAAT
AATTAGAATATCTACGATTGATCTCGATAAAAAGTCCGAGGTGGCCTTTT
CTATTGTTCATTCTAGCAATTGCAGTTTTGTTAATATTGACACGAATAAT
GGTTATTTGACGACAAACGAAATGTTTGACAGAGAAACCAAGGATGAGTA
TGCGTTTGAGGTTCAAGTCGTGGAAAAGGATAACGTCAATTTCACCGACA
CGGTTAAAGTAATTTTACGGATCAGTGATATCAATGACAACAAGCCGGTC
TTTGATGCTCACTATTCGTTTTCTATCCCAGAAAACACGTCGGTAGATGG
GTTCATAGGACGAGTTCGAGCAATTGATAATGACCTAGGGGAAAATGGAA
CTGTTTCGTATGTGCAAGTGAATCAAATTTCAAATCAACGATTTTACTTT
ACAGTTTCAAACTATGGAGAAATCAGACTATTTCACATGCTTGACATTGA
TAAACAGAACATTCACCAAGTCACGATCGTTGCTAGAGATCAAGGCCGAC
CAATTTCAATGTCTTCATCAACCACAGTTTTCATAACGGTCCTGGATTCC
AATAACCATCCACCAGAATTCGAGAAACCGTTTTTTGCGTTAACCCTTTC
CTGTCAAACACAAACCATTGACAAAAATCTTTTCCCATCAACTGATAAAG
ACAAATCTCCAGAAAATACAAAGATGAATTACTTGTTAGATAACATCAAA
CCGTTGGAGTTCAAGTCACTGTTTAAGATTGACAAACTGACCGGAACGAT
TGCAATGACTGTGAAGGAAAATGACTGTAATTTTAAAACAAACAATAAAG
AAAAAGTAGAAATCAAAGTTTCAGTTTTCGACCCAACAAAACCTTTATTT
CGAGGCTCTACAATATTGCAAATAATTCTCGAAAATGAAAGATATCACAA
GAATGTCAACGAAGAGATAAATCGTTCAAATCAAGGTCCAATGGATATTT
CTACTAATAAAAAGTATAAAGGTCCTCATCCAGAGACCGAGAACACACAA
ATACCAGAAGAATCAGTAGATCAAAACATTACCATTATCATGGTACTCAT
ATTCGTTATTCTTTTCCTGGGAATATTTTTGATAACAATTATTTGCTTTG
TCAAGAAGCGGCGCCAGGCTGATGATGAACAAGATGTCAATGAGAACACA
ATAATGGTTCGAGAAAAGGTGAACGCCTCCATTCAAAGTGGCAATAAATC
AGATTTCCATGAGCACAGTGTAGACTCATACCAAATGCCTATGAAAAAAA
TAAATTCGCAAGTCATCAGGTATCCGACAATGACGGATAATCGTAAAGAG
AAACATGCCATCTCAGATATCAACAGCAGTCTAACCCCAATGCCAAGTGT
CGAACCAAATTACCAGAAGTCTATTCTTCAATATGAAATTGCTAAAATGA
AAGACAACAACACTTATCAGTCTTTGACGATAAATCCGAAGTTTGCCAAT
GTTGATCAAAGCTTTTCTACAGTGTATTCATTCCAACAAAATCAGTCCTT
GAGCACAAGAGCCAGTCCCATAGACAAAAACCAAAACATTGTCAACAACC
CGAATCTAATAACCAACCAACCTAATAATCGGTCCTATATTTCTGTCAGT
TTTGTATGAGGTTTTAAACTTGGCGGATTCCGTTTGCATTCTTCTCATTT
GGATGTGTATATATACAATAAATGATATTCTACTTATTATTTTG
back to top

protein sequence of SMED30001935-orf-1

>SMED30001935-orf-1 ID=SMED30001935-orf-1|Name=SMED30001935-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1035bp
MISLRLNQISHRSLDNFQMIFFILTLVVIIVGYGNGLSSHCDAEIKELDI
YQMGINLNLTRGKNLKKYELIQHYNIFAIHPSTGFLQTIRSIDREALCHA
SNNCDCLKRKCVLELTIFASDLIQSNKPPERIYKTICIEDINDNSPSFPE
LTQTIEINEKSPIGTELELHSAQDRDSSDFAIIKYDMKCSENIFNLSFSI
FRDKQYKLNHQVKLIVTRNISFRYDPIQCTLTAWDLNSSSSMRLIVKVND
INDHSPEWPNSKYYIRIKENLLLDSIIHTFQATDADTVYGKVSYSIGRIM
VRDIPKTFSGNLFTIDSITGDMKLNGNLDFEERLQREYIVTIIAKDNGTP
SLSSPTTAVIDIEDFNDNPPIININRGIIDVEENTPPNYLDYFTVFDNDE
DANGKIECEILEWGEYFNLKKSTANIPITYEIYLSQILDYEKQSMIALII
QCQDGGKPNLTSKKRIAVNVIDVNDNRVYFPQKTIRISIPENIPIGSEII
RISTIDLDKKSEVAFSIVHSSNCSFVNIDTNNGYLTTNEMFDRETKDEYA
FEVQVVEKDNVNFTDTVKVILRISDINDNKPVFDAHYSFSIPENTSVDGF
IGRVRAIDNDLGENGTVSYVQVNQISNQRFYFTVSNYGEIRLFHMLDIDK
QNIHQVTIVARDQGRPISMSSSTTVFITVLDSNNHPPEFEKPFFALTLSC
QTQTIDKNLFPSTDKDKSPENTKMNYLLDNIKPLEFKSLFKIDKLTGTIA
MTVKENDCNFKTNNKEKVEIKVSVFDPTKPLFRGSTILQIILENERYHKN
VNEEINRSNQGPMDISTNKKYKGPHPETENTQIPEESVDQNITIIMVLIF
VILFLGIFLITIICFVKKRRQADDEQDVNENTIMVREKVNASIQSGNKSD
FHEHSVDSYQMPMKKINSQVIRYPTMTDNRKEKHAISDINSSLTPMPSVE
PNYQKSILQYEIAKMKDNNTYQSLTINPKFANVDQSFSTVYSFQQNQSLS
TRASPIDKNQNIVNNPNLITNQPNNRSYISVSFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
GO:0007267cell-cell signaling
GO:0007399nervous system development
GO:0007420brain development
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 351..370
score: 43.39
coord: 258..287
score: 26.67
coord: 478..491
score: 27.04
coord: 75..94
score: 32.32
coord: 671..688
score: 37.05
coord: 337..349
score: 38.16
coord: 531..557
score: 23.9
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 604..687
e-value: 4.0E-13
score: 59.6
coord: 393..478
e-value: 8.1E-15
score: 65.2
coord: 280..370
e-value: 2.5E-23
score: 93.5
coord: 170..256
e-value: 1.5
score: 2.1
coord: 710..800
e-value: 1.6
score: 1.6
coord: 54..146
e-value: 1.6
score: 1.6
coord: 502..581
e-value: 7.6E-13
score: 58.7
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 379..470
e-value: 4.5E-9
score: 36.6
coord: 486..571
e-value: 1.9E-9
score: 37.8
coord: 263..362
e-value: 2.7E-15
score: 56.6
coord: 587..680
e-value: 9.8E-14
score: 51.6
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 368..478
e-value: 2.8E-20
score: 74.8
coord: 147..254
e-value: 2.6E-12
score: 49.2
coord: 582..685
e-value: 7.2E-24
score: 86.4
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 54..146
e-value: 7.9E-9
score: 37.8
coord: 479..581
e-value: 1.4E-19
score: 72.5
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 255..367
e-value: 4.9E-24
score: 87.0
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 686..793
e-value: 1.1E-5
score: 27.9
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 542..942
coord: 72..583
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 67..148
score: 13.137
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 481..583
score: 23.046
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 259..372
score: 23.484
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 381..483
score: 15.811
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 149..258
score: 11.909
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 583..689
score: 21.95
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 381..476
e-value: 3.64117E-16
score: 72.7313
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 263..368
e-value: 4.2945E-24
score: 95.4581
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 484..579
e-value: 4.10254E-22
score: 89.6801
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 586..685
e-value: 1.00044E-23
score: 94.3025
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 67..144
e-value: 8.76612E-6
score: 43.4562
NoneNo IPR availableTMHMMTMhelixcoord: 844..866
NoneNo IPR availableTMHMMTMhelixcoord: 20..37
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 136..146
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 360..370
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 572..697
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 366..472
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 67..148
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 246..388
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 136..238
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 468..584