CUGBP Elav-like family member 3

Overview
NameCUGBP Elav-like family member 3
Smed IDSMED30001900
Uniprot Best hitCUGBP Elav-like family member 5 OS=Xenopus tropicalis GN=celf5 PE=2 SV=1 (E=1.40923e-119)
Length (bp)1713
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CUGBP Elav-like family member 3 (SMED30001900) t-SNE clustered cells

Violin plots show distribution of expression levels for CUGBP Elav-like family member 3 (SMED30001900) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CUGBP Elav-like family member 3 (SMED30001900) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CUGBP Elav-like family member 3 (SMED30001900) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

CUGBP Elav-like family member 3 ( bruli-1 ) is expressed during Stage 2, Stage 3, Stage 4, Stage 5, Stage 6, Stage 7 and Stage 8 in the blastomere, neoblast compartment and blastomere compartment

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene bruli-1.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and bruli-1(green). piwi-1+ blastomeres co-express the stem cell maintenance gene bruli-1, and virtually all bruli-1+ cells co-express piwi-1. Several fluorescent beads used 3-dimensional reconstruction are visible (red).

Homology
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Human
Match: CELF5 (CUGBP, Elav-like family member 5 [Source:HGNC Symbol;Acc:HGNC:14058])

HSP 1 Score: 362.844 bits (930), Expect = 8.262e-118
Identity = 203/462 (43.94%), Postives = 274/462 (59.31%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDY-SVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLP---------------TGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKE 1561
            +  KLFVGQIPR+  +K+++ +FE FG I+E  +L+D  TG HKGCAF+T+  +DSA   Q ALH++K L GM RP+QVKPA +               E     +RKLFVGML+K Q++E+V  +F  FG I+ECTVL+  +G+SKGCAFVKF +HT+A AAI+ALH SQ M GASSSLVVKFADTDK++ +R++QQ +  L IL   + +    YS Y   +  +  + + ++    +         IQQI   S L+ + P+  I      H  P++   +VP    P T+         + P P        V    L+ YP  +  +      AFS   +   T        TP+                 GPEGCNLFIYHLPQE GD +L Q+F+ FGN+ISSKV++DRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+
Sbjct:   43 DAIKLFVGQIPRHLDEKDLKPLFEQFGRIYELTVLKDPYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADS---------------ESRGGRDRKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFSPCHIQQIGAVS-LNGL-PATPIAPASGLHSPPLLGTTAVPGLVAPITNGF-----AGVVPFPGGHPALETVYANGLVPYPAQSPTVAETLHPAFSG--VQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLPQEFGDTELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKD 480          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Human
Match: CELF3 (CUGBP, Elav-like family member 3 [Source:HGNC Symbol;Acc:HGNC:11967])

HSP 1 Score: 359.377 bits (921), Expect = 1.144e-116
Identity = 205/476 (43.07%), Postives = 284/476 (59.66%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSN----LSSVYPSNSIVSMP--SSHPVPMIDYSVPINNF-PQTDQITMKPIVDIQPIPPEAVH----RTIVTPGSLLSYPFLNVQIPT-VYPNAFS-----------------NGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLFVGQIPR+  +K+++ IFE FG IFE  +++DK TG HKGCAF+T+  +DSA   Q ALH++K L GMNRP+QVKPA      +S   GE+          RKLFVGML K QTDE+V+ MF  FG I+ECTVL+  +G SKGCAFVKF  H +A AAIN LH+S+ + GASSSLVVKFADT+K++ +R++QQ    L +  S I +    YS Y   +  +  + + ++    +    + A Q+Q +   +      + + PS+   + P  ++ PV  I  ++ +N + P   Q T +P  D   + P  VH    ++   P   L   +  +Q  T  YP A+S                         Q     +      GP+GCN+FIYHLPQE  D ++ Q+F+ FG+VIS+KV+VDRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    5 DAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPA------DSESRGED----------RKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMF-SPIALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAINANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVNGYSPVPTQPTGQPAPDA--LYPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 461          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Human
Match: CELF3 (CUGBP, Elav-like family member 3 [Source:HGNC Symbol;Acc:HGNC:11967])

HSP 1 Score: 353.214 bits (905), Expect = 6.332e-115
Identity = 195/449 (43.43%), Postives = 267/449 (59.47%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPG--SLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLFVGQIPR+  +K+++ IFE FG IFE  +++DK TG HKGCAF+T+  +DSA   Q ALH++K L GMNRP+QVKPA      +S   GE+          RKLFVGML K QTDE+V+ MF  FG I+ECTVL+  +G SKGCAFVKF  H +A AAIN LH+S+ + GASSSLVVKFADT+K++ +R++QQ    L +  S I +    YS Y   +  +  + + ++    +    + A Q+Q +   +       +N +++ P +               P + Q    P+  +Q       H T   P   SL++  F     P                Q     +      GP+GCN+FIYHLPQE  D ++ Q+F+ FG+VIS+KV+VDRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    5 DAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPA------DSESRGED----------RKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMF-SPIALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAIN-------ANGLIATPIT---------------PSSAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSLVAPAFPQ---PPALVAQQPPPPPQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 411          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Human
Match: CELF3 (CUGBP, Elav-like family member 3 [Source:HGNC Symbol;Acc:HGNC:11967])

HSP 1 Score: 347.051 bits (889), Expect = 6.441e-112
Identity = 199/468 (42.52%), Postives = 277/468 (59.19%), Query Frame = 2
Query:  248 QIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSN----LSSVYPSNSIVSMP--SSHPVPMIDYSVPINNF-PQTDQITMKPIVDIQPIPPEAVH----RTIVTPGSLLSYPFLNVQIPT-VYPNAFS-----------------NGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            QIPR+  +K+++ IFE FG IFE  +++DK TG HKGCAF+T+  +DSA   Q ALH++K L GMNRP+QVKPA      +S   G+           RKLFVGML K QTDE+V+ MF  FG I+ECTVL+  +G SKGCAFVKF  H +A AAIN LH+S+ + GASSSLVVKFADT+K++ +R++QQ    L +  S I +    YS Y   +  +  + + ++    +    + A Q+Q +   +      + + PS+   + P  ++ PV  I  ++ +N + P   Q T +P  D   + P  VH    ++   P   L   +  +Q  T  YP A+S                         Q     +      GP+GCN+FIYHLPQE  D ++ Q+F+ FG+VIS+KV+VDRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:   15 QIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPA------DSESRGD-----------RKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMF-SPIALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAINANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVNGYSPVPTQPTGQPAPDA--LYPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 462          

HSP 2 Score: 56.9954 bits (136), Expect = 5.934e-8
Identity = 31/77 (40.26%), Postives = 41/77 (53.25%), Query Frame = 2
Query:  233 KLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVK 463
            KLFVG + +   D+++R +FE FG I E  +LR    G  KGCAFV F     A+     LH  + L G +  L VK
Sbjct:   97 KLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPD-GTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVK 172          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Human
Match: CELF6 (CUGBP, Elav-like family member 6 [Source:HGNC Symbol;Acc:HGNC:14059])

HSP 1 Score: 342.813 bits (878), Expect = 2.090e-110
Identity = 196/451 (43.46%), Postives = 267/451 (59.20%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIV-SMPSSHP--VPMIDYSVPINNF-PQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLFVGQIPR   +++++ +FE FG I+E  +L+D+ TG HKGCAF+T+  +DSA   Q ALH++K L GMNRP+QVKPA +          E + E+      RKLFVGML K Q +E+V+ +F  FG IEECTVL+  +G SKGCAFVKF +  +A AAI  LH S+ M GASSSLVVK ADTD+++ +R++QQ    L   +   P+ +     Y T I     + + + Q         +AAQ+Q +  FS +++     +   S P S P  +P +   + +N F P T Q   +P  D        ++   ++P     YP            A S G      Q+   +       GPEGCNLFIYHLPQE GD +L Q F+ FG V+S+KV+VDRATNQSKCFGFVS+D+P  A  AI++MNG+ IG KRLKVQLK+PK+A
Sbjct:   44 DAIKLFVGQIPRGLDEQDLKPLFEEFGRIYELTVLKDRLTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPAAS----------EGRGED------RKLFVGMLGKQQGEEDVRRLFQPFGHIEECTVLRSPDGTSKGCAFVKFGSQGEAQAAIRGLHGSRTMAGASSSLVVKLADTDRERALRRMQQMAGHLGAFHP-APLPLGACGAYTTAILQHQAALLAAAQGPGLGPVAAVAAQMQHVAAFSLVAAPLLPAAAANSPPGSGPGTLPGLPAPIGVNGFGPLTPQTNGQPGSDT-------LYNNGLSP-----YP------------AQSPGVADPLQQAYAGMHHY---AGPEGCNLFIYHLPQEFGDAELIQTFLPFGAVVSAKVFVDRATNQSKCFGFVSFDNPTSAQTAIQAMNGFQIGMKRLKVQLKRPKDA 450          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Celegans
Match: unc-75 (Putative RNA-binding protein; Uncharacterized protein [Source:UniProtKB/TrEMBL;Acc:G5EE68])

HSP 1 Score: 229.565 bits (584), Expect = 1.594e-67
Identity = 109/207 (52.66%), Postives = 146/207 (70.53%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILN 844
            +  KLFVGQIPRN  +K++R +FE FG I+EF IL+DK TG HKGCAF+T+ H+DSA  CQ  LHD+K L GMNR +QVKPA       S  +           D++KLF+GMLSK Q+++ V+ +F  FG+++E TVL+  +G SKGCAFVK+ +  DA  AI+ALH SQ M GASSSLVVK+ADT+K++Q R++QQ    + +LN
Sbjct:   27 DAIKLFVGQIPRNLEEKDLRHLFEQFGKIYEFTILKDKYTGMHKGCAFLTYCHRDSAVRCQATLHDQKTLPGMNRAMQVKPADTDSRPASPKDK---------MDDKKLFIGMLSKQQSEDEVRALFATFGELDEVTVLRGADGASKGCAFVKYKHGLDAHMAISALHGSQTMPGASSSLVVKYADTEKERQNRRMQQMAAQMGMLN 224          

HSP 2 Score: 53.5286 bits (127), Expect = 2.794e-7
Identity = 23/36 (63.89%), Postives = 29/36 (80.56%), Query Frame = 2
Query: 1451 GFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPK 1558
            GFVSYD+   + AAI +MNG+ IG KRLKVQLK+P+
Sbjct:  423 GFVSYDNIHSSQAAITAMNGFQIGMKRLKVQLKRPR 458          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Celegans
Match: unc-75 (Putative RNA-binding protein; Uncharacterized protein [Source:UniProtKB/TrEMBL;Acc:G5EE68])

HSP 1 Score: 228.024 bits (580), Expect = 1.869e-66
Identity = 109/207 (52.66%), Postives = 146/207 (70.53%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILN 844
            +  KLFVGQIPRN  +K++R +FE FG I+EF IL+DK TG HKGCAF+T+ H+DSA  CQ  LHD+K L GMNR +QVKPA       S  +           D++KLF+GMLSK Q+++ V+ +F  FG+++E TVL+  +G SKGCAFVK+ +  DA  AI+ALH SQ M GASSSLVVK+ADT+K++Q R++QQ    + +LN
Sbjct:   27 DAIKLFVGQIPRNLEEKDLRHLFEQFGKIYEFTILKDKYTGMHKGCAFLTYCHRDSAVRCQATLHDQKTLPGMNRAMQVKPADTDSRPASPKDK---------MDDKKLFIGMLSKQQSEDEVRALFATFGELDEVTVLRGADGASKGCAFVKYKHGLDAHMAISALHGSQTMPGASSSLVVKYADTEKERQNRRMQQMAAQMGMLN 224          

HSP 2 Score: 135.576 bits (340), Expect = 5.017e-34
Identity = 58/84 (69.05%), Postives = 72/84 (85.71%), Query Frame = 2
Query: 1307 GPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPK 1558
            GP+GCNLFIYHLPQE GD +L Q+F  FG+++S+KV+VDRATNQSKCFGFVSYD+   + AAI +MNG+ IG KRLKVQLK+P+
Sbjct:  425 GPDGCNLFIYHLPQEFGDAELIQMFAPFGHIVSAKVFVDRATNQSKCFGFVSYDNIHSSQAAITAMNGFQIGMKRLKVQLKRPR 508          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Celegans
Match: etr-1 (ELAV-Type RNA binding-protein family [Source:RefSeq peptide;Acc:NP_493673])

HSP 1 Score: 190.66 bits (483), Expect = 8.217e-53
Identity = 93/194 (47.94%), Postives = 124/194 (63.92%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIR 805
            +  K+FVGQIPR   + + R +FE +G +F   ILRDK T   KGC FVTFYH+  A   Q ALH+ K++ GM+ P+Q+KPA            EN+       +ERKLF+G LSK   +EN++ +F KFG IE+C+VL+DQ+G S+GCAFV F N + A  A   +H SQ MEG S+ LVVKFADT K K ++
Sbjct:   53 DAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQMKPADT----------ENR-------NERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCSAPLVVKFADTQKDKDVK 229          

HSP 2 Score: 112.849 bits (281), Expect = 2.962e-26
Identity = 49/81 (60.49%), Postives = 62/81 (76.54%), Query Frame = 2
Query: 1307 GPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLK 1549
            GP+G NLFIYHLPQ+ GD  L   F  FG ++S+KV++D+ TN SKCFGFVSY++   A  AI +MNG+ IG+KRLKVQLK
Sbjct:  424 GPDGANLFIYHLPQDFGDSDLINTFAPFGGILSAKVFIDKVTNLSKCFGFVSYENAQSATNAISAMNGFQIGSKRLKVQLK 504          

HSP 3 Score: 62.003 bits (149), Expect = 6.115e-10
Identity = 36/96 (37.50%), Postives = 54/96 (56.25%), Query Frame = 2
Query:  221 ENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPA---KNKLAKNSSL 499
             N  KLF+GQ+ +   ++ +R IF  FG I +  +LRD+  G  +GCAFVTF ++  A    K +H  + + G + PL VK A   K+K  K  S+
Sbjct:  139 RNERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQD-GKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCSAPLVVKFADTQKDKDVKTKSM 233          

HSP 4 Score: 61.6178 bits (148), Expect = 8.667e-10
Identity = 36/102 (35.29%), Postives = 59/102 (57.84%), Query Frame = 2
Query:  533 SDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGN-SKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLS 835
            +D  K+FVG + +   + + + +F K+G +  C +L+D++   SKGC FV F +  DA  A  ALH  + +EG    + +K ADT+ + + RKL  +I  LS
Sbjct:   52 TDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQMKPADTENRNE-RKL--FIGQLS 150          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Celegans
Match: etr-1 (ELAV-Type RNA binding-protein family [Source:RefSeq peptide;Acc:NP_493673])

HSP 1 Score: 190.66 bits (483), Expect = 8.217e-53
Identity = 93/194 (47.94%), Postives = 124/194 (63.92%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIR 805
            +  K+FVGQIPR   + + R +FE +G +F   ILRDK T   KGC FVTFYH+  A   Q ALH+ K++ GM+ P+Q+KPA            EN+       +ERKLF+G LSK   +EN++ +F KFG IE+C+VL+DQ+G S+GCAFV F N + A  A   +H SQ MEG S+ LVVKFADT K K ++
Sbjct:   53 DAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQMKPADT----------ENR-------NERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCSAPLVVKFADTQKDKDVK 229          

HSP 2 Score: 112.849 bits (281), Expect = 2.962e-26
Identity = 49/81 (60.49%), Postives = 62/81 (76.54%), Query Frame = 2
Query: 1307 GPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLK 1549
            GP+G NLFIYHLPQ+ GD  L   F  FG ++S+KV++D+ TN SKCFGFVSY++   A  AI +MNG+ IG+KRLKVQLK
Sbjct:  424 GPDGANLFIYHLPQDFGDSDLINTFAPFGGILSAKVFIDKVTNLSKCFGFVSYENAQSATNAISAMNGFQIGSKRLKVQLK 504          

HSP 3 Score: 62.003 bits (149), Expect = 6.115e-10
Identity = 36/96 (37.50%), Postives = 54/96 (56.25%), Query Frame = 2
Query:  221 ENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPA---KNKLAKNSSL 499
             N  KLF+GQ+ +   ++ +R IF  FG I +  +LRD+  G  +GCAFVTF ++  A    K +H  + + G + PL VK A   K+K  K  S+
Sbjct:  139 RNERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQD-GKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCSAPLVVKFADTQKDKDVKTKSM 233          

HSP 4 Score: 61.6178 bits (148), Expect = 8.667e-10
Identity = 36/102 (35.29%), Postives = 59/102 (57.84%), Query Frame = 2
Query:  533 SDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGN-SKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLS 835
            +D  K+FVG + +   + + + +F K+G +  C +L+D++   SKGC FV F +  DA  A  ALH  + +EG    + +K ADT+ + + RKL  +I  LS
Sbjct:   52 TDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQMKPADTENRNE-RKL--FIGQLS 150          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Celegans
Match: etr-1 (ELAV-Type RNA binding-protein family [Source:RefSeq peptide;Acc:NP_493673])

HSP 1 Score: 190.66 bits (483), Expect = 8.217e-53
Identity = 93/194 (47.94%), Postives = 124/194 (63.92%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIR 805
            +  K+FVGQIPR   + + R +FE +G +F   ILRDK T   KGC FVTFYH+  A   Q ALH+ K++ GM+ P+Q+KPA            EN+       +ERKLF+G LSK   +EN++ +F KFG IE+C+VL+DQ+G S+GCAFV F N + A  A   +H SQ MEG S+ LVVKFADT K K ++
Sbjct:   53 DAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQMKPADT----------ENR-------NERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCSAPLVVKFADTQKDKDVK 229          

HSP 2 Score: 112.849 bits (281), Expect = 2.962e-26
Identity = 49/81 (60.49%), Postives = 62/81 (76.54%), Query Frame = 2
Query: 1307 GPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLK 1549
            GP+G NLFIYHLPQ+ GD  L   F  FG ++S+KV++D+ TN SKCFGFVSY++   A  AI +MNG+ IG+KRLKVQLK
Sbjct:  424 GPDGANLFIYHLPQDFGDSDLINTFAPFGGILSAKVFIDKVTNLSKCFGFVSYENAQSATNAISAMNGFQIGSKRLKVQLK 504          

HSP 3 Score: 62.003 bits (149), Expect = 6.115e-10
Identity = 36/96 (37.50%), Postives = 54/96 (56.25%), Query Frame = 2
Query:  221 ENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPA---KNKLAKNSSL 499
             N  KLF+GQ+ +   ++ +R IF  FG I +  +LRD+  G  +GCAFVTF ++  A    K +H  + + G + PL VK A   K+K  K  S+
Sbjct:  139 RNERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQD-GKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCSAPLVVKFADTQKDKDVKTKSM 233          

HSP 4 Score: 61.6178 bits (148), Expect = 8.667e-10
Identity = 36/102 (35.29%), Postives = 59/102 (57.84%), Query Frame = 2
Query:  533 SDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGN-SKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLS 835
            +D  K+FVG + +   + + + +F K+G +  C +L+D++   SKGC FV F +  DA  A  ALH  + +EG    + +K ADT+ + + RKL  +I  LS
Sbjct:   52 TDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQMKPADTENRNE-RKL--FIGQLS 150          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Fly
Match: bru-2 (bruno-2 [Source:FlyBase gene name;Acc:FBgn0262475])

HSP 1 Score: 300.827 bits (769), Expect = 1.632e-91
Identity = 184/464 (39.66%), Postives = 254/464 (54.74%), Query Frame = 2
Query:  230 FKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTI------PSNQYIRNCNEYILAA--QIQQINLFSNL-SSVYPSNSIVSMPSS-HPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNL---------TSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
             K+FVGQIP+   +  +R +FE FGP+    +LRDK T   +GC FVT+Y + +A   Q ALH+ K L+GM+ P+Q+KPA          + EN+       +ERKLFVGML+K  T+ +V+ +FT  G IEECTVL+DQ G SKGCAFV F    +A  AI ALH SQ MEG S+ LVVKFADT K+K  +K+QQ       +++   IN P  +  G    P  N+        PS           LAA  Q+QQ    +   +++ P NS  ++ +S  P  +   +           +   P         + +H   ++P   L  P       +   +  +NG           TS  Q++    T     GP+G NLFIYHLPQE  D  L   F+ FGNV+S+KV++D+ TN SKCFGFVSYD+P  ANAAI++M+G+ IG+KRLKVQLK+ K+A
Sbjct:  295 IKMFVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRKAALRAQDALHNIKTLDGMHHPIQMKPA----------DSENR-------NERKLFVGMLNKKYTEADVRQLFTGHGTIEECTVLRDQAGQSKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPLVVKFADTQKEKDQKKMQQ-------IHAFCGINTPSGATAGA-ATPTINAATALIAAPPSAGRTNPSMAAALAAVPQVQQAGSAATAPTTLVPLNSTTALSASLTPNLLATNAAHQGAAAAAAYLGADPAAAAHLQLYQQLHGYGLSPAHYLPGPPNAADPYSSSLSGLTNGAAYGAASQPVTTSALQAAAAGVTGKQIEGPDGSNLFIYHLPQEFIDTDLASTFLPFGNVLSAKVFIDKQTNLSKCFGFVSYDNPHSANAAIQAMHGFQIGSKRLKVQLKRSKDA 733          

HSP 2 Score: 65.0846 bits (157), Expect = 1.208e-10
Identity = 36/90 (40.00%), Postives = 50/90 (55.56%), Query Frame = 2
Query:  221 ENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKN 490
             N  KLFVG + +   + ++R +F   G I E  +LRD + G  KGCAFVTF  K +A    KALH  + + G + PL VK A  +  K+
Sbjct:  379 RNERKLFVGMLNKKYTEADVRQLFTGHGTIEECTVLRD-QAGQSKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPLVVKFADTQKEKD 467          

HSP 3 Score: 55.4546 bits (132), Expect = 1.040e-7
Identity = 31/99 (31.31%), Postives = 55/99 (55.56%), Query Frame = 2
Query:  518 EEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKL 811
            ++Q  +D  K+FVG + K   +  ++ MF +FG +    VL+D+    S+GC FV +     A  A +ALH  + ++G    + +K AD++ + + RKL
Sbjct:  287 KDQPDADNIKMFVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRKAALRAQDALHNIKTLDGMHHPIQMKPADSENRNE-RKL 384          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Fly
Match: bru-2 (bruno-2 [Source:FlyBase gene name;Acc:FBgn0262475])

HSP 1 Score: 300.827 bits (769), Expect = 1.632e-91
Identity = 184/464 (39.66%), Postives = 254/464 (54.74%), Query Frame = 2
Query:  230 FKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTI------PSNQYIRNCNEYILAA--QIQQINLFSNL-SSVYPSNSIVSMPSS-HPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNL---------TSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
             K+FVGQIP+   +  +R +FE FGP+    +LRDK T   +GC FVT+Y + +A   Q ALH+ K L+GM+ P+Q+KPA          + EN+       +ERKLFVGML+K  T+ +V+ +FT  G IEECTVL+DQ G SKGCAFV F    +A  AI ALH SQ MEG S+ LVVKFADT K+K  +K+QQ       +++   IN P  +  G    P  N+        PS           LAA  Q+QQ    +   +++ P NS  ++ +S  P  +   +           +   P         + +H   ++P   L  P       +   +  +NG           TS  Q++    T     GP+G NLFIYHLPQE  D  L   F+ FGNV+S+KV++D+ TN SKCFGFVSYD+P  ANAAI++M+G+ IG+KRLKVQLK+ K+A
Sbjct:  295 IKMFVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRKAALRAQDALHNIKTLDGMHHPIQMKPA----------DSENR-------NERKLFVGMLNKKYTEADVRQLFTGHGTIEECTVLRDQAGQSKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPLVVKFADTQKEKDQKKMQQ-------IHAFCGINTPSGATAGA-ATPTINAATALIAAPPSAGRTNPSMAAALAAVPQVQQAGSAATAPTTLVPLNSTTALSASLTPNLLATNAAHQGAAAAAAYLGADPAAAAHLQLYQQLHGYGLSPAHYLPGPPNAADPYSSSLSGLTNGAAYGAASQPVTTSALQAAAAGVTGKQIEGPDGSNLFIYHLPQEFIDTDLASTFLPFGNVLSAKVFIDKQTNLSKCFGFVSYDNPHSANAAIQAMHGFQIGSKRLKVQLKRSKDA 733          

HSP 2 Score: 65.0846 bits (157), Expect = 1.208e-10
Identity = 36/90 (40.00%), Postives = 50/90 (55.56%), Query Frame = 2
Query:  221 ENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKN 490
             N  KLFVG + +   + ++R +F   G I E  +LRD + G  KGCAFVTF  K +A    KALH  + + G + PL VK A  +  K+
Sbjct:  379 RNERKLFVGMLNKKYTEADVRQLFTGHGTIEECTVLRD-QAGQSKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPLVVKFADTQKEKD 467          

HSP 3 Score: 55.4546 bits (132), Expect = 1.040e-7
Identity = 31/99 (31.31%), Postives = 55/99 (55.56%), Query Frame = 2
Query:  518 EEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKL 811
            ++Q  +D  K+FVG + K   +  ++ MF +FG +    VL+D+    S+GC FV +     A  A +ALH  + ++G    + +K AD++ + + RKL
Sbjct:  287 KDQPDADNIKMFVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRKAALRAQDALHNIKTLDGMHHPIQMKPADSENRNE-RKL 384          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Fly
Match: bru-2 (bruno-2 [Source:FlyBase gene name;Acc:FBgn0262475])

HSP 1 Score: 209.534 bits (532), Expect = 3.130e-61
Identity = 137/354 (38.70%), Postives = 188/354 (53.11%), Query Frame = 2
Query:  560 MLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTI------PSNQYIRNCNEYILAA--QIQQINLFSNL-SSVYPSNSIVSMPSS-HPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNL---------TSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            ML+K  T+ +V+ +FT  G IEECTVL+DQ G SKGCAFV F    +A  AI ALH SQ MEG S+ LVVKFADT K+K  +K+QQ       +++   IN P  +  G    P  N+        PS           LAA  Q+QQ    +   +++ P NS  ++ +S  P  +   +           +   P         + +H   ++P   L  P       +   +  +NG           TS  Q++    T     GP+G NLFIYHLPQE  D  L   F+ FGNV+S+KV++D+ TN SKCFGFVSYD+P  ANAAI++M+G+ IG+KRLKVQLK+ K+A
Sbjct:    1 MLNKKYTEADVRQLFTGHGTIEECTVLRDQAGQSKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPLVVKFADTQKEKDQKKMQQ-------IHAFCGINTPSGATAGAA-TPTINAATALIAAPPSAGRTNPSMAAALAAVPQVQQAGSAATAPTTLVPLNSTTALSASLTPNLLATNAAHQGAAAAAAYLGADPAAAAHLQLYQQLHGYGLSPAHYLPGPPNAADPYSSSLSGLTNGAAYGAASQPVTTSALQAAAAGVTGKQIEGPDGSNLFIYHLPQEFIDTDLASTFLPFGNVLSAKVFIDKQTNLSKCFGFVSYDNPHSANAAIQAMHGFQIGSKRLKVQLKRSKDA 346          

HSP 2 Score: 55.8398 bits (133), Expect = 4.802e-8
Identity = 30/74 (40.54%), Postives = 42/74 (56.76%), Query Frame = 2
Query:  269 DKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKN 490
            + ++R +F   G I E  +LRD+  G  KGCAFVTF  K +A    KALH  + + G + PL VK A  +  K+
Sbjct:    8 EADVRQLFTGHGTIEECTVLRDQ-AGQSKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPLVVKFADTQKEKD 80          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Fly
Match: bru-2 (bruno-2 [Source:FlyBase gene name;Acc:FBgn0262475])

HSP 1 Score: 200.29 bits (508), Expect = 2.616e-55
Identity = 116/281 (41.28%), Postives = 159/281 (56.58%), Query Frame = 2
Query:  230 FKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTI------PSNQYIRNCNEYILAA--QIQQINLFSNL-SSVYPSNSIVSMPSS 1045
             K+FVGQIP+   +  +R +FE FGP+    +LRDK T   +GC FVT+Y + +A   Q ALH+ K L+GM+ P+Q+KPA          + EN+       +ERKLFVGML+K  T+ +V+ +FT  G IEECTVL+DQ G SKGCAFV F    +A  AI ALH SQ MEG S+ LVVKFADT K+K  +K+QQ       +++   IN P  +  G    P  N+        PS           LAA  Q+QQ    +   +++ P NS  ++ +S
Sbjct:  295 IKMFVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRKAALRAQDALHNIKTLDGMHHPIQMKPA----------DSENR-------NERKLFVGMLNKKYTEADVRQLFTGHGTIEECTVLRDQAGQSKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPLVVKFADTQKEKDQKKMQQ-------IHAFCGINTPSGATAGA-ATPTINAATALIAAPPSAGRTNPSMAAALAAVPQVQQAGSAATAPTTLVPLNSTTALSAS 550          

HSP 2 Score: 65.855 bits (159), Expect = 6.657e-11
Identity = 36/90 (40.00%), Postives = 50/90 (55.56%), Query Frame = 2
Query:  221 ENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKN 490
             N  KLFVG + +   + ++R +F   G I E  +LRD + G  KGCAFVTF  K +A    KALH  + + G + PL VK A  +  K+
Sbjct:  379 RNERKLFVGMLNKKYTEADVRQLFTGHGTIEECTVLRD-QAGQSKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPLVVKFADTQKEKD 467          

HSP 3 Score: 55.8398 bits (133), Expect = 7.416e-8
Identity = 31/99 (31.31%), Postives = 55/99 (55.56%), Query Frame = 2
Query:  518 EEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKL 811
            ++Q  +D  K+FVG + K   +  ++ MF +FG +    VL+D+    S+GC FV +     A  A +ALH  + ++G    + +K AD++ + + RKL
Sbjct:  287 KDQPDADNIKMFVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRKAALRAQDALHNIKTLDGMHHPIQMKPADSENRNE-RKL 384          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Fly
Match: bru-2 (bruno-2 [Source:FlyBase gene name;Acc:FBgn0262475])

HSP 1 Score: 200.29 bits (508), Expect = 2.616e-55
Identity = 116/281 (41.28%), Postives = 159/281 (56.58%), Query Frame = 2
Query:  230 FKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTI------PSNQYIRNCNEYILAA--QIQQINLFSNL-SSVYPSNSIVSMPSS 1045
             K+FVGQIP+   +  +R +FE FGP+    +LRDK T   +GC FVT+Y + +A   Q ALH+ K L+GM+ P+Q+KPA          + EN+       +ERKLFVGML+K  T+ +V+ +FT  G IEECTVL+DQ G SKGCAFV F    +A  AI ALH SQ MEG S+ LVVKFADT K+K  +K+QQ       +++   IN P  +  G    P  N+        PS           LAA  Q+QQ    +   +++ P NS  ++ +S
Sbjct:  295 IKMFVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRKAALRAQDALHNIKTLDGMHHPIQMKPA----------DSENR-------NERKLFVGMLNKKYTEADVRQLFTGHGTIEECTVLRDQAGQSKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPLVVKFADTQKEKDQKKMQQ-------IHAFCGINTPSGATAGA-ATPTINAATALIAAPPSAGRTNPSMAAALAAVPQVQQAGSAATAPTTLVPLNSTTALSAS 550          

HSP 2 Score: 65.855 bits (159), Expect = 6.657e-11
Identity = 36/90 (40.00%), Postives = 50/90 (55.56%), Query Frame = 2
Query:  221 ENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKN 490
             N  KLFVG + +   + ++R +F   G I E  +LRD + G  KGCAFVTF  K +A    KALH  + + G + PL VK A  +  K+
Sbjct:  379 RNERKLFVGMLNKKYTEADVRQLFTGHGTIEECTVLRD-QAGQSKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPLVVKFADTQKEKD 467          

HSP 3 Score: 55.8398 bits (133), Expect = 7.416e-8
Identity = 31/99 (31.31%), Postives = 55/99 (55.56%), Query Frame = 2
Query:  518 EEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKL 811
            ++Q  +D  K+FVG + K   +  ++ MF +FG +    VL+D+    S+GC FV +     A  A +ALH  + ++G    + +K AD++ + + RKL
Sbjct:  287 KDQPDADNIKMFVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRKAALRAQDALHNIKTLDGMHHPIQMKPADSENRNE-RKL 384          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Zebrafish
Match: celf5a (cugbp, Elav-like family member 5a [Source:ZFIN;Acc:ZDB-GENE-050208-746])

HSP 1 Score: 359.377 bits (921), Expect = 2.107e-116
Identity = 210/462 (45.45%), Postives = 281/462 (60.82%), Query Frame = 2
Query:  221 ENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQ--YIRNCNEYILAAQIQQINLFSNLSSVYPSN-SIVSMPSSHPVPMIDYSVP------INNFPQT-DQITMKPIVD---IQPIPPEAVHRTIVTPGSLLSYPFLNVQIPT-VYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            ++  KLF+GQIPRN  +K+++ +FE FG I E  +L+D+ TG HKGCAF+T+  ++SA   Q ALH++K L GM RP+QVKPA      +S   G+           RKLFVGML+K QT+E+V  +F  +G IEECTVL+  +GNSKGCAFVKF  H +A +AI+ALH SQ M GASSSLVVKFADTDK++ IR++QQ +    I N  I +    YS Y   +  +  + + ++   Y+     +    QI Q+    N++S+ P+  + VS  SS P  +   +VP      +N F     Q    P V+      +PP +      T    L   F  VQ  T +YP         S  Q    ++      GPEGCNLFIYHLPQE GD +L Q+F+ FG VISSKV++DRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:   63 QDAIKLFIGQIPRNLEEKDLKPLFEQFGKIHELTVLKDRYTGMHKGCAFLTYCARESAIKAQNALHEQKTLPGMTRPIQVKPA------DSESRGD-----------RKLFVGMLNKQQTEEDVYRLFEPYGVIEECTVLRGPDGNSKGCAFVKFSTHAEAQSAISALHGSQTMPGASSSLVVKFADTDKERTIRRMQQMVGQFGIFNPAIALPFSTYSTYAHALMQQQAALMAASHGGYLAPSVAFP-TTQIHQMGAL-NINSLPPTPMTPVSGLSSPPANITTSAVPSIVTPIVNGFTSIPHQPNGHPAVEAVYTNGLPPYSTQSP--TAADTLQQAFTGVQQYTAIYPATTLTPIGQSLPQPPQVIQQQQQREGPEGCNLFIYHLPQEFGDNELMQMFLPFGTVISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 503          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Zebrafish
Match: celf5a (cugbp, Elav-like family member 5a [Source:ZFIN;Acc:ZDB-GENE-050208-746])

HSP 1 Score: 358.221 bits (918), Expect = 1.227e-115
Identity = 209/470 (44.47%), Postives = 282/470 (60.00%), Query Frame = 2
Query:  221 ENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQ--YIRNCNEYILAAQIQQINLFSNLSSVYPS---------NSIVSMPSSHPVPMIDYSVP------INNFPQT-DQITMKPIVD---IQPIPPEAVHRTIVTPGSLLSYPFLNVQIPT-VYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            ++  KLF+GQIPRN  +K+++ +FE FG I E  +L+D+ TG HKGCAF+T+  ++SA   Q ALH++K L GM RP+QVKPA      +S   GE+          RKLFVGML+K QT+E+V  +F  +G IEECTVL+  +GNSKGCAFVKF  H +A +AI+ALH SQ M GASSSLVVKFADTDK++ IR++QQ +    I N  I +    YS Y   +  +  + + ++   Y+     +    QI Q+    N++S+ P+         +  ++  SS P  +   +VP      +N F     Q    P V+      +PP +      T    L   F  VQ  T +YP         S  Q    ++      GPEGCNLFIYHLPQE GD +L Q+F+ FG VISSKV++DRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:   75 QDAIKLFIGQIPRNLEEKDLKPLFEQFGKIHELTVLKDRYTGMHKGCAFLTYCARESAIKAQNALHEQKTLPGMTRPIQVKPA------DSESRGED----------RKLFVGMLNKQQTEEDVYRLFEPYGVIEECTVLRGPDGNSKGCAFVKFSTHAEAQSAISALHGSQTMPGASSSLVVKFADTDKERTIRRMQQMVGQFGIFNPAIALPFSTYSTYAHALMQQQAALMAASHGGYLAPSVAFP-TTQIHQMGAL-NINSLPPTPMTPVSGEFHQTLAGLSSPPANITTSAVPSIVTPIVNGFTSIPHQPNGHPAVEAVYTNGLPPYSTQSP--TAADTLQQAFTGVQQYTAIYPATTLTPIGQSLPQPPQVIQQQQQREGPEGCNLFIYHLPQEFGDNELMQMFLPFGTVISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 524          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Zebrafish
Match: celf3a (cugbp, Elav-like family member 3a [Source:ZFIN;Acc:ZDB-GENE-000501-2])

HSP 1 Score: 351.673 bits (901), Expect = 3.951e-114
Identity = 199/482 (41.29%), Postives = 293/482 (60.79%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQIN-------LFSNLSSVYPSNSIVSMP--SSHPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPP----EAVHRTIVTPGSLLSYPFLNVQIPTVYP--NAFSN-GNLTSTTQSSTDVKTTPLP-------------------TGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLF+GQIPRN  +K+++ IFE FG I+E  +++DK TG HKGCAF+T+  ++SA   Q ALH++K L GMNRP+QVKPA      +S   G+           RKLFVGML K  +D +V+ MF  FG IEECTVL+  +G SKGCAFVK+ ++ +A AAI+ALH S+ + GASSSLVVKFADT+K++ IR++QQ    L ++ S + +++  Y+ Y   +  +  + +  + Y+      + A Q+QQ+        + + ++S+ PS+   + P  ++ PVP +   + +N++P              P+P     ++    + T G    +P+   Q P + P   A++   + T+T  ++  +   P P                    GPEGCN+FIYHLPQE  D ++ Q+F+ FGNVIS+KV+VDRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    5 DAIKLFIGQIPRNLEEKDLKPIFEQFGKIYELTVIKDKYTGMHKGCAFLTYCARESALKAQNALHEQKTLPGMNRPIQVKPA------DSEGRGD-----------RKLFVGMLGKQLSDADVRKMFEPFGSIEECTVLRGPDGASKGCAFVKYQSNAEAQAAISALHGSRTLPGASSSLVVKFADTEKERGIRRMQQVASQLGVI-SPMSLHLGAYNAYTQALV-QQQALVAQSAYLSPVAT-VAAVQMQQLAALNPSSIIATPIASITPSSGTSTPPTIAATPVPALPPPIAVNSYP--------------PVPAAPNGQSASEALYTNGV---HPY-QAQSPALDPLQQAYTGMQHYTATYPAAYGLVGQPFPHQPTLVAQQPQQPQQLQQREGPEGCNIFIYHLPQEFTDSEMLQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 448          

HSP 2 Score: 68.1662 bits (165), Expect = 8.821e-12
Identity = 36/94 (38.30%), Postives = 58/94 (61.70%), Query Frame = 2
Query:  533 SDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKL 811
            +D  KLF+G + +N  +++++ +F +FGKI E TV+KD+  G  KGCAF+ +     A  A NALH  + + G +  + VK AD++ +   RKL
Sbjct:    4 ADAIKLFIGQIPRNLEEKDLKPIFEQFGKIYELTVIKDKYTGMHKGCAFLTYCARESALKAQNALHEQKTLPGMNRPIQVKPADSEGRGD-RKL 96          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Zebrafish
Match: celf3b (cugbp, Elav-like family member 3b [Source:ZFIN;Acc:ZDB-GENE-110408-50])

HSP 1 Score: 348.206 bits (892), Expect = 7.086e-113
Identity = 196/456 (42.98%), Postives = 278/456 (60.96%), Query Frame = 2
Query:  233 KLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFPQTDQIT----MKPIVDIQP---IPPEAVH----RTIVTPGSLLSYPFLNVQIPTV-YPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            KLF+GQIPRN  +K+++ IFE +G I+E  +++DK TG HKGCAF+T+  ++SA   Q ALH++K L GMNRP+QVKPA      +S   GE+          RKLFVGML K Q+DE+V+ +F  FG I+ECTVL+  +G SKGCAFVKF +H++A +AIN+LH S+ + GASSSLVVKFADT+K++ +R++QQ    L +    + +N   Y+         Y   +   Q +    +Y+  A   QI   + L++     + ++ PS    P    + P++  PQ   +     + P  + QP   I    +H    ++ V     L   +  +Q  T  YP A+   +     Q +   +      GPEGCN+FIYHLPQE  D ++ Q+F+ FGNVIS+KV+VDRATNQSKCFGFVS+D+PA A  AI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    8 KLFIGQIPRNLEEKDLKPIFEQYGKIYELTVIKDKYTGMHKGCAFLTYCARESAIKAQSALHEQKTLPGMNRPIQVKPA------DSEGRGED----------RKLFVGMLGKQQSDEDVRKIFEPFGGIDECTVLRGPDGTSKGCAFVKFQSHSEAQSAINSLHGSRTLPGASSSLVVKFADTEKERGVRRMQQVTSQLGVYTP-VTLNFNAYN--------AYTQALVQQQALVAQAQYLSPAASMQIQQMAALNASGIIATPITPPSGANTPPTLAATPVSALPQPIAVNGYSHLPPTTNGQPASEIYTNGLHPYQAQSPVAALDPLQQAYAGMQHYTAAYPTAYGLVSPQFLQQPTLISQQQLQREGPEGCNVFIYHLPQEFTDSEMLQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPASAQTAIQAMNGFQIGMKRLKVQLKRPKDA 438          

HSP 2 Score: 68.9366 bits (167), Expect = 5.581e-12
Identity = 34/93 (36.56%), Postives = 58/93 (62.37%), Query Frame = 2
Query:  536 DERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKL 811
            D  KLF+G + +N  +++++ +F ++GKI E TV+KD+  G  KGCAF+ +     A  A +ALH  + + G +  + VK AD++ + + RKL
Sbjct:    5 DAIKLFIGQIPRNLEEKDLKPIFEQYGKIYELTVIKDKYTGMHKGCAFLTYCARESAIKAQSALHEQKTLPGMNRPIQVKPADSEGRGEDRKL 97          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Zebrafish
Match: CELF6 (CUGBP, Elav-like family member 6 [Source:HGNC Symbol;Acc:HGNC:14059])

HSP 1 Score: 300.827 bits (769), Expect = 1.257e-94
Identity = 177/424 (41.75%), Postives = 240/424 (56.60%), Query Frame = 2
Query:  233 KLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMP------SSHPVPMID----YSVPINNFPQ-TDQITMKPIVD------IQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFG 1453
            KLF+GQIPRN  +K+++ +FE FG I+E  +L+D+ TG HKGCAF+T+  ++SA   Q ALH++K L GMNRP+QVKPA      +S   GE          ERKLFVGML K Q +E+V+ +F  FG+IEECTVL+  +G SKGCAFVKF +H +A AAIN+LH  Q M GASSSLVVKFADTDK++ +R++ Q    L I +   P+++  +  YG   +            +       L              + +  N +++ P      SS P P I      S+ +N F     Q   +P  +      I P P ++   T+  P   L   +  VQ    YP A++   ++        +       GPEGCNLFIYHLPQE GD +L Q+F+ FGNVIS+KV+VDRATNQSKCFG
Sbjct:   35 KLFIGQIPRNLEEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCARESALKAQSALHEQKTLPGMNRPIQVKPA------DSEGRGE----------ERKLFVGMLGKQQCEEDVRCLFEAFGQIEECTVLRGPDGASKGCAFVKFSSHAEAQAAINSLHGGQTMPGASSSLVVKFADTDKERTLRRMHQMAGQLGIFS---PMSV-QFGAYGAYTHAMIQQQQQQAALMAATQSSYLNPMAALAAAQMQQIAAFNLNGLLAAPMTPSSGSSTP-PGISGSGLSSMGVNGFSALAAQSNGQPASETLYTNGIHPYPAQSP--TVADP---LQQAYAGVQHYAAYPTAYA--PISQAFAQQPPIIPQQQREGPEGCNLFIYHLPQEFGDAELMQMFLPFGNVISAKVFVDRATNQSKCFG 430          

HSP 2 Score: 69.707 bits (169), Expect = 3.007e-12
Identity = 36/93 (38.71%), Postives = 58/93 (62.37%), Query Frame = 2
Query:  536 DERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKL 811
            D  KLF+G + +N  +++++ +F +FGKI E TVLKD+  G  KGCAF+ +     A  A +ALH  + + G +  + VK AD++ + + RKL
Sbjct:   32 DAIKLFIGQIPRNLEEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCARESALKAQSALHEQKTLPGMNRPIQVKPADSEGRGEERKL 124          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Xenopus
Match: celf5 (CUGBP, Elav-like family member 5 [Source:Xenbase;Acc:XB-GENE-494002])

HSP 1 Score: 360.918 bits (925), Expect = 1.259e-117
Identity = 211/476 (44.33%), Postives = 286/476 (60.08%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYG--------TIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMID-YSVP------INNFPQTDQI-TMKPIVD------IQPIPPEAVHRTIVTPGSLLSYPFLNVQ-IPTVYPNAFSNGNLTSTTQSSTDVKTTPLP-------TGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKE 1561
            +  KLFVGQIPRN  +K+++ +FE FG I+E  +L+D+ TG HKGCAF+T+  +DSA   Q ALH++K L GM RP+QVKPA ++ ++ + L+               ++ GMLSK Q++E V +MF  FG IEEC+VL+  +G+SKGCAFVKF +H +A AAI ALH SQ M GASSSLVVKFADTDK++ +R++QQ +  L I    + + I  YS Y         T+++  + S +  +    +C+       IQQI    NL+ + P+  I      H  P+I   +VP       N FP      +  P +D      I P P ++   T+ +    L   F  VQ    +YP A     LT  T S      TP P        GPEGCNLFIYHLPQE GD +L Q+F+ FGN+ISSKV++DRATNQSKCFGFVS+D+P+ A  AI++MNG+ IG KRLKVQLK+PK+
Sbjct:   33 DAIKLFVGQIPRNLEEKDLKPLFEQFGKIYELTVLKDRYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSE-SRGAKLS---------------IYXGMLSKQQSEEEVTSMFQAFGSIEECSVLRGPDGSSKGCAFVKFSSHAEAQAAIQALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGIFTPSLALPISPYSAYAQALMQQQTTVLSTSHGSYLSPSVAFPSCH-------IQQIGAV-NLNGL-PAAPITPASGLHSPPVIGTAAVPGLVAPLTNGFPGLVPFPSSHPALDTIYTNSIVPYPAQSPALTVES----LHPSFTGVQQYSAIYPTA----ALTPVTHS------TPQPPPILQQREGPEGCNLFIYHLPQEFGDNELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPSSAQTAIQAMNGFQIGMKRLKVQLKRPKD 469          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Xenopus
Match: celf5 (CUGBP, Elav-like family member 5 [Source:Xenbase;Acc:XB-GENE-494002])

HSP 1 Score: 353.214 bits (905), Expect = 1.614e-114
Identity = 208/476 (43.70%), Postives = 284/476 (59.66%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYG--------TIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMID-YSVP------INNFPQTDQI-TMKPIVD------IQPIPPEAVHRTIVTPGSLLSYPFLNVQ-IPTVYPNAFSNGNLTSTTQSSTDVKTTPLP-------TGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKE 1561
            +  KLFVGQIPRN  +K+++ +FE FG I+E  +L+D+ TG HKGCAF+T+  +DSA   Q ALH++K L GM RP+QVKPA            ++++   ++     L+V  +S+ Q++E V +MF  FG IEEC+VL+  +G+SKGCAFVKF +H +A AAI ALH SQ M GASSSLVVKFADTDK++ +R++QQ +  L I    + + I  YS Y         T+++  + S +  +    +C+       IQQI    NL+ + P+  I      H  P+I   +VP       N FP      +  P +D      I P P ++   T+ +    L   F  VQ    +YP A     LT  T S      TP P        GPEGCNLFIYHLPQE GD +L Q+F+ FGN+ISSKV++DRATNQSKCFGFVS+D+P+ A  AI++MNG+ IG KRLKVQLK+PK+
Sbjct:   45 DAIKLFVGQIPRNLEEKDLKPLFEQFGKIYELTVLKDRYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPA------------DSESRGGMY----PLYVTSISRKQSEEEVTSMFQAFGSIEECSVLRGPDGSSKGCAFVKFSSHAEAQAAIQALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGIFTPSLALPISPYSAYAQALMQQQTTVLSTSHGSYLSPSVAFPSCH-------IQQIGAV-NLNGL-PAAPITPASGLHSPPVIGTAAVPGLVAPLTNGFPGLVPFPSSHPALDTIYTNSIVPYPAQSPALTVES----LHPSFTGVQQYSAIYPTA----ALTPVTHS------TPQPPPILQQREGPEGCNLFIYHLPQEFGDNELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPSSAQTAIQAMNGFQIGMKRLKVQLKRPKD 481          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Xenopus
Match: celf1 (CUGBP, Elav-like family member 1 [Source:Xenbase;Acc:XB-GENE-854036])

HSP 1 Score: 283.878 bits (725), Expect = 7.127e-88
Identity = 171/486 (35.19%), Postives = 262/486 (53.91%), Query Frame = 2
Query:  230 FKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTG--FHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKL-------------QQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIP--SNQYIRNCNEYILA---AQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVK---TTPLPT--------------------GPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPK 1558
             K+FVGQ+PR+  +KE+R +FE +G ++E  +LRD+       KGC F+TFY + +A   Q ALH+ K+L GM+ P+Q+KPA ++  KN+++            ++RKLFVGM+SK   + +++ MF++FG+IEE  +L+  +G S+GCAFV F   + A  AI A+H +Q MEG SS +VVKFADT K K+ +++                  +L+ L+S  P  +    Q  +  N    S +     +Y       + A     +  +   ++ +   PS       SS P+ ++  S   ++    +   + P+  +  +   A     +  GSL     LN  + +   N  +   + + +Q+ + ++      LP+                    GPEG NLFIYHLPQE GD  L Q+FM FGNV+S+KV++D+ TN SKCFGFVSYD+P  A AAI+SMNG+ IG KRLKVQLK+ K
Sbjct:   16 IKMFVGQVPRSWSEKELRELFEQYGAVYEINVLRDRSQNPPQSKGCCFITFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSE--KNNAV------------EDRKLFVGMVSKKCNENDIRAMFSQFGQIEESRILRGPDGMSRGCAFVTFTTRSMAQMAIKAMHQAQTMEGCSSPIVVKFADTQKDKEQKRMTQQLQQQMQQLNAASMWGNLAGLSSLAPQYLALLQQTASSGNLNSLSGLHPMGGEYATGMTSGLNAMQLQNLAALAAAASAAQNTPSAGSALTTSSSPLSILTSSATGSSPSSNNNSAVNPMASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSLSNG-TGSTMEALSQAYSGIQQYAAAALPSLYNQSLLSQQGLGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSK 486          

HSP 2 Score: 58.9214 bits (141), Expect = 4.734e-9
Identity = 35/122 (28.69%), Postives = 66/122 (54.10%), Query Frame = 2
Query:  536 DERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGN---SKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTI 892
            D  K+FVG + ++ +++ ++ +F ++G + E  VL+D++ N   SKGC F+ F     A  A NALH  + + G    + +K AD++K   +   + ++  +S   +   I    +SQ+G I
Sbjct:   14 DSIKMFVGQVPRSWSEKELRELFEQYGAVYEINVLRDRSQNPPQSKGCCFITFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFVGMVSKKCNENDIRA-MFSQFGQI 134          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Xenopus
Match: celf4 (CUGBP, Elav-like family member 4 [Source:Xenbase;Acc:XB-GENE-5873699])

HSP 1 Score: 268.47 bits (685), Expect = 2.367e-83
Identity = 161/364 (44.23%), Postives = 214/364 (58.79%), Query Frame = 2
Query:  533 SDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYN------STIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYP--SNSIVSMP---SSHPVPMIDYSVPINNFPQT-DQITMKPIVD------IQPIPPEAVHRTIVTPGSLLSYPFLNVQ--IPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +++RKLFVGML+K Q++++V+ +F  FG IEECT+L+  +GNSKGCAFVK+ +H +A AAINALH SQ M GASSSLVVKFADTDK++ +R++QQ    + + N   P+ I  +  YG              +++    Y+     +  A   Q   L  N  +  P    S  S P   ++  VP I   + +N F     Q   +P  +      I P P  A   T   P   L   +  VQ      YP A+  G ++        +       GPEGCNLFIYHLPQE GD +L Q+F+ FGNVISSKV+VDRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:   18 AEDRKLFVGMLNKQQSEDDVRRLFEAFGNIEECTILRGPDGNSKGCAFVKYSSHAEAQAAINALHGSQTMPGASSSLVVKFADTDKERTMRRMQQMAGQMGMFN---PMAI-QFGAYGAYAQALMQQQAAIMASVAQGGYLNPMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSPIGVNGFTGIPAQANGQPAAEAVFANGIHPYP--AQSPTAADP---LQQAYAGVQQYAGPAYPAAY--GQISQAFPQPPPMIPQQQREGPEGCNLFIYHLPQEFGDAELMQMFLPFGNVISSKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 370          

HSP 2 Score: 55.4546 bits (132), Expect = 4.064e-8
Identity = 31/77 (40.26%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  233 KLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVK 463
            KLFVG + +   + ++R +FEAFG I E  ILR    G  KGCAFV +     A+    ALH  + + G +  L VK
Sbjct:   22 KLFVGMLNKQQSEDDVRRLFEAFGNIEECTILRGPD-GNSKGCAFVKYSSHAEAQAAINALHGSQTMPGASSSLVVK 97          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Xenopus
Match: ENSXETT00000047017.3 (pep:known scaffold:JGI_4.2:GL174392.1:6353:37831:1 gene:ENSXETG00000021745.3 transcript:ENSXETT00000047017.3 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 204.527 bits (519), Expect = 2.030e-58
Identity = 153/485 (31.55%), Postives = 233/485 (48.04%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKP------AKNKLAKNSSLNGENQTEEQVFSDERKLFVGM-----------LSKNQTDENVQNMFTKFGKIEE--------CTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIP-INIPYYSQYGTIINPEYNSTIPSNQYIRN-------CNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPPEAV---HRTIVTPGS--LLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLF+GQIPRN  +K+++ IFE FG I+E  +++DK TG HKGCAF+T+  ++SA   Q ALH++K L G++  +   P       K+++   +SL+ ++  E +   +      G            +        V+N+ T    + +         TV++     +  C    +  H    A  N LH + +     SSL+     T        +  Y P L++L+   P ++I  Y  +  +++P    T+P   Y  +       C           + L S      P+ S V  PSS  +    Y+  ++ +P        P+  + P+        H T   P +  L+S  F   Q P +         L          +      GPEGCN+FIYHLPQE  D ++ Q+F+ FGNVIS+KV+VDRATNQSKCFGFVS+D+P  A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    5 DAIKLFIGQIPRNLDEKDLKPIFEQFGKIYELTVIKDKFTGMHKGCAFLTYCARESALKAQSALHEQKTLPGVSTWIPTSPRFSKDNGKSEMLCRTSLSRKDNGERRALGNMGSRVGGFDQGLDGVCGISVYGVGLKAKVRNILTGTKYLHQTVPELQLTLTVMEGLQVRNPEC----YSCHLALLAPSNCLHLALQ---PPSSLLSPSCPT------VPILPYCPHLALLSPSCPTVSILPYCPHLALLSPS-CPTVPILPYCLHLALLSPSCPTVSFLPYCPHLALLSPSCPAVPTQSTVQ-PSSEAI----YTNGLHPYP-----AQSPVAQLDPLQQAYAGMQHYTAAYPAAYGLVSPAF--TQAPAI---------LPQQPPQQQQQRE-----GPEGCNIFIYHLPQEFTDSEILQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPGSAQAAIQAMNGFQIGMKRLKVQLKRPKDA 449          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Mouse
Match: Celf4 (CUGBP, Elav-like family member 4 [Source:MGI Symbol;Acc:MGI:1932407])

HSP 1 Score: 360.918 bits (925), Expect = 6.438e-117
Identity = 209/474 (44.09%), Postives = 280/474 (59.07%), Query Frame = 2
Query:  233 KLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPY--YSQY-----------------GTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMP--SSHPVPMIDYSVPINNF----PQTDQITMKPIV---DIQPIPPEAVHRTIVTPGSLLSYPFLNVQ--IPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            KLF+GQIPRN  +K+++ +FE FG I+E  +L+D+ TG HKGCAF+T+  ++SA   Q ALH++K L GMNRP+QVKPA ++    SS   +  +        RKLFVGML+K Q++++V+ +F  FG IEECT+L+  +GNSKGCAFVK+ +H +A AAINALH SQ M GASSSLVVKFADTDK++ +R++QQ    + + N   P+ IP+  Y  Y                 G  +NP         Q +   N   LAA           + + P++   + P  ++  VP I   + +N F    PQ +       V    I P P  A   T   P   L   +  VQ      YP A+  G ++        +       GPEGCNL IYHLPQE GD +L Q+F+ FGNVISSKV+VDRATNQSKCFGFVS+D+PA A  AI++MNG+ IG KRLKVQLK+PK+A
Sbjct:   55 KLFIGQIPRNLDEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCERESALKAQSALHEQKTLPGMNRPIQVKPADSESRGGSSCLRQPPSH-------RKLFVGMLNKQQSEDDVRRLFEAFGNIEECTILRGPDGNSKGCAFVKYSSHAEAQAAINALHGSQTMPGASSSLVVKFADTDKERTMRRMQQMAGQMGMFN---PMAIPFGAYGAYAQALMQQQAALMASVAQGGYLNPMAAFAAAQMQQMAALNMNGLAA-----------APMTPTSGGSTPPGITAPAVPSIPSPIGVNGFTGLPPQANGQPAAEAVFANGIHPYP--AQSPTAADP---LQQAYAGVQQYAGPAYPAAY--GQISQAFPQPPPMIPQQQREGPEGCNLLIYHLPQEFGDAELMQMFLPFGNVISSKVFVDRATNQSKCFGFVSFDNPASAQTAIQAMNGFQIGMKRLKVQLKRPKDA 500          

HSP 2 Score: 67.0106 bits (162), Expect = 2.882e-11
Identity = 35/95 (36.84%), Postives = 57/95 (60.00%), Query Frame = 2
Query:  536 DERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQ 817
            D  KLF+G + +N  +++++ +F +FGKI E TVLKD+  G  KGCAF+ +     A  A +ALH  + + G +  + VK AD++ +     L+Q
Sbjct:   52 DAIKLFIGQIPRNLDEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCERESALKAQSALHEQKTLPGMNRPIQVKPADSESRGGSSCLRQ 146          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Mouse
Match: Celf3 (CUGBP, Elav-like family member 3 [Source:MGI Symbol;Acc:MGI:1926034])

HSP 1 Score: 357.451 bits (916), Expect = 8.025e-117
Identity = 197/449 (43.88%), Postives = 269/449 (59.91%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPG--SLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLFVGQIPR+  +K+++ IFE FG IFE  +++DK TG HKGCAF+T+  +DSA   Q ALH++K L GMNRP+QVKPA      +S   GE+          RKLFVGML K QTDE+V+ MF  FG I+ECTVL+  +G SKGCAFVKF  H +A AAIN LH+S+ + GASSSLVVKFADT+K++ +R++QQ    L +  S I +    YS Y   +  +  + + ++    +    + A Q+Q +   S       +N +++ P +               P + Q    P+  +Q       H T   P   SL++  F   Q P +              Q     +      GP+GCN+FIYHLPQE  D ++ Q+F+ FG+VIS+KV+VDRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    5 DAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPA------DSESRGED----------RKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMF-SPIALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAIS-------ANGLIATPIT---------------PSSAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSLVAPAF--PQPPALVAQQPPPPPQQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 412          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Mouse
Match: Celf3 (CUGBP, Elav-like family member 3 [Source:MGI Symbol;Acc:MGI:1926034])

HSP 1 Score: 358.221 bits (918), Expect = 1.878e-116
Identity = 205/477 (42.98%), Postives = 283/477 (59.33%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSN----LSSVYPSNSIVSMP--SSHPVPMIDYSVPINNF-PQTDQITMKPIVDIQPIPPEAVH----RTIVTPGSLLSYPFLNVQIPT-VYPNAFS------------------NGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLFVGQIPR+  +K+++ IFE FG IFE  +++DK TG HKGCAF+T+  +DSA   Q ALH++K L GMNRP+QVKPA      +S   G+           RKLFVGML K QTDE+V+ MF  FG I+ECTVL+  +G SKGCAFVKF  H +A AAIN LH+S+ + GASSSLVVKFADT+K++ +R++QQ    L +  S I +    YS Y   +  +  + + ++    +    + A Q+Q +   S      + + PS+   + P  ++ PV  I  ++ +N + P   Q T +P  D   + P  VH    ++   P   L   +  +Q  T  YP A+S                          Q     +      GP+GCN+FIYHLPQE  D ++ Q+F+ FG+VIS+KV+VDRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    5 DAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPA------DSESRGD-----------RKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMF-SPIALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAISANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVNGYSPVPTQPTGQPAPDA--LYPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 461          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Mouse
Match: Celf3 (CUGBP, Elav-like family member 3 [Source:MGI Symbol;Acc:MGI:1926034])

HSP 1 Score: 355.91 bits (912), Expect = 4.064e-115
Identity = 209/503 (41.55%), Postives = 286/503 (56.86%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSN----LSSVYPSNSIVSMPS--SHPVPMIDYSVPINNF-PQTDQITMKPIVD------IQPIPPEA---------------VHRTIV---------TPGSLLSYPFLNVQIPTV-YPNAFS------------------NGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLFVGQIPR+  +K+++ IFE FG IFE  +++DK TG HKGCAF+T+  +DSA   Q ALH++K L GMNRP+QVKPA      +S   GE+          RKLFVGML K QTDE+V+ MF  FG I+ECTVL+  +G SKGCAFVKF  H +A AAIN LH+S+ + GASSSLVVKFADT+K++ +R++QQ    L +  S I +    YS Y   +  +  + + ++    +    + A Q+Q +   S      + + PS+   + P+  + PV  I  ++ +N + P   Q T +P  D      + P P EA                H  +V          P   L   +  +Q  T  YP A+S                          Q     +      GP+GCN+FIYHLPQE  D ++ Q+F+ FG+VIS+KV+VDRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    5 DAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPA------DSESRGED----------RKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMF-SPIALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAISANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVNGYSPVPTQPTGQPAPDALYPNGVHPYPDEALSAERSAGGVPIMSQAHSWLVMLSAAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 490          
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Mouse
Match: Celf6 (CUGBP, Elav-like family member 6 [Source:MGI Symbol;Acc:MGI:1923433])

HSP 1 Score: 341.273 bits (874), Expect = 1.342e-109
Identity = 194/461 (42.08%), Postives = 271/461 (58.79%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSH---PVPMIDYSVPINNFPQ-TDQITMKPIVD------IQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLP----TGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLFVGQIPR   +++++ +FE FG I+E  +L+D+ TG HKGCAF+T+  +DSA   Q ALH++K L GMNRP+QVKPA +          E + E+      RKLFVGML K Q +E+V+ +F  FG IEECTVL+  +G SKGCAFVKF +  +A AAI  LH S+ M GASSSLVVK ADTD+++ +R++QQ    L   +   P+ +     Y T I     + + + Q         +AAQ+Q +  FS +++     +  + P  +    +P +   + +N F   T Q   +P  D      + P P  A   ++  P   L   +  +        +      T+ +Q     + + LP     GPEGCNLFIYHLPQE GD +L Q F+ FG V+S+KV+VDRATNQSKCFGFVS+D+P  A  AI++MNG+ IG KRLKVQLK+PK+A
Sbjct:   44 DAIKLFVGQIPRGLDEQDLKPLFEEFGRIYELTVLKDRLTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPAAS----------EGRGED------RKLFVGMLGKQQGEEDVRRLFQPFGHIEECTVLRSPDGTSKGCAFVKFGSQGEAQAAIQGLHGSRTMTGASSSLVVKLADTDRERALRRMQQMAGQLGAFHP-APLPLGACGAYTTAILQHQAALLAAAQGPGLGQVAAVAAQMQHVAAFSLVAAPLLPAAANTSPGGNGPGALPGLPAPMGVNGFGSLTPQSNGQPGSDTLYNNGVSPYP--AKSPSVADP---LQQAYAGIHHYAAAYPSAYAPASTAFSQ-----QPSALPQQQREGPEGCNLFIYHLPQEFGDAELIQTFLPFGAVVSAKVFVDRATNQSKCFGFVSFDNPTSAQTAIQAMNGFQIGMKRLKVQLKRPKDA 477          
BLAST of CUGBP Elav-like family member 3 vs. UniProt
Match: sp|A0JM51|CELF5_XENTR (CUGBP Elav-like family member 5 OS=Xenopus tropicalis GN=celf5 PE=2 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 1.409e-119
Identity = 217/476 (45.59%), Postives = 287/476 (60.29%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYG--------TIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMID-YSVP------INNFPQTDQI-TMKPIVD------IQPIPPEAVHRTIVTPGSLLSYPFLNV-QIPTVYPNAFSNGNLTSTTQSSTDVKTTPLP-------TGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKE 1561
            +  KLFVGQIPRN  +K+++ +FE FG I+E  +L+D+ TG HKGCAF+T+  +DSA   Q ALH++K L GM RP+QVKPA ++     S  G+           RKLFVGMLSK Q++E V +MF  FG IEEC+VL+  +G+SKGCAFVKF +H +A AAI ALH SQ M GASSSLVVKFADTDK++ +R++QQ +  L I    + + I  YS Y         T+++  + S +  +    +C+       IQQI    NL+ + P+  I      H  P+I   +VP       N FP      +  P +D      I P P ++   T+ +    L   F  V Q   +YP A     LT  T S      TP P        GPEGCNLFIYHLPQE GD +L Q+F+ FGN+ISSKV++DRATNQSKCFGFVS+D+P+ A  AI++MNG+ IG KRLKVQLK+PK+
Sbjct:   45 DAIKLFVGQIPRNLEEKDLKPLFEQFGKIYELTVLKDRYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSE-----SRGGD-----------RKLFVGMLSKQQSEEEVTSMFQAFGSIEECSVLRGPDGSSKGCAFVKFSSHAEAQAAIQALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGIFTPSLALPISPYSAYAQALMQQQTTVLSTSHGSYLSPSVAFPSCH-------IQQIGAV-NLNGL-PAAPITPASGLHSPPVIGTAAVPGLVAPLTNGFPGLVPFPSSHPALDTIYTNSIVPYPAQSPALTVES----LHPSFTGVQQYSAIYPTA----ALTPVTHS------TPQPPPILQQREGPEGCNLFIYHLPQEFGDNELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPSSAQTAIQAMNGFQIGMKRLKVQLKRPKD 481          
BLAST of CUGBP Elav-like family member 3 vs. UniProt
Match: sp|Q08E07|CELF3_BOVIN (CUGBP Elav-like family member 3 OS=Bos taurus GN=CELF3 PE=2 SV=1)

HSP 1 Score: 365.155 bits (936), Expect = 3.616e-118
Identity = 205/472 (43.43%), Postives = 284/472 (60.17%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSN----LSSVYPSNSIVSMPS--SHPVPMIDYSVPINNF-PQTDQITMKPIVDIQPIPPEAVH----RTIVTPGSLLSYPFLNVQIPTVYPNAFS--------------NGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLFVGQIPR+  +K+++ IFE FG IFE  +++DK TG HKGCAF+T+  +DSA   Q ALH++K L GMNRP+QVKPA      +S   GE+          RKLFVGML K QTDE+V+ MF  FG I+ECTVL+  +G SKGCAFVKF  H +A AAIN LH+S+ + GASSSLVVKFADT+K++ +R++QQ    L +  S I +    YS Y   +  +  + + ++    +    + A Q+Q +   +      + + PS+   + P+  + PV  I  ++ +N + P   Q T +P  D   + P  VH    ++   P   L   +  +Q  T YP A+S                      Q     +      GP+GCN+FIYHLPQE  D ++ Q+F+ FG+VIS+KV+VDRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    5 DAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPA------DSESRGED----------RKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMF-SPIALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAINANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVNGYSPVPTQPTGQPAPDA--LYPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAYPAAYSLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 457          
BLAST of CUGBP Elav-like family member 3 vs. UniProt
Match: sp|Q8N6W0|CELF5_HUMAN (CUGBP Elav-like family member 5 OS=Homo sapiens GN=CELF5 PE=1 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 4.245e-117
Identity = 203/462 (43.94%), Postives = 274/462 (59.31%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDY-SVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLP---------------TGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKE 1561
            +  KLFVGQIPR+  +K+++ +FE FG I+E  +L+D  TG HKGCAF+T+  +DSA   Q ALH++K L GM RP+QVKPA +               E     +RKLFVGML+K Q++E+V  +F  FG I+ECTVL+  +G+SKGCAFVKF +HT+A AAI+ALH SQ M GASSSLVVKFADTDK++ +R++QQ +  L IL   + +    YS Y   +  +  + + ++    +         IQQI   S L+ + P+  I      H  P++   +VP    P T+         + P P        V    L+ YP  +  +      AFS   +   T        TP+                 GPEGCNLFIYHLPQE GD +L Q+F+ FGN+ISSKV++DRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+
Sbjct:   43 DAIKLFVGQIPRHLDEKDLKPLFEQFGRIYELTVLKDPYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADS---------------ESRGGRDRKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFSPCHIQQIGAVS-LNGL-PATPIAPASGLHSPPLLGTTAVPGLVAPITNGF-----AGVVPFPGGHPALETVYANGLVPYPAQSPTVAETLHPAFSG--VQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLPQEFGDTELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKD 480          
BLAST of CUGBP Elav-like family member 3 vs. UniProt
Match: sp|Q5SZQ8|CELF3_HUMAN (CUGBP Elav-like family member 3 OS=Homo sapiens GN=CELF3 PE=1 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 5.877e-116
Identity = 205/476 (43.07%), Postives = 284/476 (59.66%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSN----LSSVYPSNSIVSMP--SSHPVPMIDYSVPINNF-PQTDQITMKPIVDIQPIPPEAVH----RTIVTPGSLLSYPFLNVQIPT-VYPNAFS-----------------NGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLFVGQIPR+  +K+++ IFE FG IFE  +++DK TG HKGCAF+T+  +DSA   Q ALH++K L GMNRP+QVKPA      +S   GE+          RKLFVGML K QTDE+V+ MF  FG I+ECTVL+  +G SKGCAFVKF  H +A AAIN LH+S+ + GASSSLVVKFADT+K++ +R++QQ    L +  S I +    YS Y   +  +  + + ++    +    + A Q+Q +   +      + + PS+   + P  ++ PV  I  ++ +N + P   Q T +P  D   + P  VH    ++   P   L   +  +Q  T  YP A+S                         Q     +      GP+GCN+FIYHLPQE  D ++ Q+F+ FG+VIS+KV+VDRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    5 DAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPA------DSESRGED----------RKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMF-SPIALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAINANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVNGYSPVPTQPTGQPAPDA--LYPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 461          
BLAST of CUGBP Elav-like family member 3 vs. UniProt
Match: sp|Q8CIN6|CELF3_MOUSE (CUGBP Elav-like family member 3 OS=Mus musculus GN=Celf3 PE=2 SV=1)

HSP 1 Score: 358.221 bits (918), Expect = 1.462e-115
Identity = 205/477 (42.98%), Postives = 283/477 (59.33%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSN----LSSVYPSNSIVSMP--SSHPVPMIDYSVPINNF-PQTDQITMKPIVDIQPIPPEAVH----RTIVTPGSLLSYPFLNVQIPT-VYPNAFS------------------NGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLFVGQIPR+  +K+++ IFE FG IFE  +++DK TG HKGCAF+T+  +DSA   Q ALH++K L GMNRP+QVKPA      +S   G+           RKLFVGML K QTDE+V+ MF  FG I+ECTVL+  +G SKGCAFVKF  H +A AAIN LH+S+ + GASSSLVVKFADT+K++ +R++QQ    L +  S I +    YS Y   +  +  + + ++    +    + A Q+Q +   S      + + PS+   + P  ++ PV  I  ++ +N + P   Q T +P  D   + P  VH    ++   P   L   +  +Q  T  YP A+S                          Q     +      GP+GCN+FIYHLPQE  D ++ Q+F+ FG+VIS+KV+VDRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    5 DAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPA------DSESRGD-----------RKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMF-SPIALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAISANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVNGYSPVPTQPTGQPAPDA--LYPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 461          
BLAST of CUGBP Elav-like family member 3 vs. TrEMBL
Match: tr|A4V6M1|A4V6M1_DUGJA (Bruno-like protein (Fragment) OS=Dugesia japonica PE=2 SV=1)

HSP 1 Score: 666.381 bits (1718), Expect = 0.000e+0
Identity = 324/401 (80.80%), Postives = 357/401 (89.03%), Query Frame = 2
Query:  437 GMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYY-SQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEAINEMKNFNQMLSSTPDINQVFCSS 1636
            G  RPLQVKPAKN L K +++N  NQ  E + SDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKF+NHTDA AAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQ +PDL+ILNS IPI+IPYY SQ G +INPE NS IP+ Q+I NCNEYILAAQIQQINLFSN+  +YPSNSIVSMPS+HPVPMIDYS+PINN P+TDQ+TMKP++D+Q I  + ++R IVTPGS +SYPFLNVQIPT Y  AF N NL+S  Q+S DVK+TPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKE +N+ KN +Q+L+S  DI QV+CSS
Sbjct:    2 GTRRPLQVKPAKNNLTKKTNMNTLNQLGENIASDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFLNHTDARAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQNLPDLNILNSHIPIHIPYYTSQCGPVINPEMNSAIPTTQFIPNCNEYILAAQIQQINLFSNIPPIYPSNSIVSMPSTHPVPMIDYSIPINNLPKTDQMTMKPVLDVQQITQDNLNRPIVTPGSFMSYPFLNVQIPTGYQAAFPNNNLSSINQNSNDVKSTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKETLNDTKNLSQILTSAADIKQVYCSS 402          

HSP 2 Score: 56.6102 bits (135), Expect = 4.379e-5
Identity = 30/77 (38.96%), Postives = 43/77 (55.84%), Query Frame = 2
Query:  233 KLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVK 463
            KLFVG + +N  D+ ++ +F  FG I E  +L+D + G  KGCAFV F +   A     ALH  + + G +  L VK
Sbjct:   38 KLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKD-QNGNSKGCAFVKFLNHTDARAAINALHASQKMEGASSSLVVK 113          
BLAST of CUGBP Elav-like family member 3 vs. TrEMBL
Match: tr|D5JG67|D5JG67_DUGJA (Bruno 5-like protein OS=Dugesia japonica GN=BRUNOL-5 PE=2 SV=1)

HSP 1 Score: 640.958 bits (1652), Expect = 0.000e+0
Identity = 311/381 (81.63%), Postives = 342/381 (89.76%), Query Frame = 2
Query:  497 LNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYY-SQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEAINEMKNFNQMLSSTPDINQVFCSS 1636
            +N  NQ  E + SDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKF+NHTDA AAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQ +PDL+ILNS IPI+IPYY SQ G +INPE NS IP+ Q+I NCNEYILAAQIQQINLFSN+  +YPSNSIVSMPS+HPVPMIDYS+PINN P+TDQ+TMKP++D+Q I  + ++R IVTPGS +SYPFLNVQIPT Y  AF N NL+S  Q+S DVK+TPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKE +N+ KN +Q+L+S  DI QV+CSS
Sbjct:    1 MNTLNQLGENIASDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFLNHTDARAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQNLPDLNILNSHIPIHIPYYTSQCGPVINPEMNSAIPTTQFIPNCNEYILAAQIQQINLFSNIPPIYPSNSIVSMPSTHPVPMIDYSIPINNLPKTDQMTMKPVLDVQQITQDNLNRPIVTPGSFMSYPFLNVQIPTGYQAAFPNNNLSSINQNSNDVKSTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKETLNDTKNLSQILTSAADIKQVYCSS 381          

HSP 2 Score: 56.6102 bits (135), Expect = 3.820e-5
Identity = 30/77 (38.96%), Postives = 43/77 (55.84%), Query Frame = 2
Query:  233 KLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVK 463
            KLFVG + +N  D+ ++ +F  FG I E  +L+D + G  KGCAFV F +   A     ALH  + + G +  L VK
Sbjct:   17 KLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKD-QNGNSKGCAFVKFLNHTDARAAINALHASQKMEGASSSLVVK 92          
BLAST of CUGBP Elav-like family member 3 vs. TrEMBL
Match: tr|R7TIA4|R7TIA4_CAPTE (Uncharacterized protein OS=Capitella teleta GN=CAPTEDRAFT_183838 PE=4 SV=1)

HSP 1 Score: 385.956 bits (990), Expect = 3.199e-124
Identity = 215/467 (46.04%), Postives = 288/467 (61.67%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIP---------SNQYIRNCNEYILAAQIQQINLFSN---LSSVYPSNSIVS---MPSSHPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQ----IPTVYPNAFSNGNLTSTTQSSTDV-KTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLFVGQIPRN  +K++R IFE FG I+E  +L+D+ TG HKGCAF+T+  +DSA   Q+ALH++K L GMNRP+QVKPA          + E++ E+      RKLFVGML+K Q++E V+ MF+ +G IEECT+L+DQNGNSKGCAFVKF  H DA AAINALH SQ M GASSSLVVKFADT+K++Q+RK+QQ    L +L+   P  +  +  YG     +                +  I      + A+Q+       N    +++ P++   +   +    P  M+  +  +  FP T Q   + ++D  P   +      +  G  L+  +  VQ    I T YP A+          ++T +  TT    GPEGCNLFIYHLPQE GD +L Q+FM FGNVIS+KVY+DRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:   15 DAIKLFVGQIPRNLEEKDLRPIFEEFGQIYELTVLKDRFTGMHKGCAFLTYCARDSALKAQQALHEQKTLPGMNRPIQVKPA----------DSESRAED------RKLFVGMLNKQQSEEEVRQMFSPYGSIEECTILRDQNGNSKGCAFVKFTTHADAQAAINALHGSQTMPGASSSLVVKFADTEKERQLRKMQQMTGPLGLLS---PFALSQFGTYGAYTQQQLVQQQAALMAAAAAQGSYSINPTMSALTASQVPHALAMQNGLSTAAITPTSGASNPAFLQELTPPTMLSPTAAMTAFPMT-QANGQAVMD--PSGIQQYQAQAMAAGDPLTQAYSGVQQYAGIAT-YPAAYGQFQQALAQHAATIIPTTTAQKEGPEGCNLFIYHLPQEFGDAELAQMFMPFGNVISAKVYIDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 458          

HSP 2 Score: 69.3218 bits (168), Expect = 4.492e-9
Identity = 36/94 (38.30%), Postives = 58/94 (61.70%), Query Frame = 2
Query:  533 SDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKL 811
            +D  KLFVG + +N  +++++ +F +FG+I E TVLKD+  G  KGCAF+ +     A  A  ALH  + + G +  + VK AD++ + + RKL
Sbjct:   14 ADAIKLFVGQIPRNLEEKDLRPIFEEFGQIYELTVLKDRFTGMHKGCAFLTYCARDSALKAQQALHEQKTLPGMNRPIQVKPADSESRAEDRKL 107          
BLAST of CUGBP Elav-like family member 3 vs. TrEMBL
Match: tr|B5LEQ6|B5LEQ6_XENLA (RNA binding protein Bruno-like 5 OS=Xenopus laevis GN=celf5 PE=2 SV=1)

HSP 1 Score: 368.237 bits (944), Expect = 4.844e-117
Identity = 215/482 (44.61%), Postives = 283/482 (58.71%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYG--------TIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMID-YSVP------INNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYP-------------FLNV-QIPTVYPNAFSNGNLTSTTQSSTDVKTTPLP-------TGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKE 1561
            +  KLFVGQIPRN  +K+++ +FE FG I+E  +L+D+ TG HKGCAF+T+  +DSA   Q ALH++K L GM RP+QVKPA ++     S  G+           RKLFVGMLSK Q++E V +MF  FG IEEC+VL+  +G+SKGCAFVKF +H +A AAI ALH SQ M GASSSLVVKFADTDK++ +R++QQ +  L I    + + I  YS Y         T+++  + S +  +    +C+       IQQI    NL+ + P+  I      H  P+I   +VP       N FP            + P P        +   S++ YP             F  V Q   +YP A     LT  T S      TP P        GPEGCNLFIYHLPQE GD +L Q+F+ FGN+ISSKV++DRATNQSKCFGFVS+D+P+ A  AI++MNG+ IG KRLKVQLK+PK+
Sbjct:   44 DAIKLFVGQIPRNLEEKDLKPLFEQFGKIYELTVLKDRYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSE-----SRGGD-----------RKLFVGMLSKQQSEEEVTSMFQAFGSIEECSVLRGPDGSSKGCAFVKFSSHAEAQAAIQALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGIFTPSLALPISPYSAYAQALMQQQTTVLSTSHGSYLSPSVAFPSCH-------IQQIGAV-NLNGL-PAAPITPASGLHSPPVIGTAAVPGLVAPLTNGFP-----------GLVPFPSSHPALDTIYTNSIVPYPAQSPLTVESLHPSFTGVQQYSAIYPTA----TLTPVTHS------TPQPPPILQQREGPEGCNLFIYHLPQEFGDNELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPSSAQTAIQAMNGFQIGMKRLKVQLKRPKD 479          
BLAST of CUGBP Elav-like family member 3 vs. TrEMBL
Match: tr|A0A087Y5S6|A0A087Y5S6_POEFO (Uncharacterized protein OS=Poecilia formosa PE=4 SV=2)

HSP 1 Score: 367.081 bits (941), Expect = 5.650e-117
Identity = 207/482 (42.95%), Postives = 287/482 (59.54%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEY---NSTIPSNQYIRNCNEYILAAQIQQIN-------LFSNLSSVYPSNSIVSMP--SSHPVPMIDYSVPINNFP---------QTDQITMKPIVDIQPIPPEAV------------HRTIVTPGS--LLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLFVGQIPRN  +K+++ IFE FG I+E  +++DK TG HKGCAF+T+  ++SA   Q ALH++K L GMNRP+QVKPA      +S   GE+          RKLFVGML K Q+DE+V+ +F  FG IEECTVL+  +G SKGCAFVK+  H +A AAIN+LH S+ M GASSSLVVKFADT+K++ +R++QQ    L I  S + +N P Y+ Y   +N +     + +  + Y+      + A Q+QQ+        + + ++ + PS+   + P  ++ PVP I  ++ +N +          QT+ +    +   Q   P A             H T   P +  L+  PF   Q PT+              +            GPEGCN+FIYHLPQE  D ++ Q+F+ FGNVIS+KV+VDRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    5 DAIKLFVGQIPRNLEEKDLKPIFEQFGKIYELTVIKDKYTGMHKGCAFLTYCARESALKAQSALHEQKTLPGMNRPIQVKPA------DSEGRGED----------RKLFVGMLGKQQSDEDVRRLFEPFGSIEECTVLRGPDGTSKGCAFVKYQGHAEAQAAINSLHGSRTMPGASSSLVVKFADTEKERGLRRMQQVASQLGIF-SPMTLNFPAYNAYTQAVNAQLVQQQALVAQSAYLSPVAT-VAAVQMQQMAALNANGIIATPITPITPSSGTNTPPTIAATPVPAIPPALGVNGYSSVPAPTNGQQTETLYTNGVHTYQAQSPAAALDPLQQAYAGMQHYTAAYPAAYGLVGQPF--PQQPTLVAQQHQQPQQQQQRE------------GPEGCNIFIYHLPQEFSDSEMLQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 454          

HSP 2 Score: 70.4774 bits (171), Expect = 1.633e-9
Identity = 36/94 (38.30%), Postives = 59/94 (62.77%), Query Frame = 2
Query:  533 SDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKL 811
            +D  KLFVG + +N  +++++ +F +FGKI E TV+KD+  G  KGCAF+ +     A  A +ALH  + + G +  + VK AD++ + + RKL
Sbjct:    4 ADAIKLFVGQIPRNLEEKDLKPIFEQFGKIYELTVIKDKYTGMHKGCAFLTYCARESALKAQSALHEQKTLPGMNRPIQVKPADSEGRGEDRKL 97          
The following BLAST results are available for this feature:
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
CELF58.262e-11843.94CUGBP, Elav-like family member 5 [Source:HGNC Symb... [more]
CELF31.144e-11643.07CUGBP, Elav-like family member 3 [Source:HGNC Symb... [more]
CELF36.332e-11543.43CUGBP, Elav-like family member 3 [Source:HGNC Symb... [more]
CELF36.441e-11242.52CUGBP, Elav-like family member 3 [Source:HGNC Symb... [more]
CELF62.090e-11043.46CUGBP, Elav-like family member 6 [Source:HGNC Symb... [more]
back to top
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
unc-751.594e-6752.66Putative RNA-binding protein; Uncharacterized prot... [more]
unc-751.869e-6652.66Putative RNA-binding protein; Uncharacterized prot... [more]
etr-18.217e-5347.94ELAV-Type RNA binding-protein family [Source:RefS... [more]
etr-18.217e-5347.94ELAV-Type RNA binding-protein family [Source:RefS... [more]
etr-18.217e-5347.94ELAV-Type RNA binding-protein family [Source:RefS... [more]
back to top
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
bru-21.632e-9139.66bruno-2 [Source:FlyBase gene name;Acc:FBgn0262475][more]
bru-21.632e-9139.66bruno-2 [Source:FlyBase gene name;Acc:FBgn0262475][more]
bru-23.130e-6138.70bruno-2 [Source:FlyBase gene name;Acc:FBgn0262475][more]
bru-22.616e-5541.28bruno-2 [Source:FlyBase gene name;Acc:FBgn0262475][more]
bru-22.616e-5541.28bruno-2 [Source:FlyBase gene name;Acc:FBgn0262475][more]
back to top
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
celf5a2.107e-11645.45cugbp, Elav-like family member 5a [Source:ZFIN;Acc... [more]
celf5a1.227e-11544.47cugbp, Elav-like family member 5a [Source:ZFIN;Acc... [more]
celf3a3.951e-11441.29cugbp, Elav-like family member 3a [Source:ZFIN;Acc... [more]
celf3b7.086e-11342.98cugbp, Elav-like family member 3b [Source:ZFIN;Acc... [more]
CELF61.257e-9441.75CUGBP, Elav-like family member 6 [Source:HGNC Symb... [more]
back to top
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
celf51.259e-11744.33CUGBP, Elav-like family member 5 [Source:Xenbase;A... [more]
celf51.614e-11443.70CUGBP, Elav-like family member 5 [Source:Xenbase;A... [more]
celf17.127e-8835.19CUGBP, Elav-like family member 1 [Source:Xenbase;A... [more]
celf42.367e-8344.23CUGBP, Elav-like family member 4 [Source:Xenbase;A... [more]
ENSXETT00000047017.32.030e-5831.55pep:known scaffold:JGI_4.2:GL174392.1:6353:37831:1... [more]
back to top
BLAST of CUGBP Elav-like family member 3 vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Celf46.438e-11744.09CUGBP, Elav-like family member 4 [Source:MGI Symbo... [more]
Celf38.025e-11743.88CUGBP, Elav-like family member 3 [Source:MGI Symbo... [more]
Celf31.878e-11642.98CUGBP, Elav-like family member 3 [Source:MGI Symbo... [more]
Celf34.064e-11541.55CUGBP, Elav-like family member 3 [Source:MGI Symbo... [more]
Celf61.342e-10942.08CUGBP, Elav-like family member 6 [Source:MGI Symbo... [more]
back to top
BLAST of CUGBP Elav-like family member 3 vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A0JM51|CELF5_XENTR1.409e-11945.59CUGBP Elav-like family member 5 OS=Xenopus tropica... [more]
sp|Q08E07|CELF3_BOVIN3.616e-11843.43CUGBP Elav-like family member 3 OS=Bos taurus GN=C... [more]
sp|Q8N6W0|CELF5_HUMAN4.245e-11743.94CUGBP Elav-like family member 5 OS=Homo sapiens GN... [more]
sp|Q5SZQ8|CELF3_HUMAN5.877e-11643.07CUGBP Elav-like family member 3 OS=Homo sapiens GN... [more]
sp|Q8CIN6|CELF3_MOUSE1.462e-11542.98CUGBP Elav-like family member 3 OS=Mus musculus GN... [more]
back to top
BLAST of CUGBP Elav-like family member 3 vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|A4V6M1|A4V6M1_DUGJA4.379e-580.80Bruno-like protein (Fragment) OS=Dugesia japonica ... [more]
tr|D5JG67|D5JG67_DUGJA3.820e-581.63Bruno 5-like protein OS=Dugesia japonica GN=BRUNOL... [more]
tr|R7TIA4|R7TIA4_CAPTE3.199e-12446.04Uncharacterized protein OS=Capitella teleta GN=CAP... [more]
tr|B5LEQ6|B5LEQ6_XENLA4.844e-11744.61RNA binding protein Bruno-like 5 OS=Xenopus laevis... [more]
tr|A0A087Y5S6|A0A087Y5S6_POEFO5.650e-11742.95Uncharacterized protein OS=Poecilia formosa PE=4 S... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 7..24
NoneNo IPR availableTMHMMTMhelixcoord: 52..69
NoneNo IPR availableTMHMMTMhelixcoord: 4..21
NoneNo IPR availableTMHMMTMhelixcoord: 15..34
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 29..48
NoneNo IPR availableTMHMMTMhelixcoord: 21..43
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 390..463
e-value: 2.0E-20
score: 83.8
coord: 27..103
e-value: 5.0E-20
score: 82.5
coord: 131..206
e-value: 3.6E-20
score: 83.0
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 132..194
e-value: 3.8E-16
score: 58.5
coord: 391..461
e-value: 9.6E-17
score: 60.4
coord: 28..93
e-value: 6.4E-16
score: 57.8
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 389..467
score: 15.852
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 26..107
score: 16.398
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 130..210
score: 16.449
IPR012677Nucleotide-binding alpha-beta plait domainGENE3DG3DSA:3.30.70.330coord: 24..111
e-value: 1.4E-23
score: 82.7
IPR012677Nucleotide-binding alpha-beta plait domainGENE3DG3DSA:3.30.70.330coord: 112..214
e-value: 5.8E-23
score: 80.6
IPR012677Nucleotide-binding alpha-beta plait domainGENE3DG3DSA:3.30.70.330coord: 361..472
e-value: 1.3E-26
score: 92.6
IPR012677Nucleotide-binding alpha-beta plait domainSUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 23..113
IPR012677Nucleotide-binding alpha-beta plait domainSUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 128..220
coord: 386..469

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0003723RNA binding
GO:00973227SK snRNA binding
Vocabulary: biological process
TermDefinition
GO:0000381regulation of alternative mRNA splicing, via spliceosome
GO:0006397mRNA processing
GO:0007283spermatogenesis
GO:0008380RNA splicing
GO:0030317flagellated sperm motility
GO:0030575nuclear body organization
GO:0048026positive regulation of mRNA splicing, via spliceosome
GO:0098781ncRNA transcription
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0016604nuclear body
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000003Stage 3
PLANA:0000006Stage 6
PLANA:0000005Stage 5
PLANA:0000007Stage 7
PLANA:0000002Stage 2
PLANA:0000004Stage 4
PLANA:0000008Stage 8
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0004517blastomere
PLANA:0000429neoblast compartment
PLANA:0000212blastomere compartment
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001900 ID=SMED30001900|Name=CUGBP Elav-like family member 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1713bp
CTTTTGAGGGAAAAATAATTCTTTTATTAATAATGTTTCATCATTGGAAT
ATAAAATAAAATATTAGGAGAAAACATAAGTTAACCAACAATATTAGCCA
CATATTTCGTTTAATTATTGGTCTATCACTTTTCATTTTAACCAATTGTC
TTGAGATAATGGAGAGTTTATCCTTAATTTTTATTATAAATCACTGGTTT
TGATAGACTTATTAACAATGGAAAATTATTTCAAACTTTTCGTTGGTCAG
ATACCTCGAAATACACCAGATAAAGAAATTAGACTTATTTTTGAAGCTTT
TGGACCAATCTTTGAATTTTTAATTTTAAGGGACAAGAAAACTGGTTTTC
ATAAAGGATGTGCTTTTGTTACATTTTATCATAAAGACTCTGCAGAAAAT
TGTCAAAAGGCGTTACATGACAAGAAAATCCTAAACGGGATGAATCGACC
ACTTCAAGTGAAACCAGCTAAAAATAAGTTAGCAAAAAATTCAAGTTTGA
ATGGGGAAAATCAGACAGAAGAGCAGGTTTTCAGTGATGAAAGGAAATTG
TTTGTTGGAATGTTGAGTAAAAATCAAACTGATGAAAATGTACAAAATAT
GTTCACAAAATTTGGCAAAATCGAAGAGTGCACTGTATTGAAAGACCAAA
ATGGAAATAGTAAAGGATGTGCCTTTGTCAAATTCGTGAACCACACCGAT
GCTTGTGCAGCAATAAACGCTCTTCATGCCAGTCAAAAAATGGAGGGTGC
TTCATCCAGCCTTGTGGTTAAATTTGCTGACACGGATAAACAAAAACAAA
TAAGAAAATTGCAGCAATATATTCCAGATTTAAGCATTTTAAATTCGCGC
ATTCCTATTAATATTCCATACTATTCACAATACGGTACAATAATTAATCC
AGAATATAATTCAACAATTCCTTCAAACCAATATATTCGAAATTGTAACG
AATATATTCTTGCTGCTCAAATTCAACAAATAAATTTGTTTTCTAATTTA
TCATCGGTCTACCCATCTAATTCAATAGTGTCAATGCCATCCAGCCATCC
GGTACCAATGATTGACTATTCTGTTCCTATTAACAACTTTCCACAAACTG
ACCAAATAACAATGAAACCAATTGTTGATATACAGCCAATACCTCCAGAA
GCTGTACACCGAACCATCGTAACTCCAGGATCACTCTTATCATATCCTTT
TCTTAATGTTCAAATTCCTACAGTATATCCAAACGCCTTTTCCAATGGAA
ATTTAACAAGTACAACACAAAGTTCAACAGATGTGAAAACCACTCCTTTG
CCAACAGGTCCTGAAGGCTGCAATCTATTTATTTATCATCTGCCACAAGA
AATTGGTGATTTACAATTATATCAAATTTTTATGCATTTTGGAAACGTTA
TCAGTTCTAAAGTTTATGTTGACAGAGCAACAAATCAAAGCAAATGTTTT
GGATTTGTCAGCTACGATGATCCGGCATGTGCCAATGCCGCCATCAAATC
TATGAATGGATATCATATCGGAACAAAAAGATTAAAAGTTCAGTTAAAAA
AACCAAAAGAAGCAATAAACGAAATGAAAAACTTCAATCAAATGTTATCA
TCAACTCCCGACATAAACCAAGTATTTTGTTCATCCTAATGATTGTGATA
TTTTACAGGATTTTCTCGACCATATTGAAAGCCTGATTGGTGATATGTAA
AATGACCCACCGT
back to top

protein sequence of SMED30001900-orf-1

>SMED30001900-orf-1 ID=SMED30001900-orf-1|Name=SMED30001900-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=474bp
MENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAF
VTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQT
EEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKG
CAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQ
YIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAA
QIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFPQTDQITMK
PIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTT
QSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVY
VDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEAI
NEMKNFNQMLSSTPDINQVFCSS*
back to top
Aliases
The feature 'CUGBP Elav-like family member 3' has the following synonyms
Synonym
bruli-1