PH domain-containing protein

Overview
NamePH domain-containing protein
Smed IDSMED30001904
Length (bp)2388
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PH domain-containing protein (SMED30001904) t-SNE clustered cells

Violin plots show distribution of expression levels for PH domain-containing protein (SMED30001904) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PH domain-containing protein (SMED30001904) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PH domain-containing protein (SMED30001904) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001904

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30001904h1SMcG0018773 SmedASXL_012746SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30001904h1SMcG0018773 SmedASXL_071629SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30001904h1SMcG0018773 Contig46115newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001904h1SMcG0018773 Contig46115uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30001904h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30001904h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30001904h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001904h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001904h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30001904h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30001904h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30001904h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001904h1SMcG0018773 dd_Smed_v4_9521_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001904h1SMcG0018773 dd_Smed_v4_9521_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30001904h1SMcG0018773 dd_Smed_v6_4512_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30001904h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PH domain-containing protein vs. Ensembl Human
Match: FERMT1 (fermitin family member 1 [Source:HGNC Symbol;Acc:HGNC:15889])

HSP 1 Score: 206.068 bits (523), Expect = 4.513e-56
Identity = 173/693 (24.96%), Postives = 319/693 (46.03%), Query Frame = 1
Query:  190 IRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCN---EDEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIPI-----KGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 2244
            +RV     +  V   L+ +I++  DWS+F  W   +  WLL     + ++ +Q  +K+ F  +  +L ++LP+L++ +L + FS  VF+    ICK   IR  EELSL    LK   S      +++  ++  +  +    N     T +    + G   +   PIY             P N     S  + F D  L E + S       S+   SP     EAL   D+   ++  D+A     W+ S  +LMEQ + +   +LLR  +KY++++  N KYD +RINQ++ Q+ W+++  E DC+ +E  + A + +HI+KLS +    + A  S  D   EI++ L  L   L G   +   ED  +  ++A N++L +  + +   +K++  +  +  I   K   +    P+     +G E+  +V +  +K  I  +I                +     + +R  ++ ++ +W  A  L SK       S+++ E   + + + MK+     ++  + + +D +N    +     K  KSK++  ++L   ++ + +  +EAK+ +I+ W +L   G  Y  V    + +  I+G+ Y+RLI  D  TG+         +  W  NWE    ++ F +  +      S +C+I HEY+GGY+F+  R+ ++   L+E +F  LTG
Sbjct:   31 LRVSGDLHVGGVMLKLVEQINISQDWSDFALWWEQKHCWLLKTHWTLDKYGVQADAKLLFTPQHKMLRLRLPNLKMVRLRVSFSAVVFKAVSDICKILNIRRSEELSL----LKP--SGDYFKKKKKKDKNNKEPIIEDILNLESSPTASGSSVSPGLYSKTMTPIY------------DPINGTPASSTMTWFSDSPLTEQNCSI---LAFSQPPQSP-----EALA--DMYQPRSLVDKAKLNAGWLDSSRSLMEQGIQEDEQLLLR--FKYYSFFDLNPKYDAVRINQLYEQARWAILLEEIDCTEEEMLIFAALQYHISKLSLSAETQDFAGESEVD---EIEAALSNLEVTLEGGKADSLLEDITDIPKLADNLKLFRPKKLLPKAFKQYWFIFKDTSIAYFKNKELEQGEPLEKLNLRGCEVVPDVNVAGRKFGIKLLIP--------------VADGMNEMYLRCDHENQYAQWMAACMLASKGKTMAD-SSYQPEVLNILSFLRMKNRNSASQVASSLENMD-MNPECFVSPRCAKRHKSKQLAARILEAHQNVAQMPLVEAKLRFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVSYNRLIKIDAATGIPVTTWRFTNIKQWNVNWETRQVVIEFDQNVFTAFTCLSADCKIVHEYIGGYIFLSTRSKDQNETLDEDLFHKLTG 674          
BLAST of PH domain-containing protein vs. Ensembl Human
Match: FERMT2 (fermitin family member 2 [Source:HGNC Symbol;Acc:HGNC:15767])

HSP 1 Score: 205.297 bits (521), Expect = 9.515e-56
Identity = 183/715 (25.59%), Postives = 335/715 (46.85%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRN--SQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNE---DEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIP-----IKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMK----SPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLT 2241
             ++ +S+ + +LN    +RV     I  V   L+ K+ +K DWS+   W   ++ WLL     + ++ +Q  +K+ F  +  +L +QLP+++  ++ ++FS  VF+    ICK F IRH EELSL                ++    +  ++      + +    L   L T G    ++ P   ++      D  + SP   +SP S +  F D +L+E +         S+   SP+   ++  K Q ++      D+A     W+ S  +LMEQ V +  N  L LR+KY++++  N KYD IRINQ++ Q+ W+++  E +C+ +E  + A + +HINKLS   T+    N S  ++D E+D+ L  L   L G   +    D     E+A  I++ K  +  L  YK++     +  I+  K+   SS  P     ++G E+  +V I  +K  I  +I                ++    + +R  N++++  W  A RL SK       S++  E Q + + ++M+     PQ   + + T+     +    ++   + K +K+K+I  ++L   ++ + +S IEAK+ +I+ W +L   G  +         + ++IGI Y+RLI  D  TG        + +  W  NWE+    + F++           +C++ HE++GGY+F+  R  ++   L+E +F  LT
Sbjct:   16 GTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSL---------------LKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYSSPGLYSKTMTPTYDAHDGSP---LSPTSAW--FGDSALSEGNPGI---LAVSQPITSPE-ILAKMFKPQALL------DKAKINQGWLDSSRSLMEQDVKE--NEALLLRFKYYSFFDLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIM-TSENHLNNSDKEVD-EVDAALSDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIP--------------VAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMAD-SSYNLEVQNILSFLKMQHLNPDPQLIPEQITTD-----ITPECLVSPRYLKKYKNKQITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 676          
BLAST of PH domain-containing protein vs. Ensembl Human
Match: FERMT2 (fermitin family member 2 [Source:HGNC Symbol;Acc:HGNC:15767])

HSP 1 Score: 205.297 bits (521), Expect = 9.515e-56
Identity = 183/715 (25.59%), Postives = 335/715 (46.85%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRN--SQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNE---DEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIP-----IKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMK----SPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLT 2241
             ++ +S+ + +LN    +RV     I  V   L+ K+ +K DWS+   W   ++ WLL     + ++ +Q  +K+ F  +  +L +QLP+++  ++ ++FS  VF+    ICK F IRH EELSL                ++    +  ++      + +    L   L T G    ++ P   ++      D  + SP   +SP S +  F D +L+E +         S+   SP+   ++  K Q ++      D+A     W+ S  +LMEQ V +  N  L LR+KY++++  N KYD IRINQ++ Q+ W+++  E +C+ +E  + A + +HINKLS   T+    N S  ++D E+D+ L  L   L G   +    D     E+A  I++ K  +  L  YK++     +  I+  K+   SS  P     ++G E+  +V I  +K  I  +I                ++    + +R  N++++  W  A RL SK       S++  E Q + + ++M+     PQ   + + T+     +    ++   + K +K+K+I  ++L   ++ + +S IEAK+ +I+ W +L   G  +         + ++IGI Y+RLI  D  TG        + +  W  NWE+    + F++           +C++ HE++GGY+F+  R  ++   L+E +F  LT
Sbjct:   16 GTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSL---------------LKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYSSPGLYSKTMTPTYDAHDGSP---LSPTSAW--FGDSALSEGNPGI---LAVSQPITSPE-ILAKMFKPQALL------DKAKINQGWLDSSRSLMEQDVKE--NEALLLRFKYYSFFDLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIM-TSENHLNNSDKEVD-EVDAALSDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIP--------------VAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMAD-SSYNLEVQNILSFLKMQHLNPDPQLIPEQITTD-----ITPECLVSPRYLKKYKNKQITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 676          
BLAST of PH domain-containing protein vs. Ensembl Human
Match: FERMT2 (fermitin family member 2 [Source:HGNC Symbol;Acc:HGNC:15767])

HSP 1 Score: 198.364 bits (503), Expect = 2.532e-53
Identity = 183/722 (25.35%), Postives = 335/722 (46.40%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRN--SQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNE---DEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIP-----IKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMK----SPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKE-------ILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLT 2241
             ++ +S+ + +LN    +RV     I  V   L+ K+ +K DWS+   W   ++ WLL     + ++ +Q  +K+ F  +  +L +QLP+++  ++ ++FS  VF+    ICK F IRH EELSL                ++    +  ++      + +    L   L T G    ++ P   ++      D  + SP   +SP S +  F D +L+E +         S+   SP+   ++  K Q ++      D+A     W+ S  +LMEQ V +  N  L LR+KY++++  N KYD IRINQ++ Q+ W+++  E +C+ +E  + A + +HINKLS   T+    N S  ++D E+D+ L  L   L G   +    D     E+A  I++ K  +  L  YK++     +  I+  K+   SS  P     ++G E+  +V I  +K  I  +I                ++    + +R  N++++  W  A RL SK       S++  E Q + + ++M+     PQ   + + T+   +      ++   + K +K+K+       I  ++L   ++ + +S IEAK+ +I+ W +L   G  +         + ++IGI Y+RLI  D  TG        + +  W  NWE+    + F++           +C++ HE++GGY+F+  R  ++   L+E +F  LT
Sbjct:   16 GTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSL---------------LKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYSSPGLYSKTMTPTYDAHDGSP---LSPTSAW--FGDSALSEGNPGI---LAVSQPITSPE-ILAKMFKPQALL------DKAKINQGWLDSSRSLMEQDVKE--NEALLLRFKYYSFFDLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIM-TSENHLNNSDKEVD-EVDAALSDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIP--------------VAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMAD-SSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDITPEC-----LVSPRYLKKYKNKQPGYIRDLITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 683          
BLAST of PH domain-containing protein vs. Ensembl Human
Match: FERMT2 (fermitin family member 2 [Source:HGNC Symbol;Acc:HGNC:15767])

HSP 1 Score: 198.364 bits (503), Expect = 2.532e-53
Identity = 183/722 (25.35%), Postives = 335/722 (46.40%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRN--SQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNE---DEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIP-----IKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMK----SPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKE-------ILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLT 2241
             ++ +S+ + +LN    +RV     I  V   L+ K+ +K DWS+   W   ++ WLL     + ++ +Q  +K+ F  +  +L +QLP+++  ++ ++FS  VF+    ICK F IRH EELSL                ++    +  ++      + +    L   L T G    ++ P   ++      D  + SP   +SP S +  F D +L+E +         S+   SP+   ++  K Q ++      D+A     W+ S  +LMEQ V +  N  L LR+KY++++  N KYD IRINQ++ Q+ W+++  E +C+ +E  + A + +HINKLS   T+    N S  ++D E+D+ L  L   L G   +    D     E+A  I++ K  +  L  YK++     +  I+  K+   SS  P     ++G E+  +V I  +K  I  +I                ++    + +R  N++++  W  A RL SK       S++  E Q + + ++M+     PQ   + + T+   +      ++   + K +K+K+       I  ++L   ++ + +S IEAK+ +I+ W +L   G  +         + ++IGI Y+RLI  D  TG        + +  W  NWE+    + F++           +C++ HE++GGY+F+  R  ++   L+E +F  LT
Sbjct:   16 GTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSL---------------LKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYSSPGLYSKTMTPTYDAHDGSP---LSPTSAW--FGDSALSEGNPGI---LAVSQPITSPE-ILAKMFKPQALL------DKAKINQGWLDSSRSLMEQDVKE--NEALLLRFKYYSFFDLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIM-TSENHLNNSDKEVD-EVDAALSDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIP--------------VAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMAD-SSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDITPEC-----LVSPRYLKKYKNKQPGYIRDLITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 683          
BLAST of PH domain-containing protein vs. Ensembl Celegans
Match: unc-112 (pep chromosome:WBcel235:V:14691854:14697107:-1 gene:WBGene00006836.1 transcript:C47E8.7.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-112)

HSP 1 Score: 176.792 bits (447), Expect = 3.542e-46
Identity = 175/741 (23.62%), Postives = 334/741 (45.07%), Query Frame = 1
Query:  151 ISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQW----KELKKLDS-----NTPVPXXXXXXXXXXXXXXXXXXXXXXXXTL-------TSGLNTTGH----RKRFTKPIY--LTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKT--YKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNE--DEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINII---KTTNVSSK----IPIKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNL--------KMLKTNKEVDSVNLVDIIGSIHNKPFKSKE-ILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKN-SWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 2244
            + I + +LN   +I V     +  +  +L+++  ++ DWS+   W P ++ WL    + + Q  +   +++ F        IQLPD+Q+    +DFS   F+  + +C+  GIR+ EELSL+     ++L++  S     N P+  R            + +      S L       +  L+ +GH     +  T P +  L R        PSP      +    I   +S +E      E F+++ L +SP+ + S     +D  +++   Y ++A     W+ S  +LMEQ +  +   ++ LR+K+ N++  N KYD +RINQ++ Q+ WS++  E D + +E  L A  L     L  +    E  N        ++D +LD L  +L   + N   D  +  E+A  ++ +K P+ + +      A  S   + +     +++V+S       +KG E+  +V +  +K  I  ++               T++      ++  ++ ++ +W  A RL S+       S+++ E + + N+++M+S   N         +     K  +  N+ + I S + +  +SK+ I Q+V     +   L+  EAK+ YI+ W  L   G HY  V      + +++ +  +RL   +++ G          +  W  NWE+ +  + F +    I FK  S +C++ HE++GGY+F+ MR+ E   +L+E +F  LTG
Sbjct:   17 LPILVTDLNIQRSISVLGNLNVGGLMLELVSECDVERDWSDHALWWPEKRRWLQHTRSTLDQNGITAETQLEFTPMHKEARIQLPDMQMIDARVDFSVNSFKATKKLCRDLGIRYSEELSLKRYIPPEDLRRGTSDADNMNGPLSMRPGEESVGPMTLRKAAPIFASQSNLDMRRRGQSPALSQSGHIFNAHEMGTLPRHGTLPRGV-----SPSPGAYNDTMRRTPIMPSISFSEG--LENEQFDDA-LIHSPRLAPS-----RDTPVFRPQNYVEKAAINRGWLDSSRSLMEQGI--FEGDIILLRFKFMNFFDLNPKYDPVRINQLYEQAKWSILLDEFDHTEEEATLFAA-LQLQATLQRDSPEPEENN------KDDVDILLDELEQNLDAAALNRRSDLTQVPELADYLKYMK-PKKLAAFKGFKRAFFSFRDLYLSYHQSSSDVNSAPLGHFSLKGCEVSQDVSVGQQKYHIKLLLP--------------TAEGMIDFILKCDSEHQYARWMAACRLASRGKSMAD-SSYQQEVESIKNLLKMQSGNGNENGNSNTASRKAAAVKLPNDFNVDEYISSKYVRRARSKQQIQQRVSDAHGNVRQLTATEAKLQYIRAWQALPEHGIHYFIVRFRNARKAELVAVAVNRLAKLNMDNGESLKTWRFANMKKWHVNWEIRHLKIQFEDE--DIEFKPLSADCKVVHEFIGGYIFLSMRSKEHSQNLDEELFHKLTG 717          
BLAST of PH domain-containing protein vs. Ensembl Celegans
Match: unc-112 (pep chromosome:WBcel235:V:14691857:14696654:-1 gene:WBGene00006836.1 transcript:C47E8.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-112)

HSP 1 Score: 176.792 bits (447), Expect = 3.542e-46
Identity = 175/741 (23.62%), Postives = 334/741 (45.07%), Query Frame = 1
Query:  151 ISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQW----KELKKLDS-----NTPVPXXXXXXXXXXXXXXXXXXXXXXXXTL-------TSGLNTTGH----RKRFTKPIY--LTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKT--YKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNE--DEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINII---KTTNVSSK----IPIKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNL--------KMLKTNKEVDSVNLVDIIGSIHNKPFKSKE-ILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKN-SWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 2244
            + I + +LN   +I V     +  +  +L+++  ++ DWS+   W P ++ WL    + + Q  +   +++ F        IQLPD+Q+    +DFS   F+  + +C+  GIR+ EELSL+     ++L++  S     N P+  R            + +      S L       +  L+ +GH     +  T P +  L R        PSP      +    I   +S +E      E F+++ L +SP+ + S     +D  +++   Y ++A     W+ S  +LMEQ +  +   ++ LR+K+ N++  N KYD +RINQ++ Q+ WS++  E D + +E  L A  L     L  +    E  N        ++D +LD L  +L   + N   D  +  E+A  ++ +K P+ + +      A  S   + +     +++V+S       +KG E+  +V +  +K  I  ++               T++      ++  ++ ++ +W  A RL S+       S+++ E + + N+++M+S   N         +     K  +  N+ + I S + +  +SK+ I Q+V     +   L+  EAK+ YI+ W  L   G HY  V      + +++ +  +RL   +++ G          +  W  NWE+ +  + F +    I FK  S +C++ HE++GGY+F+ MR+ E   +L+E +F  LTG
Sbjct:   17 LPILVTDLNIQRSISVLGNLNVGGLMLELVSECDVERDWSDHALWWPEKRRWLQHTRSTLDQNGITAETQLEFTPMHKEARIQLPDMQMIDARVDFSVNSFKATKKLCRDLGIRYSEELSLKRYIPPEDLRRGTSDADNMNGPLSMRPGEESVGPMTLRKAAPIFASQSNLDMRRRGQSPALSQSGHIFNAHEMGTLPRHGTLPRGV-----SPSPGAYNDTMRRTPIMPSISFSEG--LENEQFDDA-LIHSPRLAPS-----RDTPVFRPQNYVEKAAINRGWLDSSRSLMEQGI--FEGDIILLRFKFMNFFDLNPKYDPVRINQLYEQAKWSILLDEFDHTEEEATLFAA-LQLQATLQRDSPEPEENN------KDDVDILLDELEQNLDAAALNRRSDLTQVPELADYLKYMK-PKKLAAFKGFKRAFFSFRDLYLSYHQSSSDVNSAPLGHFSLKGCEVSQDVSVGQQKYHIKLLLP--------------TAEGMIDFILKCDSEHQYARWMAACRLASRGKSMAD-SSYQQEVESIKNLLKMQSGNGNENGNSNTASRKAAAVKLPNDFNVDEYISSKYVRRARSKQQIQQRVSDAHGNVRQLTATEAKLQYIRAWQALPEHGIHYFIVRFRNARKAELVAVAVNRLAKLNMDNGESLKTWRFANMKKWHVNWEIRHLKIQFEDE--DIEFKPLSADCKVVHEFIGGYIFLSMRSKEHSQNLDEELFHKLTG 717          
BLAST of PH domain-containing protein vs. Ensembl Fly
Match: Fit2 (gene:FBgn0036688 transcript:FBtr0075275)

HSP 1 Score: 208.764 bits (530), Expect = 4.230e-57
Identity = 180/738 (24.39%), Postives = 340/738 (46.07%), Query Frame = 1
Query:  142 SFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSL----QWKELKKLDSNTP----VPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKP--IYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSY--YESFENS------KLTNSPKKSFSEALKQQDIVIYKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGIL----HHIN---KLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNEDE---MEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIP------IKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLVD--IIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFK-NSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 2244
            S+ + IFI +L     +RV     I  +   L++  + K DWS+   W P   +WL      + Q  +Q  S ++F     +L +QLPDL+     +D+S   F     +CKQ  IR+ EELSL    + + LK+  +  P    VP       +  Q     +S     ++      +TG   + + P   +    S ++    SP   VSP          +  ++ L Y  Y+S  +S       L +SP    ++    Q  +  K+  ++A     W+ S L++MEQ + +Y+   L LR+KY  ++  N K D++RINQ++ Q+ WS+++ E DC+ +E+ + A +     HH++   + +  D+  ET++   ND + EIDS L  L   L G     D        E++  +  +K  R  L  YK++     +  +++ K    S ++       +KG E+  +V +   K  I   +                      V +R  N+Q++ KW  A RL +K       S+++ E   + ++++M+ P   + +    + V++V+ +   II  + NK       +Q++L    +   L+ +++K+ YI+ W +L + G     +  + + + +++G+ ++R++  D+ +G        N + +W  NW +   ++ F +    + F  +S +C++ HE++GGY+F+ MR+ +    LNE +F  LTG
Sbjct:    8 SWNLRIFITDLALEKTMRVRGDQHIGGIMLQLVDPENPK-DWSDHALWWPARNVWLSRTKLTLDQCGVQADSLLHFTPMHKILRVQLPDLRYLDSRVDYSVKTFSAVVNLCKQLDIRYPEELSLCKPLEAEHLKRNFAQVPHQKRVPIAEPDGTTYLQPAADTNSFVPISTSFHGEGGSTGSLDKPSAPGSFFCAPLSPHNHRARSPVRTVSPFPG-------TWKQSQLGYATYDSSSSSLGDFQENLASSPPTPCADVRALQ--LRPKSLVEKARLNVGWLDSSLSIMEQGIREYDT--LCLRFKYFTFFDLNPKCDQVRINQLYEQAKWSVLNEELDCTEEESLMFAALQFQVNHHVDHTPQGAAVDSGIETSS-QENDNEDEIDSALKELQITLEGPDYGGDSRNITRIPELSDYLRYLKPQRFTLRGYKRYYFTYRDLHLHLFKNAEDSRRVAPAISINLKGCEVTPDVNLSQGKYAIRLEVSPDGGHGIN-----------SEVWVRCENEQQYAKWMAACRLAAKGRSLAD-SSYESEVDSILSLLQMQRPAHGVHVNIDPRSVEAVDYLSPKIIRKLSNK------AVQRILEAHANVRELNALDSKLKYIQAWRSLPDFGVSLFIIKFDGHRKEELLGVAHNRIMRMDLSSGDHIKTWRYNTMKAWNVNWNIKCMMIQFEDE--NVVFSCHSADCKVVHEFIGGYIFMSMRSKDTNQTLNEELFHKLTG 712          
BLAST of PH domain-containing protein vs. Ensembl Fly
Match: Fit1 (gene:FBgn0035498 transcript:FBtr0073209)

HSP 1 Score: 179.874 bits (455), Expect = 3.884e-47
Identity = 174/728 (23.90%), Postives = 324/728 (44.51%), Query Frame = 1
Query:  151 ISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELS----LQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVS------PVSFFSIFDDLSLNETDLSYYESFEN-----SKLTNSPKKSFSEALKQQDIVIYKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLS-----TNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNEDE---MEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSK------IPIKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFK-NSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 2244
            + I I +L     +RV     I  V  +L++   L  DWS+   W P + +WL    + + Q  +Q  S ++F      L +Q+PDL+     ++FS   F     +CK   IR+ EELS    L+ + LKK  S  P        + +        +         S +  TG        +  + N        SP+   +      P+S  S       N T  + Y+S  +       L  SP+    +   +  +V  K+  ++A     W+ S L++MEQ V +Y+   L LR+KY  ++  N KYD++RINQ++ Q+ WS+++ E + + +ET + A +   +N  +       D+  +T++      D +IDS L+ L   L G    +D+       E++  ++ +K  R  L  YK++     +  +++ K+ + S +      I +KG E+  +V +   K  I   +  +             +     V +R  N++++ KW  A RL +K       S++  E   + ++++M+ P     +    +   SV  +D +     +   SK + Q++L    +   LS ++AK+ YI+ W +L + G     +  + + + +++G+  +R++  D+ TG        N + +W  NW +   ++   +    I F   S +C++ HE++GGY+F+ MR+ E    LNE +F  LTG
Sbjct:   11 LRILITDLQVEKTLRVKGDQHIGGVMLNLVDP-ELPKDWSDHALWWPAKNIWLTRTRSTLDQAGVQSDSFLHFTPMHKTLRVQMPDLRYLDYRVNFSAKTFGAVVSLCKDLDIRYPEELSFCKPLEPEHLKKNFSKLP-------QRKIPVAEANGIAYVQPALDTNSFVPITGAYNGSNGSLDRSHNGNLLCAPASPYTRRAATAPGTPIS--SPTGTWKHNSTGYASYDSNSSFGDLQENLAMSPRSPSPDVRAR--LVRPKSRVEKARLNVGWLDSSLSIMEQGVREYDT--LCLRFKYFTFFDLNPKYDQVRINQLYEQAKWSILNEELEPTEEETLMFAALQFQVNHQTDLHPPGIDSGIDTSSQETGGED-DIDSALNELQITLEGPGGGKDQGNITRIPELSDYLKFLKPQRFTLKGYKRYFFTYRDLHLHLYKSQDESRRGAPTISINLKGCEVTPDVNLAQGKFAIRLEVPSEIR-----------NGPNSEVWVRCDNEEQYAKWMAACRLAAKGRSLAD-SSYDSEVSSIRSLLQMQKPAQGAPLTVNPR---SVEPMDYLSPKMMRKLSSKAV-QRILEAHANVRQLSLMDAKMKYIQAWQSLPDFGVTLFIIKFDGHKKEELLGVANNRIMRMDLNTGDHIKTWRYNTMKAWNVNWGIKCMMIQLQDE--NIVFSVQSADCKVVHEFIGGYIFMSMRSKENNQTLNEEMFHKLTG 705          
BLAST of PH domain-containing protein vs. Ensembl Fly
Match: Fit1 (gene:FBgn0035498 transcript:FBtr0073210)

HSP 1 Score: 179.874 bits (455), Expect = 3.884e-47
Identity = 174/728 (23.90%), Postives = 324/728 (44.51%), Query Frame = 1
Query:  151 ISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELS----LQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVS------PVSFFSIFDDLSLNETDLSYYESFEN-----SKLTNSPKKSFSEALKQQDIVIYKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLS-----TNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNEDE---MEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSK------IPIKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFK-NSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 2244
            + I I +L     +RV     I  V  +L++   L  DWS+   W P + +WL    + + Q  +Q  S ++F      L +Q+PDL+     ++FS   F     +CK   IR+ EELS    L+ + LKK  S  P        + +        +         S +  TG        +  + N        SP+   +      P+S  S       N T  + Y+S  +       L  SP+    +   +  +V  K+  ++A     W+ S L++MEQ V +Y+   L LR+KY  ++  N KYD++RINQ++ Q+ WS+++ E + + +ET + A +   +N  +       D+  +T++      D +IDS L+ L   L G    +D+       E++  ++ +K  R  L  YK++     +  +++ K+ + S +      I +KG E+  +V +   K  I   +  +             +     V +R  N++++ KW  A RL +K       S++  E   + ++++M+ P     +    +   SV  +D +     +   SK + Q++L    +   LS ++AK+ YI+ W +L + G     +  + + + +++G+  +R++  D+ TG        N + +W  NW +   ++   +    I F   S +C++ HE++GGY+F+ MR+ E    LNE +F  LTG
Sbjct:   11 LRILITDLQVEKTLRVKGDQHIGGVMLNLVDP-ELPKDWSDHALWWPAKNIWLTRTRSTLDQAGVQSDSFLHFTPMHKTLRVQMPDLRYLDYRVNFSAKTFGAVVSLCKDLDIRYPEELSFCKPLEPEHLKKNFSKLP-------QRKIPVAEANGIAYVQPALDTNSFVPITGAYNGSNGSLDRSHNGNLLCAPASPYTRRAATAPGTPIS--SPTGTWKHNSTGYASYDSNSSFGDLQENLAMSPRSPSPDVRAR--LVRPKSRVEKARLNVGWLDSSLSIMEQGVREYDT--LCLRFKYFTFFDLNPKYDQVRINQLYEQAKWSILNEELEPTEEETLMFAALQFQVNHQTDLHPPGIDSGIDTSSQETGGED-DIDSALNELQITLEGPGGGKDQGNITRIPELSDYLKFLKPQRFTLKGYKRYFFTYRDLHLHLYKSQDESRRGAPTISINLKGCEVTPDVNLAQGKFAIRLEVPSEIR-----------NGPNSEVWVRCDNEEQYAKWMAACRLAAKGRSLAD-SSYDSEVSSIRSLLQMQKPAQGAPLTVNPR---SVEPMDYLSPKMMRKLSSKAV-QRILEAHANVRQLSLMDAKMKYIQAWQSLPDFGVTLFIIKFDGHKKEELLGVANNRIMRMDLNTGDHIKTWRYNTMKAWNVNWGIKCMMIQLQDE--NIVFSVQSADCKVVHEFIGGYIFMSMRSKENNQTLNEEMFHKLTG 705          
BLAST of PH domain-containing protein vs. Ensembl Zebrafish
Match: fermt1 (fermitin family member 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3264])

HSP 1 Score: 212.616 bits (540), Expect = 1.152e-58
Identity = 176/696 (25.29%), Postives = 318/696 (45.69%), Query Frame = 1
Query:  190 IRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYK--TYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCN---EDEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIPI-----KGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFK-NSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 2244
            +RV     +  +   L+ KI    DWS+   W   +  WLL     + ++ +Q  + + +  +   L IQLP+++  +L + FS  VF+    ICK   IR  EELSL    LK        P      +    +    +++      +T G    G   +   PIY   +              SPVS  S++               +  S LT        E L +    +YK  T +D+A     W+ S  +LMEQ + + + +LLR  +KYH ++  N KYD +RI Q++ Q+ W+++  E DC+ +E  + A + +HI KL+ +    + ++    D   E+++ L  L   L G++ +   ED  +  ++   ++L +  R  L  YK++  V  +  I+  K  + ++K PI     +G E+  +V + ++K  +  ++                +     V IR  N+ ++ KW  A  L SK       S+++ E + + + ++MKS          + E   +N    +   + K FK+K++  ++L    + S LS +EAK+ +I+ W +L + G  Y  V    + + +++GI Y+RLI  D+ TG+       + +  W  NWE+    + F ++   I F   S +C++ HEY+GGY+F+  R+ ++   L+E +F  LTG
Sbjct:   30 LRVKGDLHVGGLMLKLVEKIKAPQDWSDHAIWWEQKSCWLLKTHWTLDKYGIQANADLRYTPQHKSLCIQLPNMKNIKLPVTFSGVVFRAVAEICKTLNIRRTEELSL----LK--------PTDEPKKKKKKDKGTDLATDEILTMDITGG--ALGMYSKTMTPIYDPDSG-------------SPVSSTSLW---------------YGGSPLTACQPNLPPEELAK----LYKPLTMEDKAAINAGWLDSSRSLMEQGIQENDRLLLR--FKYHCFFDLNPKYDAVRITQLYEQARWAILLEEIDCTEEEMLMFASLQYHICKLTLSTEPLDNSDEKEVD---EVEAALSNLETHLEGRNADKILEDITDIPKLEDTLKLFRPKRLTLKPYKEYWFVFRDTTISYFKNKDSANKEPIEQLHLRGCEVIPDVNVTERKFGLKLLLP--------------AADGMNEVYIRCENETQYAKWKAACILASKGKTMAY-SSYRTEVKNIQSFLQMKSLAPPPGQAAPDVESMEMNPECFVSPRYAKKFKTKQLTTRILEAHHNISQLSLMEAKMRFIQAWQSLPDFGIKYYIVRFRGSKKDELLGISYNRLIRIDMSTGLPVTTWRFSNMKQWNVNWEIRQVTIEFDQSV-SIAFSCQSCDCKVVHEYIGGYIFLSTRSKDQNETLDEELFHKLTG 658          
BLAST of PH domain-containing protein vs. Ensembl Zebrafish
Match: fermt1 (fermitin family member 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3264])

HSP 1 Score: 212.616 bits (540), Expect = 1.152e-58
Identity = 176/696 (25.29%), Postives = 318/696 (45.69%), Query Frame = 1
Query:  190 IRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYK--TYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCN---EDEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIPI-----KGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFK-NSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 2244
            +RV     +  +   L+ KI    DWS+   W   +  WLL     + ++ +Q  + + +  +   L IQLP+++  +L + FS  VF+    ICK   IR  EELSL    LK        P      +    +    +++      +T G    G   +   PIY   +              SPVS  S++               +  S LT        E L +    +YK  T +D+A     W+ S  +LMEQ + + + +LLR  +KYH ++  N KYD +RI Q++ Q+ W+++  E DC+ +E  + A + +HI KL+ +    + ++    D   E+++ L  L   L G++ +   ED  +  ++   ++L +  R  L  YK++  V  +  I+  K  + ++K PI     +G E+  +V + ++K  +  ++                +     V IR  N+ ++ KW  A  L SK       S+++ E + + + ++MKS          + E   +N    +   + K FK+K++  ++L    + S LS +EAK+ +I+ W +L + G  Y  V    + + +++GI Y+RLI  D+ TG+       + +  W  NWE+    + F ++   I F   S +C++ HEY+GGY+F+  R+ ++   L+E +F  LTG
Sbjct:   30 LRVKGDLHVGGLMLKLVEKIKAPQDWSDHAIWWEQKSCWLLKTHWTLDKYGIQANADLRYTPQHKSLCIQLPNMKNIKLPVTFSGVVFRAVAEICKTLNIRRTEELSL----LK--------PTDEPKKKKKKDKGTDLATDEILTMDITGG--ALGMYSKTMTPIYDPDSG-------------SPVSSTSLW---------------YGGSPLTACQPNLPPEELAK----LYKPLTMEDKAAINAGWLDSSRSLMEQGIQENDRLLLR--FKYHCFFDLNPKYDAVRITQLYEQARWAILLEEIDCTEEEMLMFASLQYHICKLTLSTEPLDNSDEKEVD---EVEAALSNLETHLEGRNADKILEDITDIPKLEDTLKLFRPKRLTLKPYKEYWFVFRDTTISYFKNKDSANKEPIEQLHLRGCEVIPDVNVTERKFGLKLLLP--------------AADGMNEVYIRCENETQYAKWKAACILASKGKTMAY-SSYRTEVKNIQSFLQMKSLAPPPGQAAPDVESMEMNPECFVSPRYAKKFKTKQLTTRILEAHHNISQLSLMEAKMRFIQAWQSLPDFGIKYYIVRFRGSKKDELLGISYNRLIRIDMSTGLPVTTWRFSNMKQWNVNWEIRQVTIEFDQSV-SIAFSCQSCDCKVVHEYIGGYIFLSTRSKDQNETLDEELFHKLTG 658          
BLAST of PH domain-containing protein vs. Ensembl Zebrafish
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:553051])

HSP 1 Score: 196.052 bits (497), Expect = 1.038e-52
Identity = 186/724 (25.69%), Postives = 339/724 (46.82%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSG------LNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYK-----DRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDL-IGKSCNE--DEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIP-----IKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMK----SPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLT 2241
             ++ + + + +LN   ++RV     I  V   L+ K+ +K DWS+   W   +K WLL     + ++ +Q  +++ F  +  +L +QLP+++  ++ ++FS  VF+    ICK F IRH EELSL     K  D            +   +      +  +    L  G       ++ G   +   P Y +R+        SP   +SP S +  F D  L+E + S                + S+ +   DI++ K YK     D+A     W+ S  +LMEQ V + N VLL LR+KYH+++  N KYD IR+NQ++ Q+ W+++  E +C+ +E  + A + +HINKLS   +++   N S  ++D E+D+ L  L   L  GK+ N   D     E+A  +++ K  +  L  YK++     +  I+  K+   +   P     ++G E+  +V I  +K  I  +I                +     + +R   ++++ +W  A RL SK       S++  E Q + + ++M+     PQ  ++ + T+     +N   ++   + K +K+K+I  ++L   ++ + +S IEAK+ +I+ W +L   G  +         + ++IGI Y+RLI  D  TG        + +  W  NWE+    + F++           +C++ HE++GGY+F+  R  ++   L+E +F  LT
Sbjct:   16 GTWELKMHVTDLNRDVSLRVTGEIHIGGVMLKLVEKLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKLLRLQLPNMKHMRVKVNFSDRVFKAVSDICKTFNIRHPEELSLL---RKPRDPKKKKKKLEDAEEETLELEGPLLTPGSASDVLYIGPVKGSIYSSPGLYSKTMTPTYDSRDG-------SP---LSPTSAW--FGDSPLSEGNPSIL--------------AVSQPITSPDILV-KMYKPQSLLDKAKINQGWLDSSRSLMEQDVKE-NEVLL-LRFKYHSFFDLNPKYDAIRVNQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMSSDNHMNN-SEKEVD-EVDAALSDLEITLEGGKTSNTLGDITSIPELADYVKVFKPKKLTLKGYKQYWCTFKDITISCYKSREEAHGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIP--------------VADGMNEIWLRCDTEKQYAQWMAACRLASKGKTMAD-SSYNLEVQNILSFLKMQHMNPDPQI-IEPITTD-----INPECLVSPRYLKKYKNKQISARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLAKFQGGKKDELIGITYNRLIRMDAGTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEPSLAFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 684          
BLAST of PH domain-containing protein vs. Ensembl Zebrafish
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:553051])

HSP 1 Score: 192.586 bits (488), Expect = 1.673e-51
Identity = 184/725 (25.38%), Postives = 341/725 (47.03%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYK-----DRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDL-IGKSCNE--DEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIP-----IKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMK----SPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKE-------ILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLT 2241
             ++ + + + +LN   ++RV     I  V   L+ K+ +K DWS+   W   +K WLL     + ++ +Q  +++ F  +  +L +QLP+++  ++ ++FS  VF+    ICK F IRH EELSL    L+K       P +++     +++   +           S  ++ G   +   P Y +R+        SP   +SP S +  F D  L+E + S                + S+ +   DI++ K YK     D+A     W+ S  +LMEQ V + N VLL LR+KYH+++  N KYD IR+NQ++ Q+ W+++  E +C+ +E  + A + +HINKLS   +++   N S  ++D E+D+ L  L   L  GK+ N   D     E+A  +++ K  +  L  YK++     +  I+  K+   +   P     ++G E+  +V                + Q    +L    +     + +R   ++++ +W  A RL SK       S++  E Q + + ++M+     PQ  ++ + T+     +N   ++   + K +K+K+       I  ++L   ++ + +S IEAK+ +I+ W +L   G  +         + ++IGI Y+RLI  D  TG        + +  W  NWE+    + F++           +C++ HE++GGY+F+  R  ++   L+E +F  LT
Sbjct:   16 GTWELKMHVTDLNRDVSLRVTGEIHIGGVMLKLVEKLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKLLRLQLPNMKHMRVKVNFSDRVFKAVSDICKTFNIRHPEELSL----LRKPRD----PKKKKKKLEDAEEETLELEGPLLTPGSGSIYSSPGLYSKTMTPTYDSRDG-------SP---LSPTSAW--FGDSPLSEGNPSIL--------------AVSQPITSPDILV-KMYKPQSLLDKAKINQGWLDSSRSLMEQDVKE-NEVLL-LRFKYHSFFDLNPKYDAIRVNQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMSSDNHMNN-SEKEVD-EVDAALSDLEITLEGGKTSNTLGDITSIPELADYVKVFKPKKLTLKGYKQYWCTFKDITISCYKSREEAHGTPAHQMNLRGCEVTPDV--------------NISGQKFNIKLLIPVADGMNEIWLRCDTEKQYAQWMAACRLASKGKTMA-DSSYNLEVQNILSFLKMQHMNPDPQI-IEPITTD-----INPECLVSPRYLKKYKNKQPGFVRDLISARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLAKFQGGKKDELIGITYNRLIRMDAGTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEPSLAFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 680          
BLAST of PH domain-containing protein vs. Ensembl Zebrafish
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:553051])

HSP 1 Score: 189.504 bits (480), Expect = 2.536e-50
Identity = 184/731 (25.17%), Postives = 337/731 (46.10%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSG------LNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYK-----DRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDL-IGKSCNE--DEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIP-----IKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMK----SPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKE-------ILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLT 2241
             ++ + + + +LN   ++RV     I  V   L+ K+ +K DWS+   W   +K WLL     + ++ +Q  +++ F  +  +L +QLP+++  ++ ++FS  VF+    ICK F IRH EELSL     K  D            +   +      +  +    L  G       ++ G   +   P Y +R+        SP   +SP S +  F D  L+E + S                + S+ +   DI++ K YK     D+A     W+ S  +LMEQ V + N VLL LR+KYH+++  N KYD IR+NQ++ Q+ W+++  E +C+ +E  + A + +HINKLS   +++   N S  ++D E+D+ L  L   L  GK+ N   D     E+A  +++ K  +  L  YK++     +  I+  K+   +   P     ++G E+  +V                + Q    +L    +     + +R   ++++ +W  A RL SK       S++  E Q + + ++M+     PQ  ++ + T+     +N   ++   + K +K+K+       I  ++L   ++ + +S IEAK+ +I+ W +L   G  +         + ++IGI Y+RLI  D  TG        + +  W  NWE+    + F++           +C++ HE++GGY+F+  R  ++   L+E +F  LT
Sbjct:   16 GTWELKMHVTDLNRDVSLRVTGEIHIGGVMLKLVEKLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKLLRLQLPNMKHMRVKVNFSDRVFKAVSDICKTFNIRHPEELSLL---RKPRDPKKKKKKLEDAEEETLELEGPLLTPGSASDVLYIGPVKGSIYSSPGLYSKTMTPTYDSRDG-------SP---LSPTSAW--FGDSPLSEGNPSIL--------------AVSQPITSPDILV-KMYKPQSLLDKAKINQGWLDSSRSLMEQDVKE-NEVLL-LRFKYHSFFDLNPKYDAIRVNQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMSSDNHMNN-SEKEVD-EVDAALSDLEITLEGGKTSNTLGDITSIPELADYVKVFKPKKLTLKGYKQYWCTFKDITISCYKSREEAHGTPAHQMNLRGCEVTPDV--------------NISGQKFNIKLLIPVADGMNEIWLRCDTEKQYAQWMAACRLASKGKTMA-DSSYNLEVQNILSFLKMQHMNPDPQI-IEPITTD-----INPECLVSPRYLKKYKNKQPGFVRDLISARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLAKFQGGKKDELIGITYNRLIRMDAGTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEPSLAFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 691          
BLAST of PH domain-containing protein vs. Ensembl Xenopus
Match: sh3bgrl3 (SH3 domain binding glutamate-rich protein like 3 [Source:Xenbase;Acc:XB-GENE-965976])

HSP 1 Score: 193.356 bits (490), Expect = 1.011e-51
Identity = 186/719 (25.87%), Postives = 338/719 (47.01%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYK-----DRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNE---DEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIP-----IKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMK----SPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNS-WECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLT 2241
             ++ ++I + +LN    +RV     I  V   L        DWS+   W   +K WLL     + ++ +Q  +K+ F  +  +L +QLP+++  ++ ++FS  VF+    ICK F IRH EELSL    L+K       P +++  +   Q             T  S  ++ G   +   P Y +R+        SP   +SP S +  F D +L+E +         S+   SP+            ++ K YK     D+A     W+ S  +LMEQ V + N+ LL LR+KY++++  N KYD IRINQ++ Q+ W+++  E +C+ +E  + A + +HINKLS   + +   N S  ++D E+D+ L  L   L G   +    D     E+   +++ K  +  L  YK++     +  I+  K+   S+  P     ++G E+  +V I  +K  I  +I                ++    + +R  N++++  W  A RL SK       S++  E Q + + ++M+     PQF    + ++     +N   ++   + K +K+K+I  ++L   ++ + +S IEAK+ +I+ W +L   G  +         + ++IGI Y+RLI  D  TG        + +  W  NWE+    + F++   +++F  +  +C++ HE++GGY+F+  R  ++   L+E +F  LT
Sbjct:    8 GTWELNIHVTDLNRDVTLRVTGEVHIGGVMLKL-------KDWSDHALWWEKKKTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDKVFKAVSDICKTFNIRHPEELSL----LRKPRD----PTKKKKKKIDDQCEDNILELEGPLLTPGSIYSSPGLYSKTMTPTYDSRDG-------SP---LSPTSAW--FGDSALSEGNPGI---LAVSQPITSPE------------ILAKMYKPQTLLDKAKINQGWLDSARSLMEQDVKE-NDALL-LRFKYYSFFDLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSVMSSENHYNN-SDKEVD-EVDAALSDLEITLEGGKTSTILGDITSIPELTDYLKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESNGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIP--------------VAEGMNEIWLRCENEKQYAHWMAACRLASKGKTMAD-SSYNLEVQNILSFLKMQHLNPDPQFIPDQVNSD-----INPECVVSPRYLKKYKNKQITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLARFQGGKKEELIGITYNRLIRMDAGTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEM-RLSFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFFKLT 659          
BLAST of PH domain-containing protein vs. Ensembl Xenopus
Match: sh3bgrl3 (SH3 domain binding glutamate-rich protein like 3 [Source:Xenbase;Acc:XB-GENE-965976])

HSP 1 Score: 193.356 bits (490), Expect = 1.119e-51
Identity = 186/719 (25.87%), Postives = 338/719 (47.01%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYK-----DRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNE---DEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIP-----IKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMK----SPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNS-WECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLT 2241
             ++ ++I + +LN    +RV     I  V   L        DWS+   W   +K WLL     + ++ +Q  +K+ F  +  +L +QLP+++  ++ ++FS  VF+    ICK F IRH EELSL    L+K       P +++  +   Q             T  S  ++ G   +   P Y +R+        SP   +SP S +  F D +L+E +         S+   SP+            ++ K YK     D+A     W+ S  +LMEQ V + N+ LL LR+KY++++  N KYD IRINQ++ Q+ W+++  E +C+ +E  + A + +HINKLS   + +   N S  ++D E+D+ L  L   L G   +    D     E+   +++ K  +  L  YK++     +  I+  K+   S+  P     ++G E+  +V I  +K  I  +I                ++    + +R  N++++  W  A RL SK       S++  E Q + + ++M+     PQF    + ++     +N   ++   + K +K+K+I  ++L   ++ + +S IEAK+ +I+ W +L   G  +         + ++IGI Y+RLI  D  TG        + +  W  NWE+    + F++   +++F  +  +C++ HE++GGY+F+  R  ++   L+E +F  LT
Sbjct:   14 GTWELNIHVTDLNRDVTLRVTGEVHIGGVMLKL-------KDWSDHALWWEKKKTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDKVFKAVSDICKTFNIRHPEELSL----LRKPRD----PTKKKKKKIDDQCEDNILELEGPLLTPGSIYSSPGLYSKTMTPTYDSRDG-------SP---LSPTSAW--FGDSALSEGNPGI---LAVSQPITSPE------------ILAKMYKPQTLLDKAKINQGWLDSARSLMEQDVKE-NDALL-LRFKYYSFFDLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSVMSSENHYNN-SDKEVD-EVDAALSDLEITLEGGKTSTILGDITSIPELTDYLKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESNGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIP--------------VAEGMNEIWLRCENEKQYAHWMAACRLASKGKTMAD-SSYNLEVQNILSFLKMQHLNPDPQFIPDQVNSD-----INPECVVSPRYLKKYKNKQITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLARFQGGKKEELIGITYNRLIRMDAGTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEM-RLSFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFFKLT 665          
BLAST of PH domain-containing protein vs. Ensembl Xenopus
Match: sh3bgrl3 (SH3 domain binding glutamate-rich protein like 3 [Source:Xenbase;Acc:XB-GENE-965976])

HSP 1 Score: 192.971 bits (489), Expect = 1.454e-51
Identity = 192/735 (26.12%), Postives = 347/735 (47.21%), Query Frame = 1
Query:  103 NMSIDSLKSNRISSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYK-----DRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNE---DEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIP-----IKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMK----SPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHV----NQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNS-WECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLT 2241
            N+ + S+K N   ++ ++I + +LN    +RV     I  V   L        DWS+   W   +K WLL     + ++ +Q  +K+ F  +  +L +QLP+++  ++ ++FS  VF+    ICK F IRH EELSL    L+K       P +++  +   Q             T  S  ++ G   +   P Y +R+        SP   +SP S +  F D +L+E +         S+   SP+            ++ K YK     D+A     W+ S  +LMEQ V + N+ LL LR+KY++++  N KYD IRINQ++ Q+ W+++  E +C+ +E  + A + +HINKLS   + +   N S  ++D E+D+ L  L   L G   +    D     E+   +++ K  +  L  YK++     +  I+  K+   S+  P     ++G E+  +V I  +K  I  +I                ++    + +R  N++++  W  A RL SK       S++  E Q + + ++M+     PQF    + ++     +N   ++   + K +K+K+I  ++L   ++ + +S IEAK+ +I+ W +L   G  +   HV        + ++IGI Y+RLI  D  TG        + +  W  NWE+    + F++   +++F  +  +C++ HE++GGY+F+  R  ++   L+E +F  LT
Sbjct:    3 NIPLLSVKEN--GTWELNIHVTDLNRDVTLRVTGEVHIGGVMLKL-------KDWSDHALWWEKKKTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDKVFKAVSDICKTFNIRHPEELSL----LRKPRD----PTKKKKKKIDDQCEDNILELEGPLLTPGSIYSSPGLYSKTMTPTYDSRDG-------SP---LSPTSAW--FGDSALSEGNPGI---LAVSQPITSPE------------ILAKMYKPQTLLDKAKINQGWLDSARSLMEQDVKE-NDALL-LRFKYYSFFDLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSVMSSENHYNN-SDKEVD-EVDAALSDLEITLEGGKTSTILGDITSIPELTDYLKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESNGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIP--------------VAEGMNEIWLRCENEKQYAHWMAACRLASKGKTMAD-SSYNLEVQNILSFLKMQHLNPDPQFIPDQVNSD-----INPECVVSPRYLKKYKNKQITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLQHVLYRFQGGKKEELIGITYNRLIRMDAGTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEM-RLSFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFFKLT 668          
BLAST of PH domain-containing protein vs. Ensembl Xenopus
Match: sh3bgrl3 (SH3 domain binding glutamate-rich protein like 3 [Source:Xenbase;Acc:XB-GENE-965976])

HSP 1 Score: 188.734 bits (478), Expect = 3.776e-50
Identity = 188/723 (26.00%), Postives = 337/723 (46.61%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHL-----KYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSG--LNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYK-----DRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNEDEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIP-----IKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMK----SPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNS-WECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLT 2241
             ++ ++I + +LN    +RV     I  V   L+  + L     K DWS+   W   +K WLL     + ++ +Q  +K+ F  +  +L +QLP+++  ++ ++FS  VF+    ICK F IRH EELSL    L+K       P +++  +   Q             T  SG   ++ G   +   P Y +R+        SP   +SP S +  F D +L+E +         S+   SP+            ++ K YK     D+A     W+ S  +LMEQ V + N+ LL LR+KY++++  N KYD IRINQ++ Q+ W+++  E +C+ +E  + A + +HINKLS   + +   N S  ++D E+D+ L  L   L G              G    I   +  L  YK++     +  I+  K+   S+  P     ++G E+  +V I  +K  I  +I                ++    + +R  N++++  W  A RL SK       S++  E Q + + ++M+     PQF    + ++     +N   ++   + K +K+K+I  ++L   ++ + +S IEAK+ +I+ W +L   G  +         + ++IGI Y+RLI  D  TG        + +  W  NWE+    + F++   +++F  +  +C++ HE++GGY+F+  R  ++   L+E +F  LT
Sbjct:   16 GTWELNIHVTDLNRDVTLRVTGEVHIGGVMLKLLIFVALILLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDKVFKAVSDICKTFNIRHPEELSL----LRKPRD----PTKKKKKKIDDQCEDNILELEGPLLTPGSGSIYSSPGLYSKTMTPTYDSRDG-------SP---LSPTSAW--FGDSALSEGNPGI---LAVSQPITSPE------------ILAKMYKPQTLLDKAKINQGWLDSARSLMEQDVKE-NDALL-LRFKYYSFFDLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSVMSSENHYNN-SDKEVD-EVDAALSDLEITLEG--------------GKTSTIL--KLTLKGYKQYWCTFKDTSISCYKSKEESNGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIP--------------VAEGMNEIWLRCENEKQYAHWMAACRLASKGKTMAD-SSYNLEVQNILSFLKMQHLNPDPQFIPDQVNSD-----INPECVVSPRYLKKYKNKQITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLARFQGGKKEELIGITYNRLIRMDAGTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEM-RLSFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFFKLT 662          
BLAST of PH domain-containing protein vs. Ensembl Xenopus
Match: sh3bgrl3 (SH3 domain binding glutamate-rich protein like 3 [Source:Xenbase;Acc:XB-GENE-965976])

HSP 1 Score: 188.348 bits (477), Expect = 5.821e-50
Identity = 187/715 (26.15%), Postives = 334/715 (46.71%), Query Frame = 1
Query:  151 ISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYK-----DRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNE---DEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIP-----IKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMK----SPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNS-WECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLT 2241
            ++I + +LN    +RV     I  V   L        DWS+   W   +K WLL     + ++ +Q  +K+ F  +  +L +QLP+++  ++ ++FS  VF+    ICK F IRH EELSL    L+K       P +++  +   Q             T  S  ++ G   +   P Y +R+        SP   +SP S +  F D +L+E +         S+   SP+            ++ K YK     D+A     W+ S  +LMEQ V + N+ LL LR+KY++++  N KYD IRINQ++ Q+ W+++  E +C+ +E  + A + +HINKLS   + +   N S  ++D E+D+ L  L   L G   +    D     E+   +++ K  +  L  YK++     +  I+  K+   S+  P     ++G E+  +V I  +K  I  +I                ++    + +R  NQ  +  W  A RL SK       S++  E Q + + ++M+     PQF    + ++     +N   ++   + K +K+K+I  ++L   ++ + +S IEAK+ +I+ W +L   G  +         + ++IGI Y+RLI  D  TG        + +  W  NWE+    + F++   +++F  +  +C++ HE++GGY+F+  R  ++   L+E +F  LT
Sbjct:   15 LNIHVTDLNRDVTLRVTGEVHIGGVMLKL-------KDWSDHALWWEKKKTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDKVFKAVSDICKTFNIRHPEELSL----LRKPRD----PTKKKKKKIDDQCEDNILELEGPLLTPGSIYSSPGLYSKTMTPTYDSRDG-------SP---LSPTSAW--FGDSALSEGNPGI---LAVSQPITSPE------------ILAKMYKPQTLLDKAKINQGWLDSARSLMEQDVKE-NDALL-LRFKYYSFFDLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSVMSSENHYNN-SDKEVD-EVDAALSDLEITLEGGKTSTILGDITSIPELTDYLKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESNGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIP--------------VAEGMNEIWLRCENQ--YAHWMAACRLASKGKTMAD-SSYNLEVQNILSFLKMQHLNPDPQFIPDQVNSD-----INPECVVSPRYLKKYKNKQITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLARFQGGKKEELIGITYNRLIRMDAGTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEM-RLSFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFFKLT 660          
BLAST of PH domain-containing protein vs. Ensembl Mouse
Match: Fermt2 (fermitin family member 2 [Source:MGI Symbol;Acc:MGI:2385001])

HSP 1 Score: 206.453 bits (524), Expect = 2.855e-56
Identity = 183/711 (25.74%), Postives = 333/711 (46.84%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRN--SQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNE---DEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIP-----IKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLT 2241
             ++ +S+ + +LN    +RV     I  V   L+ K+ +K DWS+   W   ++ WLL     + +  +Q  +K+ F  +  +L +QLP+++  ++ ++FS  VF+    ICK F IRH EELSL                ++    +  ++      + +    L   L   G    ++ P   ++      D  + SP   +SP S +  F D +L+E +         S+   SP+   ++  K Q ++      D+A +   W+ S  +LMEQ V +  N  L LR+KY++++  N KYD IRINQ++ Q+ W+++  E +C+ +E  + A + +HINKLS   T+    N S  ++D E+D+ L  L   L G   +    D     E+A  I++ K  +  L  YK++     +  I+  K+   SS  P     ++G E+  +V I  +K  I  +I                ++    + +R  N++++  W  A RL SK       S++  E Q + + ++M+    + +++      D VN   ++   + K +KSK+I  ++L   ++ + +S IEAK+ +I+ W +L   G  +           ++IGI Y+RLI  D  TG        + +  W  NWE+    + F++           +C++ HE++GGY+F+  R  ++   L+E +F  LT
Sbjct:   16 GTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRTWLLKTHWTLDKCGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSL---------------LKKPRDPTKKKKKKLDDQSEDEALELEGPLIMPGSGSIYSSPGLYSKTMTPTYDAHDGSP---LSPTSAW--FGDSALSEGNPGI---LAVSQPVTSPE-ILAKMFKPQALL------DKAKTNQGWLDSSRSLMEQDVKE--NEALLLRFKYYSFFDLNPKYDAIRINQLYEQAKWALLLEEIECTEEEMMMFAALQYHINKLSIM-TSENHLNNSDKEVD-EVDAALSDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSREESSGTPAHQLNLRGCEVTPDVNISGQKFNIKLLIP--------------VAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMAD-SSYNLEVQNILSFLKMQHLNPDPQLIPDQITTD-VNPECLVSPRYLKKYKSKQITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKREELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 676          
BLAST of PH domain-containing protein vs. Ensembl Mouse
Match: Fermt1 (fermitin family member 1 [Source:MGI Symbol;Acc:MGI:2443583])

HSP 1 Score: 162.155 bits (409), Expect = 3.579e-41
Identity = 129/497 (25.96%), Postives = 238/497 (47.89%), Query Frame = 1
Query:  799 LSYYESFENSKLT--NSPKKSFSEALKQQDIVI----YKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCN---EDEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIPI-----KGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKN-SWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 2244
            LS    F +S LT  N    +FS+     D++      ++  D+A     W+ S  +LMEQ++ +     L+LR+KY+ ++  N KYD +RINQ++ Q+ W+++  E DC+ +E  + A + +HI+KLS      + A  S  D   E+++ L  L   L G   +   ED  +  ++A  ++L +  + +L   K++  V  +  I   K   +    PI     +G EI  +V +  +K  I  +I                +     V +R  ++ ++ +W  A  L SK       S+++ E   + + ++MK+ + +  ++ ++ E   +N   ++     K  KSK++  ++L    + + +  +EAK+ +I+ W +L   G  Y  V    + +  I+G+ Y+RLI  D  TG+         +  W  NWE+    + F +    I F   S +C+I HEY+GGY+F+  R+ ++   L+E +F  LTG
Sbjct:  200 LSTMTWFGDSPLTEQNCSVLAFSQPPPSPDVLADMFQPRSLVDKAKMNAGWLDSSRSLMEQSIQEDEQ--LQLRFKYYTFFDLNPKYDAVRINQLYEQARWAVLLEEIDCTEEEMLIFAALQYHISKLSQCAEIQDFATKSEVD---EVEAALSSLEVTLEGGKADNTLEDITDIPKLADYLKLFRPKKLMLKACKQYWFVFKDTSIAYFKNKELEQGEPIEKLNLRGCEIVPDVNVSGRKFGIKLLIP--------------VADGMNEVYLRCDHEDQYARWMAACILASKGKTMAD-SSYQPEVISILSFLKMKN-RNSSPLVASSLENMDMNPECLVSPCCAKKHKSKQLAARILEAHHNVAQMPLVEAKLQFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVAYNRLIRIDAVTGIPVTTWRFANMKQWNVNWEIRQVAIEFDQNV-SIAFTCLSADCKIVHEYIGGYIFLSTRSKDQNETLDEDLFHKLTG 674          

HSP 2 Score: 61.2326 bits (147), Expect = 4.172e-9
Identity = 34/115 (29.57%), Postives = 58/115 (50.43%), Query Frame = 1
Query:  169 ELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSL 513
            E  T   +RV     I  V   L+ ++++  DWS++  W   ++ WLL     + +  +Q  + + F  +  +L ++LP+ +  +L + FS  VF+    ICK   IR  EELSL
Sbjct:   24 EQQTEITLRVSGDLHIGGVMLKLVEQMNIAQDWSDYALWWEQKRCWLLKTHWTLDKCGVQADANLLFTPQHKMLRLRLPNAKTVRLRVSFSAVVFKAVADICKVLNIRRPEELSL 138          
BLAST of PH domain-containing protein vs. Ensembl Mouse
Match: Fermt3 (fermitin family member 3 [Source:MGI Symbol;Acc:MGI:2147790])

HSP 1 Score: 159.844 bits (403), Expect = 1.971e-40
Identity = 109/456 (23.90%), Postives = 222/456 (48.68%), Query Frame = 1
Query:  928 HWMISELTLMEQAV--GDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLD-KEIDSMLDRLHFDLIGKSCNE--DEMEHI-EIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIP-----IKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNL-----KMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKN-SWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 2244
             W+ S   LM+Q +  GD    +L LR+KY++++  + K D +R+ Q++ Q+ W +++ E DC+ +E  + A + +HINKL+ +    +   L+  DL   ++D+ L+ L   L G + ++  D +  I E+  ++ + +  +  L  Y+++  V  +  ++  K+ + +   P     +KG E+  +V +  +K  I  ++               + +    + +R  ++Q++ +W  A RL SK       S++  E Q +   + ++    +      K        + +N   ++     + FK+K++  ++L   ++ + LS  EA++ +I+ W +L + G  Y+ V    + + +I+GI  +RLI  D+  G V      + +  W  NW++    + F E    + F   S  C+I HEY+GGY+F+  R   +  +L+E +F  LTG
Sbjct:  228 RWLDSSRCLMQQGIKAGD----VLWLRFKYYSFFDLDPKTDPVRLTQLYEQARWDLLTEEIDCTEEEMMVFAALQYHINKLTLS---GDVGELASGDLGLDDLDAALNNLEVKLKGSAPSDMLDSLTTIPELKDHLRIFRPRKLTLKGYRQYWVVFKDTTLSYYKSQDEAPGDPTQQLNLKGCEVVPDVNVSGQKFCIKLLVP--------------SPEGMSEIYLRCQDEQQYAQWMAACRLASKGRTMAD-SSYASEVQAILAFLSLQRAGGSNGGSGNKPQGPEAPAEGLNPYGLVAPRFQRKFKAKQLTPRILEAHQNVAQLSLTEAQLRFIQAWQSLPDFGISYVMVRFKGSRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWNVNWDIRQVAIEFDEHI-NVAFSCVSASCRIVHEYIGGYIFLSTRERARGEELDEDLFLQLTG 660          

HSP 2 Score: 63.5438 bits (153), Expect = 8.505e-10
Identity = 37/128 (28.91%), Postives = 69/128 (53.91%), Query Frame = 1
Query:  139 SSFVISIFIKELNT---THNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSL 513
            SS+ + +F+ E +    +  +RV   + I  V   ++ +I+ K DWS+   W   ++ WLL     + ++ +   +++ F  +   + ++LP+ ++ +L   FSK +FQT   IC+   IRH EELSL
Sbjct:   14 SSWELRVFVGEEDPEAQSVTLRVTGESHIGGVLLKIVEEINRKQDWSDHAIWWEQKRQWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRVLRLRASFSKPLFQTVAAICRLLSIRHPEELSL 141          
BLAST of PH domain-containing protein vs. Ensembl Mouse
Match: Fermt2 (fermitin family member 2 [Source:MGI Symbol;Acc:MGI:2385001])

HSP 1 Score: 78.1814 bits (191), Expect = 1.926e-15
Identity = 40/125 (32.00%), Postives = 69/125 (55.20%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSL 513
             ++ +S+ + +LN    +RV     I  V   L+ K+ +K DWS+   W   ++ WLL     + +  +Q  +K+ F  +  +L +QLP+++  ++ ++FS  VF+    ICK F IRH EELSL
Sbjct:   16 GTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRTWLLKTHWTLDKCGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSL 140          
BLAST of PH domain-containing protein vs. Ensembl Mouse
Match: Fermt3 (fermitin family member 3 [Source:MGI Symbol;Acc:MGI:2147790])

HSP 1 Score: 74.7146 bits (182), Expect = 2.123e-13
Identity = 48/188 (25.53%), Postives = 101/188 (53.72%), Query Frame = 1
Query:  931 WMISELTLMEQAV--GDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLD-KEIDSMLDRLHFDLIGKSCNE--DEMEHI-EIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIP-----IKGNEIRLNV 1461
            W+ S   LM+Q +  GD    +L LR+KY++++  + K D +R+ Q++ Q+ W +++ E DC+ +E  + A + +HINKL+    + +   L+  DL   ++D+ L+ L   L G + ++  D +  I E+  ++ + +  +  L  Y+++  V  +  ++  K+ + +   P     +KG E+  +V
Sbjct:  229 WLDSSRCLMQQGIKAGD----VLWLRFKYYSFFDLDPKTDPVRLTQLYEQARWDLLTEEIDCTEEEMMVFAALQYHINKLT---LSGDVGELASGDLGLDDLDAALNNLEVKLKGSAPSDMLDSLTTIPELKDHLRIFRPRKLTLKGYRQYWVVFKDTTLSYYKSQDEAPGDPTQQLNLKGCEVVPDV 409          

HSP 2 Score: 63.1586 bits (152), Expect = 9.467e-10
Identity = 37/128 (28.91%), Postives = 69/128 (53.91%), Query Frame = 1
Query:  139 SSFVISIFIKELNT---THNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSL 513
            SS+ + +F+ E +    +  +RV   + I  V   ++ +I+ K DWS+   W   ++ WLL     + ++ +   +++ F  +   + ++LP+ ++ +L   FSK +FQT   IC+   IRH EELSL
Sbjct:   14 SSWELRVFVGEEDPEAQSVTLRVTGESHIGGVLLKIVEEINRKQDWSDHAIWWEQKRQWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRVLRLRASFSKPLFQTVAAICRLLSIRHPEELSL 141          
BLAST of PH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5R8M5|FERM1_PONAB (Fermitin family homolog 1 OS=Pongo abelii OX=9601 GN=FERMT1 PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 6.180e-58
Identity = 172/693 (24.82%), Postives = 320/693 (46.18%), Query Frame = 1
Query:  190 IRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCN---EDEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIPI-----KGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 2244
            +RV     +  V   L+ +I++  DWS+F  W   +  WLL     + ++ +Q  +K+ F  +  +L ++LP+L++ +L + FS  VF+    ICK   IR  EELSL    LK          ++  +          +   +  ++++S   + G   +   PIY             P N     S  + F D  L E + S         L  S     SEAL   D+   ++  D+A     W+ S  +LMEQ + +   +LLR  +KY++++  N KYD +RINQ++ Q+ W+++  E DC+ +E  + A + +HI+KLS +   +ET + +      EI++ L  L   L G   +   ED  +  ++A N++L +  + +L  +K++  V  +  I   K   +    P+     +G E+  NV + ++K  I  +I                +     + +R  ++ ++ +W  A  L SK       S+++ E   + + + MK+     ++  + + +D +N    +     K  KSK++  ++L   ++ + +  +EAK+ +I+ W +L   G  Y  V    + +  I+G+ Y+RLI  D  TG+         +  W  +WE    ++ F +  +      S +C+I HEY+GGY+F+  R+ ++   L+E +F  LTG
Sbjct:   31 LRVSGDLHVGGVMLQLVEQINISQDWSDFALWWEQKHCWLLKTHWTLDKYGVQADAKLLFTPQHKMLRLRLPNLKMVRLRVSFSAVVFKAVSDICKTLNIRRSEELSL----LKPCGDYFKKKKKKDKNNKEPITEDILNLESSPTASVSS--VSPGLYSKTMTPIY------------DPINGTPASSTMTWFSDSPLTEQNCSI--------LAFSQPPQSSEALA--DMYQPRSLVDKAKLNAGWLDSSRSLMEQGIQEDGQLLLR--FKYYSFFDLNPKYDAVRINQLYEQARWAILLEEIDCTEEEMLIFAALQYHISKLSLS---AETQDFTSESEVDEIEAALSNLEVTLEGGKADSLLEDITDIPKLADNLKLFRPKKLLLKAFKQYWFVFKDTSIAYFKNKELEQGEPLEKLNLRGCEVVPNVNVAERKFGIKLLIP--------------VADGMNEMYLRCDHENQYAQWMAACMLASKGKTMAD-SSYRPEVLNILSFLRMKNRNSASQVASSPENMD-MNPECFVSPRCAKKHKSKQLAARILEAHQNVAQMPLVEAKLRFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVSYNRLIKIDAATGIPVTTWRFTNIKQWNVSWETRQVVIEFDQNVFTAFTCLSADCKIVHEYIGGYIFLSTRSKDQNETLDEDLFHKLTG 674          
BLAST of PH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8CIB5|FERM2_MOUSE (Fermitin family homolog 2 OS=Mus musculus OX=10090 GN=Fermt2 PE=1 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 1.997e-55
Identity = 183/711 (25.74%), Postives = 333/711 (46.84%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRN--SQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNE---DEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIP-----IKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLT 2241
             ++ +S+ + +LN    +RV     I  V   L+ K+ +K DWS+   W   ++ WLL     + +  +Q  +K+ F  +  +L +QLP+++  ++ ++FS  VF+    ICK F IRH EELSL                ++    +  ++      + +    L   L   G    ++ P   ++      D  + SP   +SP S +  F D +L+E +         S+   SP+   ++  K Q ++      D+A +   W+ S  +LMEQ V +  N  L LR+KY++++  N KYD IRINQ++ Q+ W+++  E +C+ +E  + A + +HINKLS   T+    N S  ++D E+D+ L  L   L G   +    D     E+A  I++ K  +  L  YK++     +  I+  K+   SS  P     ++G E+  +V I  +K  I  +I                ++    + +R  N++++  W  A RL SK       S++  E Q + + ++M+    + +++      D VN   ++   + K +KSK+I  ++L   ++ + +S IEAK+ +I+ W +L   G  +           ++IGI Y+RLI  D  TG        + +  W  NWE+    + F++           +C++ HE++GGY+F+  R  ++   L+E +F  LT
Sbjct:   16 GTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRTWLLKTHWTLDKCGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSL---------------LKKPRDPTKKKKKKLDDQSEDEALELEGPLIMPGSGSIYSSPGLYSKTMTPTYDAHDGSP---LSPTSAW--FGDSALSEGNPGI---LAVSQPVTSPE-ILAKMFKPQALL------DKAKTNQGWLDSSRSLMEQDVKE--NEALLLRFKYYSFFDLNPKYDAIRINQLYEQAKWALLLEEIECTEEEMMMFAALQYHINKLSIM-TSENHLNNSDKEVD-EVDAALSDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSREESSGTPAHQLNLRGCEVTPDVNISGQKFNIKLLIP--------------VAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMAD-SSYNLEVQNILSFLKMQHLNPDPQLIPDQITTD-VNPECLVSPRYLKKYKSKQITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKREELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 676          
BLAST of PH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9BQL6|FERM1_HUMAN (Fermitin family homolog 1 OS=Homo sapiens OX=9606 GN=FERMT1 PE=1 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 2.167e-55
Identity = 173/693 (24.96%), Postives = 319/693 (46.03%), Query Frame = 1
Query:  190 IRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCN---EDEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIPI-----KGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 2244
            +RV     +  V   L+ +I++  DWS+F  W   +  WLL     + ++ +Q  +K+ F  +  +L ++LP+L++ +L + FS  VF+    ICK   IR  EELSL    LK   S      +++  ++  +  +    N     T +    + G   +   PIY             P N     S  + F D  L E + S       S+   SP     EAL   D+   ++  D+A     W+ S  +LMEQ + +   +LLR  +KY++++  N KYD +RINQ++ Q+ W+++  E DC+ +E  + A + +HI+KLS +    + A  S  D   EI++ L  L   L G   +   ED  +  ++A N++L +  + +   +K++  +  +  I   K   +    P+     +G E+  +V +  +K  I  +I                +     + +R  ++ ++ +W  A  L SK       S+++ E   + + + MK+     ++  + + +D +N    +     K  KSK++  ++L   ++ + +  +EAK+ +I+ W +L   G  Y  V    + +  I+G+ Y+RLI  D  TG+         +  W  NWE    ++ F +  +      S +C+I HEY+GGY+F+  R+ ++   L+E +F  LTG
Sbjct:   31 LRVSGDLHVGGVMLKLVEQINISQDWSDFALWWEQKHCWLLKTHWTLDKYGVQADAKLLFTPQHKMLRLRLPNLKMVRLRVSFSAVVFKAVSDICKILNIRRSEELSL----LKP--SGDYFKKKKKKDKNNKEPIIEDILNLESSPTASGSSVSPGLYSKTMTPIY------------DPINGTPASSTMTWFSDSPLTEQNCSI---LAFSQPPQSP-----EALA--DMYQPRSLVDKAKLNAGWLDSSRSLMEQGIQEDEQLLLR--FKYYSFFDLNPKYDAVRINQLYEQARWAILLEEIDCTEEEMLIFAALQYHISKLSLSAETQDFAGESEVD---EIEAALSNLEVTLEGGKADSLLEDITDIPKLADNLKLFRPKKLLPKAFKQYWFIFKDTSIAYFKNKELEQGEPLEKLNLRGCEVVPDVNVAGRKFGIKLLIP--------------VADGMNEMYLRCDHENQYAQWMAACMLASKGKTMAD-SSYQPEVLNILSFLRMKNRNSASQVASSLENMD-MNPECFVSPRCAKRHKSKQLAARILEAHQNVAQMPLVEAKLRFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVSYNRLIKIDAATGIPVTTWRFTNIKQWNVNWETRQVVIEFDQNVFTAFTCLSADCKIVHEYIGGYIFLSTRSKDQNETLDEDLFHKLTG 674          
BLAST of PH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96AC1|FERM2_HUMAN (Fermitin family homolog 2 OS=Homo sapiens OX=9606 GN=FERMT2 PE=1 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 4.569e-55
Identity = 183/715 (25.59%), Postives = 335/715 (46.85%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRN--SQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNE---DEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIP-----IKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMK----SPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLT 2241
             ++ +S+ + +LN    +RV     I  V   L+ K+ +K DWS+   W   ++ WLL     + ++ +Q  +K+ F  +  +L +QLP+++  ++ ++FS  VF+    ICK F IRH EELSL                ++    +  ++      + +    L   L T G    ++ P   ++      D  + SP   +SP S +  F D +L+E +         S+   SP+   ++  K Q ++      D+A     W+ S  +LMEQ V +  N  L LR+KY++++  N KYD IRINQ++ Q+ W+++  E +C+ +E  + A + +HINKLS   T+    N S  ++D E+D+ L  L   L G   +    D     E+A  I++ K  +  L  YK++     +  I+  K+   SS  P     ++G E+  +V I  +K  I  +I                ++    + +R  N++++  W  A RL SK       S++  E Q + + ++M+     PQ   + + T+     +    ++   + K +K+K+I  ++L   ++ + +S IEAK+ +I+ W +L   G  +         + ++IGI Y+RLI  D  TG        + +  W  NWE+    + F++           +C++ HE++GGY+F+  R  ++   L+E +F  LT
Sbjct:   16 GTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSL---------------LKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYSSPGLYSKTMTPTYDAHDGSP---LSPTSAW--FGDSALSEGNPGI---LAVSQPITSPE-ILAKMFKPQALL------DKAKINQGWLDSSRSLMEQDVKE--NEALLLRFKYYSFFDLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIM-TSENHLNNSDKEVD-EVDAALSDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIP--------------VAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMAD-SSYNLEVQNILSFLKMQHLNPDPQLIPEQITTD-----ITPECLVSPRYLKKYKNKQITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 676          
BLAST of PH domain-containing protein vs. UniProt/SwissProt
Match: sp|F1Q8X5|FERM2_DANRE (Fermitin family homolog 2 OS=Danio rerio OX=7955 GN=fermt2 PE=2 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 1.263e-50
Identity = 184/725 (25.38%), Postives = 341/725 (47.03%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYK-----DRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDL-IGKSCNE--DEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIP-----IKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMK----SPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKE-------ILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLT 2241
             ++ + + + +LN   ++RV     I  V   L+ K+ +K DWS+   W   +K WLL     + ++ +Q  +++ F  +  +L +QLP+++  ++ ++FS  VF+    ICK F IRH EELSL    L+K       P +++     +++   +           S  ++ G   +   P Y +R+        SP   +SP S +  F D  L+E + S                + S+ +   DI++ K YK     D+A     W+ S  +LMEQ V + N VLL LR+KYH+++  N KYD IR+NQ++ Q+ W+++  E +C+ +E  + A + +HINKLS   +++   N S  ++D E+D+ L  L   L  GK+ N   D     E+A  +++ K  +  L  YK++     +  I+  K+   +   P     ++G E+  +V                + Q    +L    +     + +R   ++++ +W  A RL SK       S++  E Q + + ++M+     PQ  ++ + T+     +N   ++   + K +K+K+       I  ++L   ++ + +S IEAK+ +I+ W +L   G  +         + ++IGI Y+RLI  D  TG        + +  W  NWE+    + F++           +C++ HE++GGY+F+  R  ++   L+E +F  LT
Sbjct:   16 GTWELKMHVTDLNRDVSLRVTGEIHIGGVMLKLVEKLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKLLRLQLPNMKHMRVKVNFSDRVFKAVSDICKTFNIRHPEELSL----LRKPRD----PKKKKKKLEDAEEETLELEGPLLTPGSGSIYSSPGLYSKTMTPTYDSRDG-------SP---LSPTSAW--FGDSPLSEGNPSIL--------------AVSQPITSPDILV-KMYKPQSLLDKAKINQGWLDSSRSLMEQDVKE-NEVLL-LRFKYHSFFDLNPKYDAIRVNQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMSSDNHMNN-SEKEVD-EVDAALSDLEITLEGGKTSNTLGDITSIPELADYVKVFKPKKLTLKGYKQYWCTFKDITISCYKSREEAHGTPAHQMNLRGCEVTPDV--------------NISGQKFNIKLLIPVADGMNEIWLRCDTEKQYAQWMAACRLASKGKTMA-DSSYNLEVQNILSFLKMQHMNPDPQI-IEPITTD-----INPECLVSPRYLKKYKNKQPGFVRDLISARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLAKFQGGKKDELIGITYNRLIRMDAGTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEPSLAFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 680          
BLAST of PH domain-containing protein vs. TrEMBL
Match: A0A2C9JQH7 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106063740 PE=4 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 8.321e-71
Identity = 200/735 (27.21%), Postives = 339/735 (46.12%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSL--QW--KELKKL-------------DSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTK--PIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDD-LSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCN-EDEMEHI-EIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIPI------KGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMK----SPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKN-SWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 2244
             S+ ++I + +L     +RV     I  V   L+  + +  DWS+   W P +  WLL   + + Q+ +Q  +K++F      L +QLPDLQ+ +L +DFS   F T    CK+ GIRH EELS   +W  ++LKK+             D N P+                           +SG    G    +    P+  +  S       SP+NL + VS +S F+  +S        +E    S L NSP     +A   Q +   K + ++A     W+ S ++L+EQ + +  N  + L++K++N+Y  N KYD IRINQI+ Q+ W++IS E DC+ +E  + A + H +   S         + +    D EID+ L  L   L G + +   ++ HI E++  ++  K  +  L  YKK+ A   +  I   +T   S   PI      +G E + +V +   K  I   +                 +    + +RF  ++++ +W  A +L SK       S+++ E Q + + + ++    SP  N     +N  +  VN  D I +   K  K++ ++ K++    S   +S +EAK+A+IK W +L   G  Y  + +  + + +++G+  +R+I  D+ TG        N L SW  NWE+ N +L F     K+ F +    C+  HE++GGY+F+ MR+++K   LNE +F  LTG
Sbjct:   14 GSWELNILVTDLQVEKTLRVMGDLHIGGVMVKLVQALDIALDWSDHALWWPDKNKWLLRARSTLDQYNVQADAKLHFTPMHKNLKVQLPDLQVLELSVDFSIKCFATVVQTCKELGIRHPEELSFLRKWDKEDLKKVAKEVHKRKKRGDPDQNGPLSANGTHHN-------------------SSGSLDGGKLSPYPSRSPVGPSPTSTLVRSANSPYNLSTSVSGYSTFNGTMSPGSMHSLSFEGTMESTLANSPFVPAKDAF--QYLYRPKNFAEKARINCAWLDSSISLLEQGIKE--NDFIMLKFKFYNFYDLNPKYDAIRINQIYEQAKWALISEEIDCTEEEMMVFAALQHQVRIQSGLPQPEFDQSQNAQSEDDEIDAALKDLQESLEGSAVSPHGDITHIPELSDYVKFFKPKKLTLKSYKKYFATFKDTFIAFYRTKEESHGPPIMQRIDVRGCEAQPDVNLSAHKYGIKLFVPE--------------PEGMSEICLRFDLEEQYCRWMAACKLASKGKTMAD-SSYEAEVQAIQSFLGLQHPVVSPSHNSPTSSSNV-ITEVNSDDYIAARFFKKVKARSLVSKIMEAHASVQEMSLMEAKLAFIKAWQSLPEFGITYFRIKMANSRKEELMGVASNRIIRMDLNTGDSLKTWRYNTLQSWHVNWEVENVILDFDTE--KVTFASMECSCKTIHEFIGGYIFLSMRSTDKNQSLNEEMFHKLTG 707          
BLAST of PH domain-containing protein vs. TrEMBL
Match: A0A1S3J2D1 (fermitin family homolog 2 OS=Lingula unguis OX=7574 GN=LOC106169603 PE=4 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 1.516e-67
Identity = 194/725 (26.76%), Postives = 331/725 (45.66%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRNSQNDLEEP------SPFNLVSPVSFFSIFDDLSLNE-TDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNEDEMEHIEIAGNIELIKYPRNILSLYK----------KHSAVLSNEGINIIKTTNVSSKIPI-----KGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSW-ECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 2244
             S+ + I + ++     +RV     I  V   L+  +    DWS+   W P E +WL    + + Q+ +   ++++F      L +QLPDLQI  +  DFS  +F +   ICK+ GIRH EE+SL W+++ + +       ++R  Q  S               LT   N +G   +        R  Q  L  P      SPF   +P S +S    LS    + LS+  S E S L NSP+    EA     +   K+Y D+A     W+ S  +LMEQ + + + VLL+  +K++++Y  N KYD +RINQI+ Q  W++IS E DC+ +E  + A +   ++  +  D      + S N+   +ID+ L  L   L G         HI   G+I  I   ++ L  +K          K+     +  + + K+   ++  P+     KG E++ ++ I  +K  I   I                    + V IR   + ++ KW  A +L SK       S ++ E Q +   + M+ P         N     +N  D +     K FK+K+++Q+++    +   ++  EAK+ +IK W  L   G  Y  V    N + +++GI ++R++  D+  G        + + +W  NWE+   L+ F E   ++ FK+ + +C+I HE++GGY+F+ MR+S+K   L++ +F  LTG
Sbjct:   10 GSWELQILVTDMQVERTLRVKGDLHIGGVMLKLVESLEFAVDWSDHALWWPEENMWLSRTRSTLDQYGVSAEARLHFTPMHKNLKLQLPDLQIMDVRADFSVKIFASVIQICKEMGIRHPEEVSL-WRKVDRDELRNRNNVQKRRRQPDSPSGTLSPGGGGTSPYLTINSNHSGDSGQGG---LFPRTPQGTLLRPGGSTPGSPFTPHTPASPYSYNGTLSPGSMSSLSFEGSLETS-LINSPQTPSREAFNH--LYRPKSYADKAKMNAWWLDSSRSLMEQNIRENDTVLLK--FKFYSFYDLNPKYDAVRINQIYEQGKWALISEEIDCTEEEMMMFAALQLQVSLRANTDQPDGDQSNSTNEEGDDIDAALTDLQVSLEGS--------HITSPGDITRIPELQDYLKFFKPKKLTFKSFKKYWFAFRDTHLVMHKSKETTNGQPLMRVNLKGCEVQPDINITSQKYGIKLFIP--------------GPDGMQEVWIRCETEDQYAKWMAAFKLASKGKTMAD-STYETEVQSIQAFLSMQRP---APAPAVNPNQLDINPEDYVAPRFFKKFKTKQLVQRIVDSHANVRDMTLTEAKLNFIKAWQALPEFGITYFLVKFRNNRKEELVGIAHNRIMKMDLSNGDCLKTWRYSTMKAWNVNWEVREVLVQFEEE--EVAFKSPYADCKIIHEFIGGYIFLSMRSSDKNQTLDQEMFFKLTG 697          
BLAST of PH domain-containing protein vs. TrEMBL
Match: A0A0B6ZPD6 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF73979 PE=4 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 2.027e-66
Identity = 197/724 (27.21%), Postives = 339/724 (46.82%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTL--TSGLNTTGHRKRFT--KPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNET--DLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHI---NKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSC-NEDEMEHI-EIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIP------IKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMK----SPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKN-SWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 2244
             S+ ++I + +L     +RV     I  V   L+  + +  DWS+   + P    WL    + + Q+ +Q  +K+ F      L +QLPDLQ+ +L +DFS   F      CK+ G+RH EELS     L+K D +      + + +   + +   +   + + TL  + G    G    +    P+  + N+       SP+NL + +S +S F+      +   LS+  S E+S L NSP     EA   Q +   K + ++A     W+ S  +LMEQ + +  N  + L++K+ N+Y  N KYD IRINQI+ QS W++IS E DC+ +E  + A +   I   + L   D +  + N   +  D EID+ L  L   L G    +  ++ HI E+   ++  K  +  L  YK++ A   +  I+  ++   S   P      +KG E + +V +  +K  I   +                 +    + +RF  ++ + +W  A +L SK       S+++ E Q +   + M+    SP  N   L T      +   D + S   +  K+K ++ K++    +   +S +EAK+AYIK W +L   G  Y  + ++ + + +++GI  +R+I  D+ +G        N L SW  NWE+ N +L F     K+ F +    C+  HE++GGY+F+ MR+++K   LNE +F  LTG
Sbjct:   12 GSWELNILVTDLQVEKTLRVMGDLHIGGVMVKLVQALDIALDWSDHALYWPERNKWLHRARSTLDQYNVQADAKLQFTPMHKNLKVQLPDLQVLELRVDFSIKCFTAVVQTCKELGVRHPEELSF----LRKWDKDDLKKVAKEVHKRKKRGDPDANGPLSSNGTLHNSQGSLDGGKLSPYPNRSPVGPSPNNTLIRSANSPYNLSTSISGYSTFNGTVSPGSMHSLSFEGSMESS-LANSPPVPAKEAF--QYLYRPKNFAEKARINCAWLDSSTSLMEQGIRE--NDFIMLKFKFFNFYDINPKYDAIRINQIYEQSKWALISEEIDCTEEEMMVFAALQFQIQLQSGLPQPDLDI-SMNAHNHSEDDEIDAALKDLQESLEGSVVTSHGDITHIPELGDYVKFFKPKKLTLKSYKRYYATFKDTFISFYRSKEESQGTPALPRIDVKGCEAQPDVNLSTRKYGIKLFVPE--------------PEGMCEIFLRFEMEEHYCRWMAACKLASKGKTMAD-SSYEAEVQALQTFLGMQHPVVSPTNNSAPLSTTINQADIQSEDYVASKFFRKIKAKSLVGKIMEAHSNVQDMSLLEAKLAYIKAWQSLAEYGITYFRIKMSNSKKEELMGIASNRIIRMDLNSGDSLKTWRYNTLQSWHVNWEVENVILDFDTE--KVTFASMECSCKTIHEFIGGYIFLSMRSTDKNQSLNEEMFHKLTG 708          
BLAST of PH domain-containing protein vs. TrEMBL
Match: A0A0L8GYE5 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22025940mg PE=4 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 2.381e-66
Identity = 195/716 (27.23%), Postives = 341/716 (47.63%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWK-ELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKP-IYLTRNSQNDLEEPSPFNLVSPVS--FFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSC--NEDEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIPI-----KGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVT--NIVEMKSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKN-SWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 2244
             S+ ++I + +LN    +RV     I  V   L+  + +  DWS+   W P    WL    + + Q+++Q  +K+ F      L IQLP+L I +L +DFS  VF     ICK+ GIRH EELSL  K E + L  NT +P + +  +     +    S  + +++  S    + H  R  +  ++ +  S + L   SP N  +  +  F      L L+      YE      L N P K   EA     ++  KT+ ++A     W+ S ++LMEQ + + +  LL LR+K+  +Y  + KYD +RINQI+ Q+ W++IS E DC+ +E  + AG+   + +L + +   E  + +    + +IDS L  L   L G +   + D     E+   I++ K  +  L  +K++  V     I++ K+    +  PI     KG E   +V +  +K  I                   T +    + +RF  ++ +  W  A RL SK      +++  YE ++ T    + M+ P  +  ++ ++  V  +N+ D +     +  K+ + L+++     +  ++S  E+K+AYIK W  L   G  Y  + +N   + ++IG+  +R+I  D+++G        N L +W  NWE    +L F E    I F + + +C++ HE++GGY+F+ MR+S+K   L+E +F  LTG
Sbjct:   10 GSWQLNINVTDLNVDIALRVKGDLHIGGVMLQLVEALDIALDWSDHGIWWPARNRWLNRTRSTLDQYEVQADAKLEFTPMHKPLQIQLPNLSIIELPVDFSCNVFGAVIQICKKCGIRHPEELSLMRKLEKEDLKKNTLIPVQHKRHRQKQPMSPYVDSPNSHNNSSNSLDFYSPHSNRSPQSTLHHSPGSVHSLSSNSPQNTFNANNSYFAGSMHSLHLD----GGYEQI----LLNGPHKPTKEAFNL--LLRPKTFAEKARMNKGWLDSSISLMEQGIRERH--LLLLRFKFFTFYDLSPKYDSVRINQIYEQAKWALISEEIDCTEEEMVMFAGLQLQV-QLESQNPQPEIFDQTDGQEEDDIDSALKELKESLEGTTAPSSNDITNVPELDAFIKIFKPKKFTLKNFKRYYCVFREYTISLYKSKEDRAGEPIARISTKGCEASPDVNLSSQKFGIKLFEP--------------TKEGMSEIWLRFDTKELYCDWMAACRLASKG---KTMADSTYESEVTTLKTFLSMQEPAADDSIVSSSGSVPDINVEDFVAPRFVRKLKAGQFLKRIKEAHSNVKNMSLTESKMAYIKAWQALPEYGITYFIIKMNNMKKEELIGVANNRIIRMDLQSGDSVKTWRYNTLQTWTVNWETRQVILKFEEE--NIIFDSPAADCKVVHEFIGGYIFLSMRSSDKNQTLDEALFHKLTG 693          
BLAST of PH domain-containing protein vs. TrEMBL
Match: C3ZKQ8 (PH domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_285279 PE=4 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 4.350e-64
Identity = 192/727 (26.41%), Postives = 331/727 (45.53%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTG-HRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNE-----TDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHIN---KLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNE---DEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIPI-----KGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLV-------DIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKN-SWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 2244
             S+ +++ + +L     +RVD   +I  V   L+  + +  DWS+  FW P   +WLL     + +  +Q  ++++F      L +QLPDLQ+  L +DFS   F     +C   GIRH EELS     +KK+D  T                            L  G       +K+  K   LT  +      PS +N    V  ++    +S +       D  Y +    S L+ SP K  SEA+    +   K Y DRA     W+ S  +LMEQ + + N+++L LR+KY++++  N KYD +RINQI+ Q+ WS+++   +C+ +E  + A +   +N    +   D N+       ND   +ID+ L  L   L G + N    D  +  E+A  +   K  +  L  YK++     +  +    +   +S  PI     +G E+  +V I  +K  I  +I               +++    V IR  ++ ++ +W  A RL +K       + ++ E Q +TN + ++ P+         + V SVN+        D +   H K FK+K +  ++L    + ++L+ +EAK+ YI+ W  L   G  +  V    N +  ++G+ ++R++  D+ TG        N +  W  NWE+   L+ F +   +++F   S +C+I HE++GGY+F  MR+ ++   LNE +F  LTG
Sbjct:   10 GSWELNVLVTDLKAERKLRVDGDMSIGNVMIKLVESLDVAMDWSDHGFWWPQRNMWLLRTHWTLDKCGVQADAQLHFTPTHKNLRVQLPDLQLVDLKVDFSYMAFNAIMNVCAMLGIRHPEELSF----MKKVDERT----------------------------LKRGEKRGSFKKKKGEKSGPLTPGTPLTPGTPSGYNTYPRVPSYNGTSPVSSSYSLSSFPDSPYSDGSNISALSISPAKPSSEAVAT--LHRPKNYVDRARLNSLWLNSSRSLMEQGIRE-NDIIL-LRFKYYSFFDLNPKYDAVRINQIYEQAKWSLLTEGIECTEEEAMMFAALQLQVNLQSAMPQPDMNNA------NDSTDDIDAALTDLQVSLEGSAKNSAAGDITQIPELADWLRFFKPKKFTLKSYKRYWFTFKDTHLAYYHSPEEASGAPIMRVNLRGCEVTPDVNISSEKYCIKLLIP--------------STEGMNEVWIRADSETQYARWMAACRLAAKGKTMAD-ATYESEVQSITNFLGLQHPK---------EPVPSVNVSNINIEPQDFVSQRHVKKFKAKSLTARILEAHANVANLALMEAKLNYIRAWQALPEFGITHFVVRFRGNKKEDLLGVAFNRIMRMDLHTGDALKTWRYNSMKHWNVNWEVKEVLVQFEDE--QVSFACLSADCKIVHEFIGGYIFNSMRSKDQNQTLNEELFHKLTG 668          
BLAST of PH domain-containing protein vs. Ensembl Cavefish
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:553051])

HSP 1 Score: 170.629 bits (431), Expect = 2.203e-44
Identity = 174/718 (24.23%), Postives = 323/718 (44.99%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYK-----DRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDL-IGKSCNE--DEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIP-----IKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMK----SPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLT 2241
             ++ + + + +LN   ++RV     I  V   L+ K+ +K DWS+   W   +K WLL     + ++ +Q  +++ F  +  +L +QLP+++  ++ ++FS  VF+    ICK                                                   T  S  ++ G   +   P Y +R+        SP   +SP S +  F D  L+E + S                + S+ +   DI++ K YK     D+A     W+ S  +LMEQ V + N VLL LR+KYH+++  N KYD IR+NQ++ Q+ W+++  E +C+ +E  + A + +HINKLS   +++   N S  ++D E+D+ L  L   L  GK+ N   D     E+A  +++ K  +  L   K++     +  I+  K+   +  IP     ++G E+  +V I  +K  I  +I                +     + +R   ++++ +W  A RL SK       S++  E Q + + ++M+     PQ  ++ + T+     +N   ++   + K +K+K+I  ++L   ++ + +S IEAK+ +I+ W +L   G  +       +   ++IGI Y+RLI  D  T         + +  W  NWE+    + F++           +C++ HE++GGY+F+  R  ++   L+E +F  LT
Sbjct:   16 GTWELKMHVTDLNKDVSLRVTGEIHIGGVMLKLVEKLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKLLRLQLPNMKHMKVKVNFSDRVFKAVSDICK---------------------------------------------------TFRSIYSSPGLYSKTMTPTYDSRDG-------SP---LSPTSAW--FGDSPLSEGNPSIL--------------AVSQPISSPDILV-KLYKPPSLLDKAKINQGWLDSSRSLMEQDVKE-NEVLL-LRFKYHSFFDLNPKYDAIRVNQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMSSDNHMNN-SEKEVD-EVDAALSDLEITLEGGKTSNALGDITSIPELADYVKVFKPKKLTLKGPKQYWCTFKDITISCYKSREEAHGIPAHQMNLRGCEVTPDVNISGQKFNIKLLIP--------------VADGMNEIWLRCDTERQYAQWMAACRLASKGKTMAD-SSYNLEVQNILSFLKMQHMNPDPQI-IEPITTD-----INPECLVSPRYLKKYKNKQISARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLAKFQGSKREELIGITYNRLIRIDASTRDAIKTWRFSNMKQWNVNWEIKMVTVEFADEPSLSFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 630          
BLAST of PH domain-containing protein vs. Ensembl Cavefish
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:553051])

HSP 1 Score: 164.081 bits (414), Expect = 3.901e-42
Identity = 172/725 (23.72%), Postives = 321/725 (44.28%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYK-----DRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDL-IGKSCNE--DEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIP-----IKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMK----SPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKE-------ILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLT 2241
             ++ + + + +LN   ++RV     I  V   L+ K+ +K DWS+   W   +K WLL     + ++ +Q  +++ F  +  +L +QLP+++  ++ ++FS  VF+    ICK                                                   T  S  ++ G   +   P Y +R+        SP   +SP S +  F D  L+E + S                + S+ +   DI++ K YK     D+A     W+ S  +LMEQ V + N VLL LR+KYH+++  N KYD IR+NQ++ Q+ W+++  E +C+ +E  + A + +HINKLS   +++   N S  ++D E+D+ L  L   L  GK+ N   D     E+A  +++ K  +  L   K++     +  I+  K+   +  IP     ++G E+  +V                + Q    +L    +     + +R   ++++ +W  A RL SK       S++  E Q + + ++M+     PQ  ++ + T+     +N   ++   + K +K+K+       I  ++L   ++ + +S IEAK+ +I+ W +L   G  +       +   ++IGI Y+RLI  D  T         + +  W  NWE+    + F++           +C++ HE++GGY+F+  R  ++   L+E +F  LT
Sbjct:   16 GTWELKMHVTDLNKDVSLRVTGEIHIGGVMLKLVEKLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKLLRLQLPNMKHMKVKVNFSDRVFKAVSDICK---------------------------------------------------TFRSIYSSPGLYSKTMTPTYDSRDG-------SP---LSPTSAW--FGDSPLSEGNPSIL--------------AVSQPISSPDILV-KLYKPPSLLDKAKINQGWLDSSRSLMEQDVKE-NEVLL-LRFKYHSFFDLNPKYDAIRVNQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMSSDNHMNN-SEKEVD-EVDAALSDLEITLEGGKTSNALGDITSIPELADYVKVFKPKKLTLKGPKQYWCTFKDITISCYKSREEAHGIPAHQMNLRGCEVTPDV--------------NISGQKFNIKLLIPVADGMNEIWLRCDTERQYAQWMAACRLASKGKTMA-DSSYNLEVQNILSFLKMQHMNPDPQI-IEPITTD-----INPECLVSPRYLKKYKNKQPGYIRDLISARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLAKFQGSKREELIGITYNRLIRIDASTRDAIKTWRFSNMKQWNVNWEIKMVTVEFADEPSLSFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 637          
BLAST of PH domain-containing protein vs. Ensembl Cavefish
Match: fermt3a (fermitin family homolog 3 [Source:NCBI gene;Acc:103039629])

HSP 1 Score: 161.77 bits (408), Expect = 2.794e-41
Identity = 117/455 (25.71%), Postives = 221/455 (48.57%), Query Frame = 1
Query:  907 DRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNEDEMEHI---EIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIPI-----KGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKN-SWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 2244
            D+A     W+ S  +L++Q V + + ++LR  +KY++++    ++D +R+ Q++ Q+ W+++  E DC+ +E  L A + +HI K+ST  T    A+    D   ++DS L  L   +  ++  E+ +E +   E+   ++L +  +  L  YK+      +  I+  K+   S K PI     KG E+  +V +  +K  I  +I                 +    V +R  N+Q++ KW  A RL SK       S +  E Q + + + M+      K ++++   +S+N   ++   + K +K K++  ++L   ++ + LS  EA + +++ W  L + G  Y  V      + +++GI  +RLI  D+    V      N +  W  NW++    + F+     I F   + +C+I HEY+GGY+F+  R+ E+   LNE +F  LTG
Sbjct:  208 DKAQVNGRWLDSSRSLLQQGVKEGDKLILR--FKYYSFHDLAPQFDAVRLTQLYEQAKWAILLEEIDCTEEEMMLFAALQYHIGKVST--TEQLVASCPAMD---DLDSALQCLEVKMEAETSAEEMLETMTAPELHDYLKLFRPKKQTLKKYKQFWFTFKDTSISYYKSKEESCKEPIQQMNLKGCEVAPDVSVAAQKFCIRLLIPE--------------PEGMNEVYLRCDNEQQYSKWMAASRLASKGKTLADAS-YSSEVQSIQSFLAMQKTTPGNKTVQSD---ESINTHSLVSPRYQKKYKPKQLTPRILEAHQNVAQLSLTEAILKFLQIWQALPDFGLSYFVVRFKGCRKDEVLGIANNRLIRIDLSVEDVVKTWRYNTMRQWNVNWDIKQVAIEFNGNV-NIAFSCVTADCKIVHEYIGGYIFMSTRSREQNDTLNEELFHKLTG 636          

HSP 2 Score: 55.8398 bits (133), Expect = 1.461e-7
Identity = 37/124 (29.84%), Postives = 60/124 (48.39%), Query Frame = 1
Query:  151 ISIFIKELNTTH---NIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSL 513
            +S+ ++EL        I V     I  V   ++ K  +K DWS+   W   ++ WLL  +  + +  +   +++    +   L + LP+L   +L + FS  VF+T   ICK   IRH EELSL
Sbjct:    6 LSVNVEELGEEAPPLKISVTSDLHIGGVILKIVEKTEIKKDWSDHALWWEQKQQWLLKPAWTLDKCGIHADARLYLTPQHKPLRLVLPNLLTLRLRVCFSSPVFRTVIGICKLLNIRHPEELSL 129          
BLAST of PH domain-containing protein vs. Ensembl Cavefish
Match: fermt1 (fermitin family member 1 [Source:NCBI gene;Acc:103022983])

HSP 1 Score: 160.229 bits (404), Expect = 9.673e-41
Identity = 119/446 (26.68%), Postives = 222/446 (49.78%), Query Frame = 1
Query:  931 WMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCN---EDEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIPI-----KGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 2244
            W+ S  +LMEQ + + + +LLR  +KYH ++  N KYD +RI Q++ Q+ W+++  E +C+ +E  + A + +HI KL+ +    + ++    D+D E+++ L  L   L G++ +   ED  +  ++   ++L + P+ +L  +K +  V  +  I+  K    +S  PI     +G E+  +V + +KK  I  ++                +     V IR  N+ ++ KW  A  L SK       S++  E + + + ++MKS         ++ E   +N    +   + K +K+K++  ++L    + S LS +EAK+ +I+ W +L   G  Y  V      + +I+GI Y+RLI  D  T +       + +  W  NWE+    + F +  W      S +C++ HEY+GGY+F+  R+ ++   L+E +FR LTG
Sbjct:  235 WLDSSSSLMEQGIQENDKLLLR--FKYHCFFDLNPKYDAVRITQLYEQARWAILLEEIECTEEEMLMFASLQYHICKLTMSTKPVDYSD--EPDID-EVEAALSHLETTLEGRNTDKILEDITDIPKLEDTLKLYR-PKRLLRTFKDYWFVFKDTSISYYKNKESASGEPIEQLHLRGCEVVPDVNVTEKKFGIKLLLP--------------VADGMNEVYIRCDNETQYAKWKAACILASKGKTMAY-SSYGSEVRNIQSFLQMKSLAPPPGQAASDVESMEMNPECFVSPRYGKKYKNKQLSTRILDAHHNISQLSLMEAKMRFIQAWQSLPEFGIKYYIVRFRGCKKDEILGISYNRLIRIDTSTRLPVTTWRFSNMKQWNVNWEIRQVSIEFDQNVWVAFSCQSCDCRVVHEYIGGYIFLSTRSKDQNETLDEELFRKLTG 659          

HSP 2 Score: 58.151 bits (139), Expect = 2.741e-8
Identity = 31/100 (31.00%), Postives = 51/100 (51.00%), Query Frame = 1
Query:  214 ISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSL 513
            I  +   L+ KI    +WS+   W   +  WLL     + ++ +Q  + + F  +   L +QLP+++  +L + FS  VF+  + ICK   IR  EELSL
Sbjct:   38 IGGLMLKLVEKIKTPQNWSDHALWWEKKNCWLLKNHWTLDKYGVQADADLRFTPQHKPLLLQLPNMKTIKLTISFSSVVFKAVEEICKALNIRRSEELSL 137          
BLAST of PH domain-containing protein vs. Ensembl Cavefish
Match: fermt3a (fermitin family homolog 3 [Source:NCBI gene;Acc:103039629])

HSP 1 Score: 159.458 bits (402), Expect = 1.837e-40
Identity = 117/452 (25.88%), Postives = 217/452 (48.01%), Query Frame = 1
Query:  907 DRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNEDEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIPI-----KGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKN-SWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 2244
            D+A     W+ S  +L++Q V + + ++LR  +KY++++    ++D +R+ Q++ Q+ W+++  E DC+ +E  L A + +HI K+ST  T    A+    D   ++DS L  L   +  ++  E   E + +  N  L +  +  L  YK+      +  I+  K+   S K PI     KG E+  +V +  +K  I  +I                 +    V +R  N+Q++ KW  A RL SK       S +  E Q + + + M+      K ++++   +S+N   ++   + K +K K++  ++L   ++ + LS  EA + +++ W  L + G  Y  V      + +++GI  +RLI  D+    V      N +  W  NW++    + F+     I F   + +C+I HEY+GGY+F+  R+ E+   LNE +F  LTG
Sbjct:  220 DKAQVNGRWLDSSRSLLQQGVKEGDKLILR--FKYYSFHDLAPQFDAVRLTQLYEQAKWAILLEEIDCTEEEMMLFAALQYHIGKVST--TEQLVASCPAMD---DLDSALQCLEVKMEAETSAE---EMLSVKPNSYLHRPKKQTLKKYKQFWFTFKDTSISYYKSKEESCKEPIQQMNLKGCEVAPDVSVAAQKFCIRLLIPE--------------PEGMNEVYLRCDNEQQYSKWMAASRLASKGKTLADAS-YSSEVQSIQSFLAMQKTTPGNKTVQSD---ESINTHSLVSPRYQKKYKPKQLTPRILEAHQNVAQLSLTEAILKFLQIWQALPDFGLSYFVVRFKGCRKDEVLGIANNRLIRIDLSVEDVVKTWRYNTMRQWNVNWDIKQVAIEFNGNV-NIAFSCVTADCKIVHEYIGGYIFMSTRSREQNDTLNEELFHKLTG 642          

HSP 2 Score: 55.8398 bits (133), Expect = 1.359e-7
Identity = 37/124 (29.84%), Postives = 60/124 (48.39%), Query Frame = 1
Query:  151 ISIFIKELNTTH---NIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSL 513
            +S+ ++EL        I V     I  V   ++ K  +K DWS+   W   ++ WLL  +  + +  +   +++    +   L + LP+L   +L + FS  VF+T   ICK   IRH EELSL
Sbjct:   18 LSVNVEELGEEAPPLKISVTSDLHIGGVILKIVEKTEIKKDWSDHALWWEQKQQWLLKPAWTLDKCGIHADARLYLTPQHKPLRLVLPNLLTLRLRVCFSSPVFRTVIGICKLLNIRHPEELSL 141          
BLAST of PH domain-containing protein vs. Ensembl Sea Lamprey
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:553051])

HSP 1 Score: 222.631 bits (566), Expect = 6.836e-63
Identity = 175/709 (24.68%), Postives = 337/709 (47.53%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIG---KSCNEDEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVS---SKIPIKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNS-WECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 2244
             ++ + I + +L     +RV     I  V   L+ ++ +K DWS+   W   +  WLL     + ++ +Q  + ++F  +  ++ +QLP ++  ++ ++FS  VF+    ICK F IRH EELSL     K  DS+     +     +  +    +       ++     ++ G   +   P Y  R+        SP   +SP + +  F D  L E + S   +     L N+  +  +   + Q ++      D+A     W+ S  +LMEQ + D  N +L LR+KY++++  N KYD IRINQ++ Q+ W+++  + +C+ +E  + A + +HINKLS        AN S  ++D E+D+ L  L   L G    S   D M+  E++  +++ +  +  L  YK++  V  +  I+  +  +      +I ++G E+  +V I  +K  I  ++                ++    V +R  +++++ +W  A RL SK       S++  E   +   ++M++     + + + + V  +N    +   + K +K+K++  ++L   ++ SH+S +EAK+ +I+ W +L   G  +  V      + +++GI Y+RLI  D+ TG        + +  W  NWE+    + F +   +I F  S  +C++ HE++GGY+F+  R  ++   L+E +F  LTG
Sbjct:   15 GTWELRILVTDLQQEVMMRVTGELHIGGVMLRLVERLEMKKDWSDHALWWERKTTWLLKTHWTLDKYGIQADATLHFTPQHKLMRLQLPSMKYVRVKVNFSDLVFKAVVDICKTFNIRHPEELSLI---RKPQDSSKKKKKKGGEENNHEEVTELEGPLITPTASPGGPFSSPGWYSKTMTPTYDARDG-------SP---LSPTTAW--FGDSPLAEGNPSALAA----ALPNTSPEVLARMYRPQTLL------DKARINGGWLDSSRSLMEQGIKD--NDILMLRFKYYSFFDLNPKYDAIRINQLYEQAKWAILLEDIECTEEEMMMFAALQYHINKLSL--MTEGHANHSEQEVD-EVDAALSDLEIALEGGRSSSGLRDIMKIPELSDYLKMFRPKKLTLKGYKQYWFVFKDTAISYYRNKDDPRPVQQITLRGCEVIPDVNIAAQKFNIKLLVP--------------VTEGMTEVWLRCESEKQYAEWMAACRLASKGKTMAD-SSYAGEVNSILTFLKMQNVSLEPQSI-SPQNVPDINPESFVCPRYMKKYKAKQLTARILEAHQNVSHMSLVEAKMRFIQAWQSLPEFGITHFVVRFRGAKKEEMMGIAYNRLIRMDLSTGDAIKTYRFSNMKQWNVNWEVRQVAVEFDDEM-QIAFHCSDADCKVVHEFIGGYIFLSTRAKDQNEALDEELFHKLTG 676          
BLAST of PH domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002438.1 (pep scaffold:Pmarinus_7.0:GL480979:127958:159017:1 gene:ENSPMAG00000002171.1 transcript:ENSPMAT00000002438.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 196.438 bits (498), Expect = 1.197e-53
Identity = 173/713 (24.26%), Postives = 320/713 (44.88%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHL--KYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLH--FDLIGKSCNEDEMEHI-EIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIPI-----KGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKN-SWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 2244
             S+ +S+ I +L     +R+     I  +   ++       + DWS+   W    KLWLL     + ++ +Q  + + F  +  +L +QLP  +  ++ + FS  VF+    IC+   IRH EELSL    L+K +  T         +    +                G  T G   +   P+Y T++        +P       S    F +  L +  LS   + E +     P    +   +Q+ +       D+A     W+ S  +LMEQ V + ++++LR  YKY  ++  N KYD IRINQ++ Q+ W ++  + DC+ +E  + A + +HI+KLS +    +    S  D+D  +DS L  L    ++   S    ++  I ++   I++ K  R  L  YK +  V  +  I   K    S+ +P+     KG E+  +V I  ++  I  +I                 +    + +R  N++++ +W  A RL SK       S++  E   + + + MK    ++++   +     +     +   + K  K+K++  +++   ++ ++L+ +EAK+ +I+ W +L + G  +  V    + +   +GI Y+R+I  D+ TG        N +  W  NWE+   ++ F E   KI F   S +C++ HEY+GGY+F+  R+ E+  +L+E +F  LTG
Sbjct:   19 GSWELSVNITDLERPVTVRLKGDLHIGGLILRIVQAAGADEQRDWSDHALWWEHRKLWLLKHPWTLDKYGVQANAVLVFTPQHKLLRLQLPSSKRVRVTVSFSDPVFRAVADICRTCNIRHPEELSL----LRKPEDPT--------KKKKKDKETTDDLLEPLIQASGKGAGTQGLYSKTMTPMYDTKDG-------TPL-----ASTAQWFGNDGLTDGGLSVLATSEAA-----PADVLARRYRQESLA------DKARINGGWLDSSRSLMEQGVKEKDSLMLR--YKYFCFFDINPKYDAIRINQLYEQARWGILLEKVDCTEEEMMMFAALQYHISKLSASPEIRKVE--SEPDVDA-VDSALSDLEVALEVNNPSVPLGDLTSIPQLNDYIKVFKPKRLTLKGYKLYWCVFKDTCITCYKNKEDSTGVPLQTMNLKGCEVAPDVNISGQRFNIKLMIP--------------VPEGMNEIWLRCDNEEQYGRWMAACRLASKGKTMAD-SSYHGEVDSILSFLRMKQISPDVQISSQSISAADMTPECFVSPRYAKKIKTKQLAARIMEAHQNVANLALVEAKMKFIQAW-SLPDFGIAHFVVRFRGSKKDDALGIAYNRIIRQDVNTGEPIKTWRFNNMKQWNVNWEVKQVIIEFDEEV-KIGFNCISADCKVVHEYIGGYIFMSTRSKEQDDNLDEELFHKLTG 674          
BLAST of PH domain-containing protein vs. Ensembl Nematostella
Match: EDO36565 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIB3])

HSP 1 Score: 173.711 bits (439), Expect = 8.570e-46
Identity = 173/712 (24.30%), Postives = 309/712 (43.40%), Query Frame = 1
Query:  151 ISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRNSQNDLEEPSP-FNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNEDEMEHIEIAGNI-ELIKYPRNILSLYKKH-SAVLSNEGINIIKTTNVSSKIPI-----KGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHV--NQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNET----IFRSLTG 2244
            +S+FI  L+T   + V     I K+  DL+  + +  DWS+   W P  + WLL     +    +Q  +K++F      + +QLPDLQ  +L +DFSK VF   Q +C + GIRH EELSL  K   KL  +                               +  +  G +KR +     +  S       SP ++   P   FS  ++ +LN+                SP     EAL    +   K+ +++A     W+ S  +LMEQ V +++ +   LRYKY+ ++  N K DEIRINQ++ Q+ WS+++ E +C+ +E    A I   +  LS     S  +N+ P D D +ID+ L  L   L G S +      +     + E++ Y   + +   KH  +  S+  + + K+   +   P+     +G E+  +V +   K  I   +                 +  E +++    + ++ KW  A R+ SK      +S ++ E   +   + M+  + +   L   +    +   D +G    K +K K+I  ++L    +    S +E+K+ YI+ W +L   G  +  V    ++  + +I+GI ++R++  D  T         + + +W  NWE    ++   +     N  ++ + +  HE++GGY+F+ MR      D+N+     +F  LTG
Sbjct:   12 LSVFITSLSTEKPVEVTGQTHIGKLMLDLVEGLDISADWSDHGLWWPQRRQWLLKPRITLDTCGVQGDAKLHFTPIHKKVRVQLPDLQFVELSMDFSKKVFVAVQELCAELGIRHPEELSLM-KPNNKLKKD-------------------------------ARRSMKGKKKRHSG----SGISPGSASPGSPAYSNFGPEGPFSTLENTNLNQ----------------SPLTPSQEALNT--LCKPKSIQEKAYLNSGWLDSSRSLMEQEVQEFDTIY--LRYKYYTFFDLNPKVDEIRINQLYEQAKWSILTEEVECTEEEMMSFAAIQFQVKILSA----SPQSNI-PED-DDDIDAALSDLQLTLEGSSHSTTSPAKVNSLNTVPEIMDYLNLVNNCDVKHFLSADSDTTLTVYKSQEEAFGQPVQRMNLRGCEVTTDVNVSKDKYQIRMRL-----------------QDNEEIELACSTESQYAKWMAACRMASKGKTMADIS-YESEKAGIQAFLSMQHDKGDGTPLSPGQ--IHIQPEDFVGQRMLKKYKPKQIAARILESHTALHKASLVESKMMYIRQWQSLPEFGVSHFIVRFRSDKPKKEEILGIAFNRIMRIDASTREAIKTWRYSVMRAWNVNWETREMIVQCEDEMIAFNCVSA-DIKAVHEFIGGYIFLSMRK-----DVNQPPSDELFYKLTG 635          
BLAST of PH domain-containing protein vs. Ensembl Medaka
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:101155069])

HSP 1 Score: 198.749 bits (504), Expect = 1.179e-53
Identity = 188/724 (25.97%), Postives = 339/724 (46.82%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSG------LNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYK-----DRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDL-IGKSCNE--DEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIP-----IKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMK----SPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLT 2241
             ++ + + + +L+   ++RV     I  V   L+ K+ +K DWS+   W   +K WLL     + ++ +Q  +++ F  +  VL +QLP+++  ++ ++FS  VF+    ICK F IRH EELSL     K  D            +   +      +  +    +  G       ++ G   +   P Y +R+        SP   +SP S +  F D  L+E + S                + S+ +   DI++ K YK     D+A     WM S  +LMEQ V + N VLL LR+KYH+++  N KYD IR+NQ++ Q+ W+++  E +C+ +E  + A + +HINKLS   T++   N S  ++D E+D+ L  L   L  GK+ N   D     E+A  +++ K  +  L  YK++     +  I+  K+   +   P     ++G E+  +V I  +K  I  +I                +     + +R   ++++  W  A RL SK       S++  E Q + + ++M+     PQF ++ + T+     +N   ++   + K +K+K+I  ++L   ++ + +S IEAK+ +I+ W +L   G  +         + ++IGI Y+RLI  D  TG        + +  W  NWE+    + F++           +C++ HE++GGY+F+  R  ++   L+E +F  LT
Sbjct:   16 GTWELKMHVTDLHRDVSLRVTGEIHIGGVMLKLVEKLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKVLRLQLPNMKHMKVKVNFSDRVFKAVSDICKTFNIRHPEELSLL---RKPRDPKKKKKKLEEAEEDDLELEGPLLTPGSASEIIYIGPVKGSIYSSPGLYSKTMTPTYDSRDG-------SP---LSPTSAW--FGDSPLSEGNPSIL--------------AVSQPISSPDILV-KLYKPQSLLDKAKINQGWMDSSRSLMEQDVKE-NEVLL-LRFKYHSFFDLNPKYDAIRVNQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMSTDNHMNN-SEKEVD-EVDAALSDLEITLEGGKTSNTLGDITSIPELADYVKVFKPKKLTLKGYKQYWCTFKDITISCYKSKEEAHGTPSYQMNLRGCEVTPDVNISGQKFNIKLLIP--------------VADGMNEIWLRCDTEKQYAHWMAACRLASKGKTMAD-SSYNLEVQNILSFLKMQHMNPDPQF-IEPITTD-----INPECLVSPRYLKKYKNKQISARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLAKFQGGKKEELIGITYNRLIRMDAHTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEPSLAFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 684          
BLAST of PH domain-containing protein vs. Ensembl Medaka
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:101155069])

HSP 1 Score: 195.667 bits (496), Expect = 1.075e-52
Identity = 187/725 (25.79%), Postives = 342/725 (47.17%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYK-----DRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDL-IGKSCNE--DEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIP-----IKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMK----SPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKE-------ILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLT 2241
             ++ + + + +L+   ++RV     I  V   L+ K+ +K DWS+   W   +K WLL     + ++ +Q  +++ F  +  VL +QLP+++  ++ ++FS  VF+    ICK F IRH EELSL    L+K       P +++     ++++  +           S  ++ G   +   P Y +R+        SP   +SP S +  F D  L+E + S                + S+ +   DI++ K YK     D+A     WM S  +LMEQ V + N VLL LR+KYH+++  N KYD IR+NQ++ Q+ W+++  E +C+ +E  + A + +HINKLS   T++   N S  ++D E+D+ L  L   L  GK+ N   D     E+A  +++ K  +  L  YK++     +  I+  K+   +   P     ++G E+  +V                + Q    +L    +     + +R   ++++  W  A RL SK       S++  E Q + + ++M+     PQF ++ + T+     +N   ++   + K +K+K+       I  ++L   ++ + +S IEAK+ +I+ W +L   G  +         + ++IGI Y+RLI  D  TG        + +  W  NWE+    + F++           +C++ HE++GGY+F+  R  ++   L+E +F  LT
Sbjct:   16 GTWELKMHVTDLHRDVSLRVTGEIHIGGVMLKLVEKLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKVLRLQLPNMKHMKVKVNFSDRVFKAVSDICKTFNIRHPEELSL----LRKPRD----PKKKKKKLEEAEEDDLELEGPLLTPGSGSIYSSPGLYSKTMTPTYDSRDG-------SP---LSPTSAW--FGDSPLSEGNPSIL--------------AVSQPISSPDILV-KLYKPQSLLDKAKINQGWMDSSRSLMEQDVKE-NEVLL-LRFKYHSFFDLNPKYDAIRVNQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMSTDNHMNN-SEKEVD-EVDAALSDLEITLEGGKTSNTLGDITSIPELADYVKVFKPKKLTLKGYKQYWCTFKDITISCYKSKEEAHGTPSYQMNLRGCEVTPDV--------------NISGQKFNIKLLIPVADGMNEIWLRCDTEKQYAHWMAACRLASKGKTMA-DSSYNLEVQNILSFLKMQHMNPDPQF-IEPITTD-----INPECLVSPRYLKKYKNKQPGYIRDLISARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLAKFQGGKKEELIGITYNRLIRMDAHTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEPSLAFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 680          
BLAST of PH domain-containing protein vs. Ensembl Medaka
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:101155069])

HSP 1 Score: 191.43 bits (485), Expect = 3.726e-51
Identity = 186/731 (25.44%), Postives = 337/731 (46.10%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSG------LNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYK-----DRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDL-IGKSCNE--DEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIP-----IKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMK----SPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKE-------ILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLT 2241
             ++ + + + +L+   ++RV     I  V   L+ K+ +K DWS+   W   +K WLL     + ++ +Q  +++ F  +  VL +QLP+++  ++ ++FS  VF+    ICK F IRH EELSL     K  D            +   +      +  +    +  G       ++ G   +   P Y +R+        SP   +SP S +  F D  L+E + S                + S+ +   DI++ K YK     D+A     WM S  +LMEQ V + N VLL LR+KYH+++  N KYD IR+NQ++ Q+ W+++  E +C+ +E  + A + +HINKLS   T++   N S  ++D E+D+ L  L   L  GK+ N   D     E+A  +++ K  +  L  YK++     +  I+  K+   +   P     ++G E+  +V                + Q    +L    +     + +R   ++++  W  A RL SK       S++  E Q + + ++M+     PQF ++ + T+     +N   ++   + K +K+K+       I  ++L   ++ + +S IEAK+ +I+ W +L   G  +         + ++IGI Y+RLI  D  TG        + +  W  NWE+    + F++           +C++ HE++GGY+F+  R  ++   L+E +F  LT
Sbjct:   16 GTWELKMHVTDLHRDVSLRVTGEIHIGGVMLKLVEKLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKVLRLQLPNMKHMKVKVNFSDRVFKAVSDICKTFNIRHPEELSLL---RKPRDPKKKKKKLEEAEEDDLELEGPLLTPGSASEIIYIGPVKGSIYSSPGLYSKTMTPTYDSRDG-------SP---LSPTSAW--FGDSPLSEGNPSIL--------------AVSQPISSPDILV-KLYKPQSLLDKAKINQGWMDSSRSLMEQDVKE-NEVLL-LRFKYHSFFDLNPKYDAIRVNQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMSTDNHMNN-SEKEVD-EVDAALSDLEITLEGGKTSNTLGDITSIPELADYVKVFKPKKLTLKGYKQYWCTFKDITISCYKSKEEAHGTPSYQMNLRGCEVTPDV--------------NISGQKFNIKLLIPVADGMNEIWLRCDTEKQYAHWMAACRLASKGKTMA-DSSYNLEVQNILSFLKMQHMNPDPQF-IEPITTD-----INPECLVSPRYLKKYKNKQPGYIRDLISARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLAKFQGGKKEELIGITYNRLIRMDAHTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEPSLAFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 691          
BLAST of PH domain-containing protein vs. Ensembl Medaka
Match: fermt1 (fermitin family member 1 [Source:NCBI gene;Acc:101160280])

HSP 1 Score: 174.481 bits (441), Expect = 1.837e-45
Identity = 125/454 (27.53%), Postives = 222/454 (48.90%), Query Frame = 1
Query:  907 DRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCN---EDEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIPI-----KGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 2244
            D+A +   W+ S  +LMEQ V   + +LLR  +KY+ ++  N KYD +RI Q++ Q+ W+++  E DC+ +E  + A + +HI KL+ +    + AN    D   E+++ L  L   L G   +   ED  +  ++A  + L +     L  YK++  V  +  I+  K    SS  PI     +G E+  +V + DKK  I  +I                +     V IR  N+ ++ KW  A  L SK       S++K E + + + ++MKS          + +   +N    +   + K  K+K++  ++L   ++ +HLS ++AK+ +IK W +L   G  Y  V    + + +I+GI Y+RLI  D+ TG+         +  W  NWE+   ++ F ++        S +C++ HE++GGY+F+  R+ ++   L+E +F  LTG
Sbjct:  229 DKATNNAGWLDSSRSLMEQDVQSSDRLLLR--FKYNVFFDLNPKYDAVRITQLYEQARWAILLEEIDCTEEEMLMFASLQYHICKLTMSSEPRDNANEPEVD---EVEAALSNLEVTLEGSHTDKFLEDITDIPQLADTLRLFRPKWLTLRPYKEYWFVFKDTNISYYKNKEASSGEPIEQFHLRGCEVVPDVNVTDKKFGIKLLIP--------------VADGMNEVYIRCDNEMQYAKWKAACILASKGKTMAY-SSYKSEVKNIHSFLQMKSLAPPPGHATPDVDAMEMNAESFVSPRYAKKQKTKQLTTRILEAHQNIAHLSLMDAKMRFIKAWQSLPEFGIKYYIVRFKGSKKDEILGISYNRLIRIDMSTGLPVTTWRFANMKQWNVNWEVRQVMIEFDQSVSIAFCCLSCDCKVVHEFIGGYIFLSTRSKDQNETLDEDLFVKLTG 662          

HSP 2 Score: 61.2326 bits (147), Expect = 3.335e-9
Identity = 33/108 (30.56%), Postives = 55/108 (50.93%), Query Frame = 1
Query:  190 IRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSL 513
            +RV     +  +   L+ KI    DWS+   W    K WLL     + ++ +Q  + + +  +   L +QLP+++  ++ + FS  VF+T   IC+Q  IR  EELSL
Sbjct:   31 LRVAGDLHVGGLMLKLVEKIKAPQDWSDHALWWEQRKCWLLKTHWTLDKYGIQADADLRYTPQHKPLLLQLPNMKTIKINVCFSSMVFKTVSDICRQLNIRRPEELSL 138          
BLAST of PH domain-containing protein vs. Ensembl Medaka
Match: fermt1 (fermitin family member 1 [Source:NCBI gene;Acc:101160280])

HSP 1 Score: 174.481 bits (441), Expect = 1.837e-45
Identity = 125/454 (27.53%), Postives = 222/454 (48.90%), Query Frame = 1
Query:  907 DRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCN---EDEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIPI-----KGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 2244
            D+A +   W+ S  +LMEQ V   + +LLR  +KY+ ++  N KYD +RI Q++ Q+ W+++  E DC+ +E  + A + +HI KL+ +    + AN    D   E+++ L  L   L G   +   ED  +  ++A  + L +     L  YK++  V  +  I+  K    SS  PI     +G E+  +V + DKK  I  +I                +     V IR  N+ ++ KW  A  L SK       S++K E + + + ++MKS          + +   +N    +   + K  K+K++  ++L   ++ +HLS ++AK+ +IK W +L   G  Y  V    + + +I+GI Y+RLI  D+ TG+         +  W  NWE+   ++ F ++        S +C++ HE++GGY+F+  R+ ++   L+E +F  LTG
Sbjct:  229 DKATNNAGWLDSSRSLMEQDVQSSDRLLLR--FKYNVFFDLNPKYDAVRITQLYEQARWAILLEEIDCTEEEMLMFASLQYHICKLTMSSEPRDNANEPEVD---EVEAALSNLEVTLEGSHTDKFLEDITDIPQLADTLRLFRPKWLTLRPYKEYWFVFKDTNISYYKNKEASSGEPIEQFHLRGCEVVPDVNVTDKKFGIKLLIP--------------VADGMNEVYIRCDNEMQYAKWKAACILASKGKTMAY-SSYKSEVKNIHSFLQMKSLAPPPGHATPDVDAMEMNAESFVSPRYAKKQKTKQLTTRILEAHQNIAHLSLMDAKMRFIKAWQSLPEFGIKYYIVRFKGSKKDEILGISYNRLIRIDMSTGLPVTTWRFANMKQWNVNWEVRQVMIEFDQSVSIAFCCLSCDCKVVHEFIGGYIFLSTRSKDQNETLDEDLFVKLTG 662          

HSP 2 Score: 61.2326 bits (147), Expect = 3.335e-9
Identity = 33/108 (30.56%), Postives = 55/108 (50.93%), Query Frame = 1
Query:  190 IRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSL 513
            +RV     +  +   L+ KI    DWS+   W    K WLL     + ++ +Q  + + +  +   L +QLP+++  ++ + FS  VF+T   IC+Q  IR  EELSL
Sbjct:   31 LRVAGDLHVGGLMLKLVEKIKAPQDWSDHALWWEQRKCWLLKTHWTLDKYGIQADADLRYTPQHKPLLLQLPNMKTIKINVCFSSMVFKTVSDICRQLNIRRPEELSL 138          
BLAST of PH domain-containing protein vs. Planmine SMEST
Match: SMESG000025860.1 (SMESG000025860.1)

HSP 1 Score: 1338.55 bits (3463), Expect = 0.000e+0
Identity = 716/717 (99.86%), Postives = 717/717 (100.00%), Query Frame = 1
Query:  106 MSIDSLKSNRISSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNEDEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIPIKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTGRNAD 2256
            MSIDSLKSNRISSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPNRRRISQSVSQQNVRQSSNRNRDSTLTSGLNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWS+ISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNEDEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIPIKGNEIRLNVKIRDKKIFIIEIILLKNNQNNKNELNNKTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTGRNAD
Sbjct:    1 MSIDSLKSNRISSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPNRRRISQSVSQQNVRQSSNRNRDSTLTSGLNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKSFSEALKQQDIVIYKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSVISGETDCSADETYLLAGILHHINKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNEDEMEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIPIKGNEIRLNVKIRDKKIFIIEIILLKNNQNNKNELNNKTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTGRNAD 717          
BLAST of PH domain-containing protein vs. Planmine SMEST
Match: SMESG000020711.1 (SMESG000020711.1)

HSP 1 Score: 191.43 bits (485), Expect = 2.960e-51
Identity = 186/737 (25.24%), Postives = 325/737 (44.10%), Query Frame = 1
Query:  139 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKK-LDSNTPVPXXXXXXXXXXXXXXXXXXXXXXXXTLTSGLNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSI----FDDLSLNETDLSYYESFENSKLTNSPKKS---------FSEALKQQDIVIYKT----------YKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHI---NKLSTNDTN---SETANLSPNDL-DKEIDSMLDRLHFDLIGKSCNEDE--MEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIPIKGNEIRLNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQ-KVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKN-SWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 2244
             S+ ++I I ++     +RV     I  V    +  +  K DWS+   W P + +WL      + Q+ +Q  SK+  ++  N L + LP +    + ++FS  +F     ICK+FGIR  EELSLQ   +K+ L SN  +                                T    K F       ++S  +L  P P   +SP S ++     F  L+ N   LS   +F  S  +  P+           FSE +K     +++            K R NS   W+ S  +LMEQ +       L  R+K+H +Y  N KYD +RI+Q+F Q+ W +IS   D + DE  +   +        ++ST D N     T N+  N++ + E+D M+  L    +G     D   ++   + G++ + +  +  +   K+   VL  + +N   + +  ++ PI  NEI ++             +  + N +        T+ + E  K +F N+ ++  W  ALRL+++    T    F+ E + +  ++ +++P     + K +      +L D +     K  KSK+ L+ ++     +   LS ++AK  YI+ W  L N G  Y+ V  +  ++ +IIGI ++R+++ +  +G V      + + SW  NW+    +L F  T  K+ FK  S  C+   E++GGY+F+  RN +K  +LN  +F  LTG
Sbjct:   10 GSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTL--------------------------------TMMKSKIFAIQSSENKSSPKELPTPEP---LSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNST--WLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELNQ-PI--NEILVS----------SCQMKAEVNVSANKFFIKITTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFKAT--KLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 694          
BLAST of PH domain-containing protein vs. Planmine SMEST
Match: SMESG000005290.1 (SMESG000005290.1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.967e-7
Identity = 55/220 (25.00%), Postives = 105/220 (47.73%), Query Frame = 1
Query: 1546 TSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEM----KSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSE---LQIIGIGYDRLILADIETGMVTNLV-EMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQ--IFHEYLGGYL 2175
             +K   +++++F+N ++F    ++    S     +L   F  E ++   +VE+      P++N+        +  V LV+++G    K  +S + L+ +L + + F  LS+ ++KI YI+  L      +HY  V +++  E   L ++ +  +  I+ D     +T LV     L SWK N ELN   L F   F  I+F  + +C    FHE++  ++
Sbjct:  463 CNKRLLKIEMKFFNDEDFFSLYSSAVAHSNFWWPSLKQIFDCE-RVARKLVEIFRSSDEPEYNIF------NMPRVELVNLLGCRIGKKEQSGKYLKTILQYNQCFKTLSRRKSKIQYIRFCLNFPRFNYHYFFVKIHEPPEEMGLTVVAVNEEMFIVFDPNYYSITRLVLPWAVLKSWKFNTELNQLDLYFKNLF--ISF-TTQDCSAICFHEFISTFI 672          
The following BLAST results are available for this feature:
BLAST of PH domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FERMT14.513e-5624.96fermitin family member 1 [Source:HGNC Symbol;Acc:H... [more]
FERMT29.515e-5625.59fermitin family member 2 [Source:HGNC Symbol;Acc:H... [more]
FERMT29.515e-5625.59fermitin family member 2 [Source:HGNC Symbol;Acc:H... [more]
FERMT22.532e-5325.35fermitin family member 2 [Source:HGNC Symbol;Acc:H... [more]
FERMT22.532e-5325.35fermitin family member 2 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of PH domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
unc-1123.542e-4623.62pep chromosome:WBcel235:V:14691854:14697107:-1 gen... [more]
unc-1123.542e-4623.62pep chromosome:WBcel235:V:14691857:14696654:-1 gen... [more]
back to top
BLAST of PH domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Fit24.230e-5724.39gene:FBgn0036688 transcript:FBtr0075275[more]
Fit13.884e-4723.90gene:FBgn0035498 transcript:FBtr0073209[more]
Fit13.884e-4723.90gene:FBgn0035498 transcript:FBtr0073210[more]
back to top
BLAST of PH domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fermt11.152e-5825.29fermitin family member 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
fermt11.152e-5825.29fermitin family member 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
fermt21.038e-5225.69fermitin family member 2 [Source:NCBI gene;Acc:553... [more]
fermt21.673e-5125.38fermitin family member 2 [Source:NCBI gene;Acc:553... [more]
fermt22.536e-5025.17fermitin family member 2 [Source:NCBI gene;Acc:553... [more]
back to top
BLAST of PH domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sh3bgrl31.011e-5125.87SH3 domain binding glutamate-rich protein like 3 [... [more]
sh3bgrl31.119e-5125.87SH3 domain binding glutamate-rich protein like 3 [... [more]
sh3bgrl31.454e-5126.12SH3 domain binding glutamate-rich protein like 3 [... [more]
sh3bgrl33.776e-5026.00SH3 domain binding glutamate-rich protein like 3 [... [more]
sh3bgrl35.821e-5026.15SH3 domain binding glutamate-rich protein like 3 [... [more]
back to top
BLAST of PH domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fermt22.855e-5625.74fermitin family member 2 [Source:MGI Symbol;Acc:MG... [more]
Fermt13.579e-4125.96fermitin family member 1 [Source:MGI Symbol;Acc:MG... [more]
Fermt31.971e-4023.90fermitin family member 3 [Source:MGI Symbol;Acc:MG... [more]
Fermt21.926e-1532.00fermitin family member 2 [Source:MGI Symbol;Acc:MG... [more]
Fermt32.123e-1325.53fermitin family member 3 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of PH domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R8M5|FERM1_PONAB6.180e-5824.82Fermitin family homolog 1 OS=Pongo abelii OX=9601 ... [more]
sp|Q8CIB5|FERM2_MOUSE1.997e-5525.74Fermitin family homolog 2 OS=Mus musculus OX=10090... [more]
sp|Q9BQL6|FERM1_HUMAN2.167e-5524.96Fermitin family homolog 1 OS=Homo sapiens OX=9606 ... [more]
sp|Q96AC1|FERM2_HUMAN4.569e-5525.59Fermitin family homolog 2 OS=Homo sapiens OX=9606 ... [more]
sp|F1Q8X5|FERM2_DANRE1.263e-5025.38Fermitin family homolog 2 OS=Danio rerio OX=7955 G... [more]
back to top
BLAST of PH domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JQH78.321e-7127.21Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A1S3J2D11.516e-6726.76fermitin family homolog 2 OS=Lingula unguis OX=757... [more]
A0A0B6ZPD62.027e-6627.21Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A0L8GYE52.381e-6627.23Uncharacterized protein OS=Octopus bimaculoides OX... [more]
C3ZKQ84.350e-6426.41PH domain-containing protein OS=Branchiostoma flor... [more]
back to top
BLAST of PH domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fermt22.203e-4424.23fermitin family member 2 [Source:NCBI gene;Acc:553... [more]
fermt23.901e-4223.72fermitin family member 2 [Source:NCBI gene;Acc:553... [more]
fermt3a2.794e-4125.71fermitin family homolog 3 [Source:NCBI gene;Acc:10... [more]
fermt19.673e-4126.68fermitin family member 1 [Source:NCBI gene;Acc:103... [more]
fermt3a1.837e-4025.88fermitin family homolog 3 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of PH domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fermt26.836e-6324.68fermitin family member 2 [Source:NCBI gene;Acc:553... [more]
ENSPMAT00000002438.11.197e-5324.26pep scaffold:Pmarinus_7.0:GL480979:127958:159017:1... [more]
back to top
BLAST of PH domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PH domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO365658.570e-4624.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PH domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fermt21.179e-5325.97fermitin family member 2 [Source:NCBI gene;Acc:101... [more]
fermt21.075e-5225.79fermitin family member 2 [Source:NCBI gene;Acc:101... [more]
fermt23.726e-5125.44fermitin family member 2 [Source:NCBI gene;Acc:101... [more]
fermt11.837e-4527.53fermitin family member 1 [Source:NCBI gene;Acc:101... [more]
fermt11.837e-4527.53fermitin family member 1 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of PH domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000025860.10.000e+099.86SMESG000025860.1[more]
SMESG000020711.12.960e-5125.24SMESG000020711.1[more]
SMESG000005290.11.967e-725.00SMESG000005290.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001904 ID=SMED30001904|Name=PH domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2388bp
CAGGAAGCATAGAATAAATTTAACAATGCATCAAAATCAATTATACAGTT
CGATGGAATCATTAAATTTGATCTTCCCAGATATCGGATAATTAATGAAG
AAAATATGTCAATAGATTCTTTGAAATCCAACCGAATTAGCTCGTTTGTC
ATATCGATTTTCATCAAAGAATTGAATACAACTCACAATATCCGAGTCGA
TCCAACGGCAACGATTTCTAAAGTCGCAACAGATCTTATCAATAAAATTC
ATTTAAAATACGATTGGTCGGAGTTTTGGTTTTGGAATCCGACAGAAAAA
CTTTGGCTTCTGCCGAAATCCAACATAGTTTCCCAATTCAAACTCCAACC
ATATTCGAAAATCAATTTTGTTCGTCGATTCAACGTATTGAACATCCAAT
TACCGGATTTACAAATCCGCCAATTGCTGTTGGATTTCTCGAAAACGGTT
TTCCAAACCAATCAAATCATTTGCAAACAATTCGGAATCCGACACCATGA
AGAGTTATCATTGCAGTGGAAAGAACTGAAAAAACTCGACAGCAACACTC
CAGTTCCGAATCGTCGTCGAATTTCTCAATCGGTGAGCCAACAAAATGTT
CGGCAATCCTCGAATCGGAATCGCGACTCGACTCTAACAAGTGGCCTCAA
CACTACCGGTCATAGAAAACGTTTCACAAAACCAATATATCTGACAAGAA
ATTCCCAAAACGATCTCGAAGAACCGTCTCCGTTTAATCTCGTTTCTCCG
GTATCGTTTTTTTCCATATTTGATGATCTTTCCCTAAACGAAACCGATTT
ATCGTATTACGAAAGTTTTGAAAACTCAAAATTGACTAATAGTCCGAAAA
AATCGTTTTCCGAAGCACTAAAGCAACAGGACATTGTAATTTATAAAACC
TACAAAGATCGCGCAAACTCGCCTTTTCATTGGATGATTTCCGAGTTGAC
ATTAATGGAGCAAGCAGTTGGTGATTATAACAATGTCCTTTTACGGCTTC
GATACAAATATCACAATTACTATTGGTTCAATGAGAAATACGATGAAATA
CGAATCAATCAAATATTCCACCAATCATATTGGAGTATGATATCGGGAGA
AACCGATTGCTCCGCTGACGAAACATATCTATTAGCTGGAATATTACATC
ACATCAACAAACTCTCAACTAACGATACGAACTCTGAAACCGCAAATCTT
TCTCCCAACGATTTGGATAAAGAAATCGACTCGATGCTAGATCGGTTGCA
TTTCGATCTCATCGGTAAAAGTTGCAATGAGGACGAAATGGAACATATTG
AAATCGCCGGTAATATCGAGTTGATAAAGTATCCAAGAAATATACTGAGT
CTATATAAAAAACATTCCGCTGTCTTGTCTAATGAGGGAATAAATATAAT
AAAAACAACAAATGTTTCGAGTAAAATCCCCATCAAAGGCAACGAAATTC
GTCTCAATGTCAAAATCCGTGATAAAAAGATTTTCATTATTGAAATAATT
CTATTAAAAAACAATCAAAACAACAAAAACGAGCTAAATAATAAAACCAG
CAAATCATTTGAAAGGGTGAAAATTCGATTTTACAATCAGCAAGAATTCA
TTAAGTGGGCAACTGCACTGAGACTGCTATCGAAATCGATCGATTTTACA
CTTTTGTCGAATTTCAAATACGAGTATCAAATGGTGACAAATATTGTCGA
AATGAAATCTCCACAGTTCAATTTGAAAATGCTCAAAACCAACAAAGAAG
TTGACAGTGTCAATCTCGTGGACATTATCGGTTCGATACACAATAAGCCT
TTTAAAAGCAAAGAAATCCTCCAGAAAGTTCTATATTTTGCCAAGTCTTT
TAGTCATCTCTCAAAGATCGAGGCAAAAATTGCTTATATCAAGTGTTGGC
TTACACTCAACAATTCTGGATTCCATTATATGACAGTCCATGTCAATCAG
AATAGTGAGCTACAAATTATCGGTATCGGCTACGATCGGCTGATACTCGC
CGATATCGAGACGGGAATGGTGACAAATTTGGTGGAAATGAATAAACTCA
TCTCATGGAAGACCAATTGGGAGTTGAATAACACGCTGTTGATGTTTAGT
GAAACCTTTTGGAAAATAAATTTCAAGAATTCCTGGGAATGTCAAATTTT
TCACGAATATCTCGGCGGTTATCTGTTTATTTTAATGAGGAATTCCGAGA
AGTTTTCGGATCTAAATGAGACTATTTTTAGAAGTTTAACAGGCAGAAAT
GCAGATTAGGAATATTAAATATTAACTTTTTACATTTTATGACAAATTGA
TCTTTTTTTAAATATTTTACACTCATTATTATCATTTGTTCCAATCCTTA
ATGTATTCACATTATATTTGAATATATTTTTCGATATG
back to top

protein sequence of SMED30001904-orf-1

>SMED30001904-orf-1 ID=SMED30001904-orf-1|Name=SMED30001904-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=718bp
MSIDSLKSNRISSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHL
KYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLP
DLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPV
PNRRRISQSVSQQNVRQSSNRNRDSTLTSGLNTTGHRKRFTKPIYLTRNS
QNDLEEPSPFNLVSPVSFFSIFDDLSLNETDLSYYESFENSKLTNSPKKS
FSEALKQQDIVIYKTYKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRY
KYHNYYWFNEKYDEIRINQIFHQSYWSMISGETDCSADETYLLAGILHHI
NKLSTNDTNSETANLSPNDLDKEIDSMLDRLHFDLIGKSCNEDEMEHIEI
AGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTNVSSKIPIKGNEIRL
NVKIRDKKIFIIEIILLKNNQNNKNELNNKTSKSFERVKIRFYNQQEFIK
WATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVD
SVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLT
LNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLIS
WKTNWELNNTLLMFSETFWKINFKNSWECQIFHEYLGGYLFILMRNSEKF
SDLNETIFRSLTGRNAD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR040790Kindlin_2_N
IPR037843Kindlin/fermitin
IPR035963FERM_2
IPR019749Band_41_domain
IPR011993PH-like_dom_sf
IPR019748FERM_central
Vocabulary: molecular function
TermDefinition
GO:0005547phosphatidylinositol-3,4,5-trisphosphate binding
GO:0008289lipid binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0005925focal adhesion
GO:0005938cell cortex
GO:0009986cell surface
GO:0016020membrane
GO:0030054cell junction
GO:0031234extrinsic component of cytoplasmic side of plasma membrane
GO:0031258lamellipodium membrane
GO:0031674I band
GO:0042995cell projection
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
GO:0007160cell-matrix adhesion
GO:0007179transforming growth factor beta receptor signaling pathway
GO:0007229integrin-mediated signaling pathway
GO:0008360regulation of cell shape
GO:0016055Wnt signaling pathway
GO:0033622integrin activation
GO:0034446substrate adhesion-dependent cell spreading
GO:0048041focal adhesion assembly
GO:0072657protein localization to membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019749Band 4.1 domainSMARTSM00295B41_5coord: 89..609
e-value: 0.0026
score: 13.7
IPR040790Kindlin-2, N-terminalPFAMPF18124Kindlin_2_Ncoord: 15..88
e-value: 1.3E-5
score: 25.2
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 4..97
e-value: 8.2E-14
score: 53.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 147..183
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 150..183
NoneNo IPR availablePANTHERPTHR16160:SF13FERMITIN 2-RELATEDcoord: 12..713
NoneNo IPR availableCDDcd17095FERM_F0_kindlinscoord: 13..91
e-value: 3.26724E-8
score: 49.2235
NoneNo IPR availableCDDcd17096FERM_F1_kindlinscoord: 93..167
e-value: 3.81465E-12
score: 60.7572
IPR019748FERM central domainPFAMPF00373FERM_Mcoord: 309..608
e-value: 1.5E-15
score: 57.6
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 399..546
e-value: 1.7E-5
score: 26.6
IPR037843Kindlin/fermitinPANTHERPTHR16160FAMILY NOT NAMEDcoord: 12..713
IPR035963FERM superfamily, second domainSUPERFAMILYSSF47031Second domain of FERMcoord: 306..403