Bruno-like protein

Overview
NameBruno-like protein
Smed IDSMED30001900
Uniprot Best hitCUGBP Elav-like family member 5 OS=Xenopus tropicalis OX=8364 GN=celf5 PE=2 SV=1 (E=3.6612e-121)
Length (bp)1713
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Bruno-like protein (SMED30001900) t-SNE clustered cells

Violin plots show distribution of expression levels for Bruno-like protein (SMED30001900) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Bruno-like protein (SMED30001900) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Bruno-like protein (SMED30001900) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Don't be a BOT, type this for download: 2ibMlsIn

 

back to top

Expression Details

Bruno-like protein ( bruli-1 ) is expressed during Stage 2, Stage 3, Stage 4, Stage 5, Stage 6, Stage 7 and Stage 8 in the neoblast and blastomere

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene bruli-1.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and bruli-1(green). piwi-1+ blastomeres co-express the stem cell maintenance gene bruli-1, and virtually all bruli-1+ cells co-express piwi-1. Several fluorescent beads used 3-dimensional reconstruction are visible (red).

Anatomical Expression

PAGE et. al., 2020




SMED30001900

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30001900SMESG000046617.1 dd_Smed_v4_17226_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
headSMED30001900SMESG000046617.1 SmedASXL_015547SmedAsxl_ww_GCZZ01PMID:27034770whole organismasexual adultRNA-sequencing evidence
blastomereSMED30001900SMESG000046617.1 SMED30001900smed_20140614PMID:28072387whole organismStage 3fluorescence in situ hybridization evidence
blastomereSMED30001900SMESG000046617.1 SMED30001900smed_20140614PMID:28072387whole organismStage 5fluorescence in situ hybridization evidence
blastomereSMED30001900SMESG000046617.1 SMED30001900smed_20140614PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
blastomereSMED30001900SMESG000046617.1 SMED30001900smed_20140614PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
embryonic pharynx neuronSMED30001900SMESG000046617.1 SMED30001900smed_20140614PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
blastomereSMED30001900SMESG000046617.1 SMED30001900smed_20140614PMID:28072387whole organismStage 4fluorescence in situ hybridization evidence
blastomereSMED30001900SMESG000046617.1 SMED30001900smed_20140614PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
neoblastSMED30001900SMESG000046617.1 SMED30001900smed_20140614PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
neoblastSMED30001900SMESG000046617.1 SMED30001900smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
embryonic pharynx neuronSMED30001900SMESG000046617.1 SMED30001900smed_20140614PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
blastomereSMED30001900SMESG000046617.1 SMED30001900smed_20140614PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
neoblastSMED30001900SMESG000046617.1 SMED30001900smed_20140614PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
headSMED30001900SMESG000046617.1 SmedASXL_074103SmedAsxl_ww_GCZZ01PMID:27034770whole organismasexual adultRNA-sequencing evidence
headSMED30001900SMESG000046617.1 dd_Smed_v6_17226_0_1dd_Smed_v6PMID:28171748whole organismasexual adultRNA-sequencing evidence
headSMED30001900SMESG000046617.1 OX_Smed_1.0.08002ox_Smed_v2PMID:24238224whole organismasexual adultRNA-sequencing evidence
Homology
BLAST of Bruno-like protein vs. Ensembl Human
Match: CELF5 (CUGBP Elav-like family member 5 [Source:HGNC Symbol;Acc:HGNC:14058])

HSP 1 Score: 362.844 bits (930), Expect = 2.371e-119
Identity = 203/462 (43.94%), Postives = 274/462 (59.31%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDY-SVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLP---------------TGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKE 1561
            +  KLFVGQIPR+  +K+++ +FE FG I+E  +L+D  TG HKGCAF+T+  +DSA   Q ALH++K L GM RP+QVKPA +               E     +RKLFVGML+K Q++E+V  +F  FG I+ECTVL+  +G+SKGCAFVKF +HT+A AAI+ALH SQ M GASSSLVVKFADTDK++ +R++QQ +  L IL   + +    YS Y   +  +  + + ++    +         IQQI   S L+ + P+  I      H  P++   +VP    P T+         + P P        V    L+ YP  +  +      AFS   +   T        TP+                 GPEGCNLFIYHLPQE GD +L Q+F+ FGN+ISSKV++DRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+
Sbjct:   43 DAIKLFVGQIPRHLDEKDLKPLFEQFGRIYELTVLKDPYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADS---------------ESRGGRDRKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFSPCHIQQIGAVS-LNGL-PATPIAPASGLHSPPLLGTTAVPGLVAPITNGF-----AGVVPFPGGHPALETVYANGLVPYPAQSPTVAETLHPAFSG--VQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLPQEFGDTELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKD 480          
BLAST of Bruno-like protein vs. Ensembl Human
Match: CELF3 (CUGBP Elav-like family member 3 [Source:HGNC Symbol;Acc:HGNC:11967])

HSP 1 Score: 359.377 bits (921), Expect = 3.293e-118
Identity = 205/476 (43.07%), Postives = 284/476 (59.66%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSN----LSSVYPSNSIVSMP--SSHPVPMIDYSVPINNF-PQTDQITMKPIVDIQPIPPEAVH----RTIVTPGSLLSYPFLNVQIPT-VYPNAFS-----------------NGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLFVGQIPR+  +K+++ IFE FG IFE  +++DK TG HKGCAF+T+  +DSA   Q ALH++K L GMNRP+QVKPA      +S   GE+          RKLFVGML K QTDE+V+ MF  FG I+ECTVL+  +G SKGCAFVKF  H +A AAIN LH+S+ + GASSSLVVKFADT+K++ +R++QQ    L +  S I +    YS Y   +  +  + + ++    +    + A Q+Q +   +      + + PS+   + P  ++ PV  I  ++ +N + P   Q T +P  D   + P  VH    ++   P   L   +  +Q  T  YP A+S                         Q     +      GP+GCN+FIYHLPQE  D ++ Q+F+ FG+VIS+KV+VDRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    5 DAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPA------DSESRGED----------RKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMF-SPIALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAINANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVNGYSPVPTQPTGQPAPDA--LYPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 461          
BLAST of Bruno-like protein vs. Ensembl Human
Match: CELF3 (CUGBP Elav-like family member 3 [Source:HGNC Symbol;Acc:HGNC:11967])

HSP 1 Score: 353.214 bits (905), Expect = 1.812e-116
Identity = 195/449 (43.43%), Postives = 267/449 (59.47%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPG--SLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLFVGQIPR+  +K+++ IFE FG IFE  +++DK TG HKGCAF+T+  +DSA   Q ALH++K L GMNRP+QVKPA      +S   GE+          RKLFVGML K QTDE+V+ MF  FG I+ECTVL+  +G SKGCAFVKF  H +A AAIN LH+S+ + GASSSLVVKFADT+K++ +R++QQ    L +  S I +    YS Y   +  +  + + ++    +    + A Q+Q +   +       +N +++ P +               P + Q    P+  +Q       H T   P   SL++  F     P                Q     +      GP+GCN+FIYHLPQE  D ++ Q+F+ FG+VIS+KV+VDRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    5 DAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPA------DSESRGED----------RKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMF-SPIALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAIN-------ANGLIATPIT---------------PSSAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSLVAPAFPQ---PPALVAQQPPPPPQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 411          
BLAST of Bruno-like protein vs. Ensembl Human
Match: CELF3 (CUGBP Elav-like family member 3 [Source:HGNC Symbol;Acc:HGNC:11967])

HSP 1 Score: 347.051 bits (889), Expect = 1.981e-113
Identity = 199/468 (42.52%), Postives = 277/468 (59.19%), Query Frame = 2
Query:  248 QIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSN----LSSVYPSNSIVSMP--SSHPVPMIDYSVPINNF-PQTDQITMKPIVDIQPIPPEAVH----RTIVTPGSLLSYPFLNVQIPT-VYPNAFS-----------------NGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            QIPR+  +K+++ IFE FG IFE  +++DK TG HKGCAF+T+  +DSA   Q ALH++K L GMNRP+QVKPA      +S   G+           RKLFVGML K QTDE+V+ MF  FG I+ECTVL+  +G SKGCAFVKF  H +A AAIN LH+S+ + GASSSLVVKFADT+K++ +R++QQ    L +  S I +    YS Y   +  +  + + ++    +    + A Q+Q +   +      + + PS+   + P  ++ PV  I  ++ +N + P   Q T +P  D   + P  VH    ++   P   L   +  +Q  T  YP A+S                         Q     +      GP+GCN+FIYHLPQE  D ++ Q+F+ FG+VIS+KV+VDRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:   15 QIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPA------DSESRGD-----------RKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMF-SPIALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAINANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVNGYSPVPTQPTGQPAPDA--LYPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 462          

HSP 2 Score: 56.9954 bits (136), Expect = 6.483e-8
Identity = 31/77 (40.26%), Postives = 41/77 (53.25%), Query Frame = 2
Query:  233 KLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVK 463
            KLFVG + +   D+++R +FE FG I E  +LR    G  KGCAFV F     A+     LH  + L G +  L VK
Sbjct:   97 KLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPD-GTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVK 172          
BLAST of Bruno-like protein vs. Ensembl Human
Match: CELF6 (CUGBP Elav-like family member 6 [Source:HGNC Symbol;Acc:HGNC:14059])

HSP 1 Score: 342.813 bits (878), Expect = 6.518e-112
Identity = 196/451 (43.46%), Postives = 267/451 (59.20%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIV-SMPSSHP--VPMIDYSVPINNF-PQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLFVGQIPR   +++++ +FE FG I+E  +L+D+ TG HKGCAF+T+  +DSA   Q ALH++K L GMNRP+QVKPA +          E + E+      RKLFVGML K Q +E+V+ +F  FG IEECTVL+  +G SKGCAFVKF +  +A AAI  LH S+ M GASSSLVVK ADTD+++ +R++QQ    L   +   P+ +     Y T I     + + + Q         +AAQ+Q +  FS +++     +   S P S P  +P +   + +N F P T Q   +P  D        ++   ++P     YP            A S G      Q+   +       GPEGCNLFIYHLPQE GD +L Q F+ FG V+S+KV+VDRATNQSKCFGFVS+D+P  A  AI++MNG+ IG KRLKVQLK+PK+A
Sbjct:   44 DAIKLFVGQIPRGLDEQDLKPLFEEFGRIYELTVLKDRLTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPAAS----------EGRGED------RKLFVGMLGKQQGEEDVRRLFQPFGHIEECTVLRSPDGTSKGCAFVKFGSQGEAQAAIRGLHGSRTMAGASSSLVVKLADTDRERALRRMQQMAGHLGAFHP-APLPLGACGAYTTAILQHQAALLAAAQGPGLGPVAAVAAQMQHVAAFSLVAAPLLPAAAANSPPGSGPGTLPGLPAPIGVNGFGPLTPQTNGQPGSDT-------LYNNGLSP-----YP------------AQSPGVADPLQQAYAGMHHY---AGPEGCNLFIYHLPQEFGDAELIQTFLPFGAVVSAKVFVDRATNQSKCFGFVSFDNPTSAQTAIQAMNGFQIGMKRLKVQLKRPKDA 450          
BLAST of Bruno-like protein vs. Ensembl Celegans
Match: unc-75 (Putative RNA-binding protein [Source:UniProtKB/TrEMBL;Acc:G5EE68])

HSP 1 Score: 229.565 bits (584), Expect = 1.258e-68
Identity = 109/207 (52.66%), Postives = 146/207 (70.53%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILN 844
            +  KLFVGQIPRN  +K++R +FE FG I+EF IL+DK TG HKGCAF+T+ H+DSA  CQ  LHD+K L GMNR +QVKPA       S  +           D++KLF+GMLSK Q+++ V+ +F  FG+++E TVL+  +G SKGCAFVK+ +  DA  AI+ALH SQ M GASSSLVVK+ADT+K++Q R++QQ    + +LN
Sbjct:   27 DAIKLFVGQIPRNLEEKDLRHLFEQFGKIYEFTILKDKYTGMHKGCAFLTYCHRDSAVRCQATLHDQKTLPGMNRAMQVKPADTDSRPASPKDK---------MDDKKLFIGMLSKQQSEDEVRALFATFGELDEVTVLRGADGASKGCAFVKYKHGLDAHMAISALHGSQTMPGASSSLVVKYADTEKERQNRRMQQMAAQMGMLN 224          

HSP 2 Score: 53.5286 bits (127), Expect = 3.060e-7
Identity = 23/36 (63.89%), Postives = 29/36 (80.56%), Query Frame = 2
Query: 1451 GFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPK 1558
            GFVSYD+   + AAI +MNG+ IG KRLKVQLK+P+
Sbjct:  423 GFVSYDNIHSSQAAITAMNGFQIGMKRLKVQLKRPR 458          
BLAST of Bruno-like protein vs. Ensembl Celegans
Match: unc-75 (Putative RNA-binding protein [Source:UniProtKB/TrEMBL;Acc:G5EE68])

HSP 1 Score: 228.024 bits (580), Expect = 1.630e-67
Identity = 109/207 (52.66%), Postives = 146/207 (70.53%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILN 844
            +  KLFVGQIPRN  +K++R +FE FG I+EF IL+DK TG HKGCAF+T+ H+DSA  CQ  LHD+K L GMNR +QVKPA       S  +           D++KLF+GMLSK Q+++ V+ +F  FG+++E TVL+  +G SKGCAFVK+ +  DA  AI+ALH SQ M GASSSLVVK+ADT+K++Q R++QQ    + +LN
Sbjct:   27 DAIKLFVGQIPRNLEEKDLRHLFEQFGKIYEFTILKDKYTGMHKGCAFLTYCHRDSAVRCQATLHDQKTLPGMNRAMQVKPADTDSRPASPKDK---------MDDKKLFIGMLSKQQSEDEVRALFATFGELDEVTVLRGADGASKGCAFVKYKHGLDAHMAISALHGSQTMPGASSSLVVKYADTEKERQNRRMQQMAAQMGMLN 224          

HSP 2 Score: 135.576 bits (340), Expect = 6.540e-34
Identity = 58/84 (69.05%), Postives = 72/84 (85.71%), Query Frame = 2
Query: 1307 GPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPK 1558
            GP+GCNLFIYHLPQE GD +L Q+F  FG+++S+KV+VDRATNQSKCFGFVSYD+   + AAI +MNG+ IG KRLKVQLK+P+
Sbjct:  425 GPDGCNLFIYHLPQEFGDAELIQMFAPFGHIVSAKVFVDRATNQSKCFGFVSYDNIHSSQAAITAMNGFQIGMKRLKVQLKRPR 508          
BLAST of Bruno-like protein vs. Ensembl Celegans
Match: etr-1 (ELAV-Type RNA binding-protein family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR37])

HSP 1 Score: 190.66 bits (483), Expect = 1.380e-53
Identity = 93/194 (47.94%), Postives = 124/194 (63.92%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIR 805
            +  K+FVGQIPR   + + R +FE +G +F   ILRDK T   KGC FVTFYH+  A   Q ALH+ K++ GM+ P+Q+KPA            EN+       +ERKLF+G LSK   +EN++ +F KFG IE+C+VL+DQ+G S+GCAFV F N + A  A   +H SQ MEG S+ LVVKFADT K K ++
Sbjct:   53 DAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQMKPADT----------ENR-------NERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCSAPLVVKFADTQKDKDVK 229          

HSP 2 Score: 112.849 bits (281), Expect = 2.963e-26
Identity = 49/81 (60.49%), Postives = 62/81 (76.54%), Query Frame = 2
Query: 1307 GPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLK 1549
            GP+G NLFIYHLPQ+ GD  L   F  FG ++S+KV++D+ TN SKCFGFVSY++   A  AI +MNG+ IG+KRLKVQLK
Sbjct:  424 GPDGANLFIYHLPQDFGDSDLINTFAPFGGILSAKVFIDKVTNLSKCFGFVSYENAQSATNAISAMNGFQIGSKRLKVQLK 504          

HSP 3 Score: 62.003 bits (149), Expect = 6.697e-10
Identity = 36/96 (37.50%), Postives = 54/96 (56.25%), Query Frame = 2
Query:  221 ENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPA---KNKLAKNSSL 499
             N  KLF+GQ+ +   ++ +R IF  FG I +  +LRD+  G  +GCAFVTF ++  A    K +H  + + G + PL VK A   K+K  K  S+
Sbjct:  139 RNERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQD-GKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCSAPLVVKFADTQKDKDVKTKSM 233          

HSP 4 Score: 61.6178 bits (148), Expect = 9.492e-10
Identity = 36/102 (35.29%), Postives = 59/102 (57.84%), Query Frame = 2
Query:  533 SDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGN-SKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLS 835
            +D  K+FVG + +   + + + +F K+G +  C +L+D++   SKGC FV F +  DA  A  ALH  + +EG    + +K ADT+ + + RKL  +I  LS
Sbjct:   52 TDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQMKPADTENRNE-RKL--FIGQLS 150          
BLAST of Bruno-like protein vs. Ensembl Celegans
Match: etr-1 (ELAV-Type RNA binding-protein family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR37])

HSP 1 Score: 190.66 bits (483), Expect = 1.380e-53
Identity = 93/194 (47.94%), Postives = 124/194 (63.92%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIR 805
            +  K+FVGQIPR   + + R +FE +G +F   ILRDK T   KGC FVTFYH+  A   Q ALH+ K++ GM+ P+Q+KPA            EN+       +ERKLF+G LSK   +EN++ +F KFG IE+C+VL+DQ+G S+GCAFV F N + A  A   +H SQ MEG S+ LVVKFADT K K ++
Sbjct:   53 DAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQMKPADT----------ENR-------NERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCSAPLVVKFADTQKDKDVK 229          

HSP 2 Score: 112.849 bits (281), Expect = 2.963e-26
Identity = 49/81 (60.49%), Postives = 62/81 (76.54%), Query Frame = 2
Query: 1307 GPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLK 1549
            GP+G NLFIYHLPQ+ GD  L   F  FG ++S+KV++D+ TN SKCFGFVSY++   A  AI +MNG+ IG+KRLKVQLK
Sbjct:  424 GPDGANLFIYHLPQDFGDSDLINTFAPFGGILSAKVFIDKVTNLSKCFGFVSYENAQSATNAISAMNGFQIGSKRLKVQLK 504          

HSP 3 Score: 62.003 bits (149), Expect = 6.697e-10
Identity = 36/96 (37.50%), Postives = 54/96 (56.25%), Query Frame = 2
Query:  221 ENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPA---KNKLAKNSSL 499
             N  KLF+GQ+ +   ++ +R IF  FG I +  +LRD+  G  +GCAFVTF ++  A    K +H  + + G + PL VK A   K+K  K  S+
Sbjct:  139 RNERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQD-GKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCSAPLVVKFADTQKDKDVKTKSM 233          

HSP 4 Score: 61.6178 bits (148), Expect = 9.492e-10
Identity = 36/102 (35.29%), Postives = 59/102 (57.84%), Query Frame = 2
Query:  533 SDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGN-SKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLS 835
            +D  K+FVG + +   + + + +F K+G +  C +L+D++   SKGC FV F +  DA  A  ALH  + +EG    + +K ADT+ + + RKL  +I  LS
Sbjct:   52 TDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQMKPADTENRNE-RKL--FIGQLS 150          
BLAST of Bruno-like protein vs. Ensembl Celegans
Match: etr-1 (ELAV-Type RNA binding-protein family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR37])

HSP 1 Score: 190.66 bits (483), Expect = 1.380e-53
Identity = 93/194 (47.94%), Postives = 124/194 (63.92%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIR 805
            +  K+FVGQIPR   + + R +FE +G +F   ILRDK T   KGC FVTFYH+  A   Q ALH+ K++ GM+ P+Q+KPA            EN+       +ERKLF+G LSK   +EN++ +F KFG IE+C+VL+DQ+G S+GCAFV F N + A  A   +H SQ MEG S+ LVVKFADT K K ++
Sbjct:   53 DAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQMKPADT----------ENR-------NERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCSAPLVVKFADTQKDKDVK 229          

HSP 2 Score: 112.849 bits (281), Expect = 2.963e-26
Identity = 49/81 (60.49%), Postives = 62/81 (76.54%), Query Frame = 2
Query: 1307 GPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLK 1549
            GP+G NLFIYHLPQ+ GD  L   F  FG ++S+KV++D+ TN SKCFGFVSY++   A  AI +MNG+ IG+KRLKVQLK
Sbjct:  424 GPDGANLFIYHLPQDFGDSDLINTFAPFGGILSAKVFIDKVTNLSKCFGFVSYENAQSATNAISAMNGFQIGSKRLKVQLK 504          

HSP 3 Score: 62.003 bits (149), Expect = 6.697e-10
Identity = 36/96 (37.50%), Postives = 54/96 (56.25%), Query Frame = 2
Query:  221 ENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPA---KNKLAKNSSL 499
             N  KLF+GQ+ +   ++ +R IF  FG I +  +LRD+  G  +GCAFVTF ++  A    K +H  + + G + PL VK A   K+K  K  S+
Sbjct:  139 RNERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQD-GKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCSAPLVVKFADTQKDKDVKTKSM 233          

HSP 4 Score: 61.6178 bits (148), Expect = 9.492e-10
Identity = 36/102 (35.29%), Postives = 59/102 (57.84%), Query Frame = 2
Query:  533 SDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGN-SKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLS 835
            +D  K+FVG + +   + + + +F K+G +  C +L+D++   SKGC FV F +  DA  A  ALH  + +EG    + +K ADT+ + + RKL  +I  LS
Sbjct:   52 TDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQMKPADTENRNE-RKL--FIGQLS 150          
BLAST of Bruno-like protein vs. Ensembl Fly
Match: bru2 (gene:FBgn0262475 transcript:FBtr0304859)

HSP 1 Score: 300.827 bits (769), Expect = 8.430e-93
Identity = 184/464 (39.66%), Postives = 254/464 (54.74%), Query Frame = 2
Query:  230 FKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTI------PSNQYIRNCNEYILAA--QIQQINLFSNL-SSVYPSNSIVSMPSS-HPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNL---------TSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
             K+FVGQIP+   +  +R +FE FGP+    +LRDK T   +GC FVT+Y + +A   Q ALH+ K L+GM+ P+Q+KPA          + EN+       +ERKLFVGML+K  T+ +V+ +FT  G IEECTVL+DQ G SKGCAFV F    +A  AI ALH SQ MEG S+ LVVKFADT K+K  +K+QQ       +++   IN P  +  G    P  N+        PS           LAA  Q+QQ    +   +++ P NS  ++ +S  P  +   +           +   P         + +H   ++P   L  P       +   +  +NG           TS  Q++    T     GP+G NLFIYHLPQE  D  L   F+ FGNV+S+KV++D+ TN SKCFGFVSYD+P  ANAAI++M+G+ IG+KRLKVQLK+ K+A
Sbjct:  295 IKMFVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRKAALRAQDALHNIKTLDGMHHPIQMKPA----------DSENR-------NERKLFVGMLNKKYTEADVRQLFTGHGTIEECTVLRDQAGQSKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPLVVKFADTQKEKDQKKMQQ-------IHAFCGINTPSGATAGA-ATPTINAATALIAAPPSAGRTNPSMAAALAAVPQVQQAGSAATAPTTLVPLNSTTALSASLTPNLLATNAAHQGAAAAAAYLGADPAAAAHLQLYQQLHGYGLSPAHYLPGPPNAADPYSSSLSGLTNGAAYGAASQPVTTSALQAAAAGVTGKQIEGPDGSNLFIYHLPQEFIDTDLASTFLPFGNVLSAKVFIDKQTNLSKCFGFVSYDNPHSANAAIQAMHGFQIGSKRLKVQLKRSKDA 733          

HSP 2 Score: 65.0846 bits (157), Expect = 1.217e-10
Identity = 36/90 (40.00%), Postives = 50/90 (55.56%), Query Frame = 2
Query:  221 ENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKN 490
             N  KLFVG + +   + ++R +F   G I E  +LRD + G  KGCAFVTF  K +A    KALH  + + G + PL VK A  +  K+
Sbjct:  379 RNERKLFVGMLNKKYTEADVRQLFTGHGTIEECTVLRD-QAGQSKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPLVVKFADTQKEKD 467          

HSP 3 Score: 55.4546 bits (132), Expect = 1.048e-7
Identity = 31/99 (31.31%), Postives = 55/99 (55.56%), Query Frame = 2
Query:  518 EEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKL 811
            ++Q  +D  K+FVG + K   +  ++ MF +FG +    VL+D+    S+GC FV +     A  A +ALH  + ++G    + +K AD++ + + RKL
Sbjct:  287 KDQPDADNIKMFVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRKAALRAQDALHNIKTLDGMHHPIQMKPADSENRNE-RKL 384          
BLAST of Bruno-like protein vs. Ensembl Fly
Match: bru2 (gene:FBgn0262475 transcript:FBtr0332232)

HSP 1 Score: 300.827 bits (769), Expect = 8.430e-93
Identity = 184/464 (39.66%), Postives = 254/464 (54.74%), Query Frame = 2
Query:  230 FKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTI------PSNQYIRNCNEYILAA--QIQQINLFSNL-SSVYPSNSIVSMPSS-HPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNL---------TSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
             K+FVGQIP+   +  +R +FE FGP+    +LRDK T   +GC FVT+Y + +A   Q ALH+ K L+GM+ P+Q+KPA          + EN+       +ERKLFVGML+K  T+ +V+ +FT  G IEECTVL+DQ G SKGCAFV F    +A  AI ALH SQ MEG S+ LVVKFADT K+K  +K+QQ       +++   IN P  +  G    P  N+        PS           LAA  Q+QQ    +   +++ P NS  ++ +S  P  +   +           +   P         + +H   ++P   L  P       +   +  +NG           TS  Q++    T     GP+G NLFIYHLPQE  D  L   F+ FGNV+S+KV++D+ TN SKCFGFVSYD+P  ANAAI++M+G+ IG+KRLKVQLK+ K+A
Sbjct:  295 IKMFVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRKAALRAQDALHNIKTLDGMHHPIQMKPA----------DSENR-------NERKLFVGMLNKKYTEADVRQLFTGHGTIEECTVLRDQAGQSKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPLVVKFADTQKEKDQKKMQQ-------IHAFCGINTPSGATAGA-ATPTINAATALIAAPPSAGRTNPSMAAALAAVPQVQQAGSAATAPTTLVPLNSTTALSASLTPNLLATNAAHQGAAAAAAYLGADPAAAAHLQLYQQLHGYGLSPAHYLPGPPNAADPYSSSLSGLTNGAAYGAASQPVTTSALQAAAAGVTGKQIEGPDGSNLFIYHLPQEFIDTDLASTFLPFGNVLSAKVFIDKQTNLSKCFGFVSYDNPHSANAAIQAMHGFQIGSKRLKVQLKRSKDA 733          

HSP 2 Score: 65.0846 bits (157), Expect = 1.217e-10
Identity = 36/90 (40.00%), Postives = 50/90 (55.56%), Query Frame = 2
Query:  221 ENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKN 490
             N  KLFVG + +   + ++R +F   G I E  +LRD + G  KGCAFVTF  K +A    KALH  + + G + PL VK A  +  K+
Sbjct:  379 RNERKLFVGMLNKKYTEADVRQLFTGHGTIEECTVLRD-QAGQSKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPLVVKFADTQKEKD 467          

HSP 3 Score: 55.4546 bits (132), Expect = 1.048e-7
Identity = 31/99 (31.31%), Postives = 55/99 (55.56%), Query Frame = 2
Query:  518 EEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKL 811
            ++Q  +D  K+FVG + K   +  ++ MF +FG +    VL+D+    S+GC FV +     A  A +ALH  + ++G    + +K AD++ + + RKL
Sbjct:  287 KDQPDADNIKMFVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRKAALRAQDALHNIKTLDGMHHPIQMKPADSENRNE-RKL 384          
BLAST of Bruno-like protein vs. Ensembl Fly
Match: bru2 (gene:FBgn0262475 transcript:FBtr0304863)

HSP 1 Score: 209.534 bits (532), Expect = 2.475e-62
Identity = 137/354 (38.70%), Postives = 188/354 (53.11%), Query Frame = 2
Query:  560 MLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTI------PSNQYIRNCNEYILAA--QIQQINLFSNL-SSVYPSNSIVSMPSS-HPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNL---------TSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            ML+K  T+ +V+ +FT  G IEECTVL+DQ G SKGCAFV F    +A  AI ALH SQ MEG S+ LVVKFADT K+K  +K+QQ       +++   IN P  +  G    P  N+        PS           LAA  Q+QQ    +   +++ P NS  ++ +S  P  +   +           +   P         + +H   ++P   L  P       +   +  +NG           TS  Q++    T     GP+G NLFIYHLPQE  D  L   F+ FGNV+S+KV++D+ TN SKCFGFVSYD+P  ANAAI++M+G+ IG+KRLKVQLK+ K+A
Sbjct:    1 MLNKKYTEADVRQLFTGHGTIEECTVLRDQAGQSKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPLVVKFADTQKEKDQKKMQQ-------IHAFCGINTPSGATAGAA-TPTINAATALIAAPPSAGRTNPSMAAALAAVPQVQQAGSAATAPTTLVPLNSTTALSASLTPNLLATNAAHQGAAAAAAYLGADPAAAAHLQLYQQLHGYGLSPAHYLPGPPNAADPYSSSLSGLTNGAAYGAASQPVTTSALQAAAAGVTGKQIEGPDGSNLFIYHLPQEFIDTDLASTFLPFGNVLSAKVFIDKQTNLSKCFGFVSYDNPHSANAAIQAMHGFQIGSKRLKVQLKRSKDA 346          

HSP 2 Score: 55.8398 bits (133), Expect = 4.694e-8
Identity = 30/74 (40.54%), Postives = 42/74 (56.76%), Query Frame = 2
Query:  269 DKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKN 490
            + ++R +F   G I E  +LRD+  G  KGCAFVTF  K +A    KALH  + + G + PL VK A  +  K+
Sbjct:    8 EADVRQLFTGHGTIEECTVLRDQ-AGQSKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPLVVKFADTQKEKD 80          
BLAST of Bruno-like protein vs. Ensembl Fly
Match: bru2 (gene:FBgn0262475 transcript:FBtr0332234)

HSP 1 Score: 200.29 bits (508), Expect = 5.209e-56
Identity = 116/281 (41.28%), Postives = 159/281 (56.58%), Query Frame = 2
Query:  230 FKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTI------PSNQYIRNCNEYILAA--QIQQINLFSNL-SSVYPSNSIVSMPSS 1045
             K+FVGQIP+   +  +R +FE FGP+    +LRDK T   +GC FVT+Y + +A   Q ALH+ K L+GM+ P+Q+KPA          + EN+       +ERKLFVGML+K  T+ +V+ +FT  G IEECTVL+DQ G SKGCAFV F    +A  AI ALH SQ MEG S+ LVVKFADT K+K  +K+QQ       +++   IN P  +  G    P  N+        PS           LAA  Q+QQ    +   +++ P NS  ++ +S
Sbjct:  295 IKMFVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRKAALRAQDALHNIKTLDGMHHPIQMKPA----------DSENR-------NERKLFVGMLNKKYTEADVRQLFTGHGTIEECTVLRDQAGQSKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPLVVKFADTQKEKDQKKMQQ-------IHAFCGINTPSGATAGA-ATPTINAATALIAAPPSAGRTNPSMAAALAAVPQVQQAGSAATAPTTLVPLNSTTALSAS 550          

HSP 2 Score: 65.855 bits (159), Expect = 6.706e-11
Identity = 36/90 (40.00%), Postives = 50/90 (55.56%), Query Frame = 2
Query:  221 ENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKN 490
             N  KLFVG + +   + ++R +F   G I E  +LRD + G  KGCAFVTF  K +A    KALH  + + G + PL VK A  +  K+
Sbjct:  379 RNERKLFVGMLNKKYTEADVRQLFTGHGTIEECTVLRD-QAGQSKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPLVVKFADTQKEKD 467          

HSP 3 Score: 55.8398 bits (133), Expect = 7.471e-8
Identity = 31/99 (31.31%), Postives = 55/99 (55.56%), Query Frame = 2
Query:  518 EEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKL 811
            ++Q  +D  K+FVG + K   +  ++ MF +FG +    VL+D+    S+GC FV +     A  A +ALH  + ++G    + +K AD++ + + RKL
Sbjct:  287 KDQPDADNIKMFVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRKAALRAQDALHNIKTLDGMHHPIQMKPADSENRNE-RKL 384          
BLAST of Bruno-like protein vs. Ensembl Fly
Match: bru2 (gene:FBgn0262475 transcript:FBtr0304862)

HSP 1 Score: 200.29 bits (508), Expect = 5.209e-56
Identity = 116/281 (41.28%), Postives = 159/281 (56.58%), Query Frame = 2
Query:  230 FKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTI------PSNQYIRNCNEYILAA--QIQQINLFSNL-SSVYPSNSIVSMPSS 1045
             K+FVGQIP+   +  +R +FE FGP+    +LRDK T   +GC FVT+Y + +A   Q ALH+ K L+GM+ P+Q+KPA          + EN+       +ERKLFVGML+K  T+ +V+ +FT  G IEECTVL+DQ G SKGCAFV F    +A  AI ALH SQ MEG S+ LVVKFADT K+K  +K+QQ       +++   IN P  +  G    P  N+        PS           LAA  Q+QQ    +   +++ P NS  ++ +S
Sbjct:  295 IKMFVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRKAALRAQDALHNIKTLDGMHHPIQMKPA----------DSENR-------NERKLFVGMLNKKYTEADVRQLFTGHGTIEECTVLRDQAGQSKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPLVVKFADTQKEKDQKKMQQ-------IHAFCGINTPSGATAGA-ATPTINAATALIAAPPSAGRTNPSMAAALAAVPQVQQAGSAATAPTTLVPLNSTTALSAS 550          

HSP 2 Score: 65.855 bits (159), Expect = 6.706e-11
Identity = 36/90 (40.00%), Postives = 50/90 (55.56%), Query Frame = 2
Query:  221 ENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKN 490
             N  KLFVG + +   + ++R +F   G I E  +LRD + G  KGCAFVTF  K +A    KALH  + + G + PL VK A  +  K+
Sbjct:  379 RNERKLFVGMLNKKYTEADVRQLFTGHGTIEECTVLRD-QAGQSKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPLVVKFADTQKEKD 467          

HSP 3 Score: 55.8398 bits (133), Expect = 7.471e-8
Identity = 31/99 (31.31%), Postives = 55/99 (55.56%), Query Frame = 2
Query:  518 EEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKL 811
            ++Q  +D  K+FVG + K   +  ++ MF +FG +    VL+D+    S+GC FV +     A  A +ALH  + ++G    + +K AD++ + + RKL
Sbjct:  287 KDQPDADNIKMFVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRKAALRAQDALHNIKTLDGMHHPIQMKPADSENRNE-RKL 384          
BLAST of Bruno-like protein vs. Ensembl Zebrafish
Match: celf5a (cugbp, Elav-like family member 5a [Source:ZFIN;Acc:ZDB-GENE-050208-746])

HSP 1 Score: 359.377 bits (921), Expect = 6.783e-118
Identity = 210/462 (45.45%), Postives = 281/462 (60.82%), Query Frame = 2
Query:  221 ENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQ--YIRNCNEYILAAQIQQINLFSNLSSVYPSN-SIVSMPSSHPVPMIDYSVP------INNFPQT-DQITMKPIVD---IQPIPPEAVHRTIVTPGSLLSYPFLNVQIPT-VYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            ++  KLF+GQIPRN  +K+++ +FE FG I E  +L+D+ TG HKGCAF+T+  ++SA   Q ALH++K L GM RP+QVKPA      +S   G+           RKLFVGML+K QT+E+V  +F  +G IEECTVL+  +GNSKGCAFVKF  H +A +AI+ALH SQ M GASSSLVVKFADTDK++ IR++QQ +    I N  I +    YS Y   +  +  + + ++   Y+     +    QI Q+    N++S+ P+  + VS  SS P  +   +VP      +N F     Q    P V+      +PP +      T    L   F  VQ  T +YP         S  Q    ++      GPEGCNLFIYHLPQE GD +L Q+F+ FG VISSKV++DRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:   63 QDAIKLFIGQIPRNLEEKDLKPLFEQFGKIHELTVLKDRYTGMHKGCAFLTYCARESAIKAQNALHEQKTLPGMTRPIQVKPA------DSESRGD-----------RKLFVGMLNKQQTEEDVYRLFEPYGVIEECTVLRGPDGNSKGCAFVKFSTHAEAQSAISALHGSQTMPGASSSLVVKFADTDKERTIRRMQQMVGQFGIFNPAIALPFSTYSTYAHALMQQQAALMAASHGGYLAPSVAFP-TTQIHQMGAL-NINSLPPTPMTPVSGLSSPPANITTSAVPSIVTPIVNGFTSIPHQPNGHPAVEAVYTNGLPPYSTQSP--TAADTLQQAFTGVQQYTAIYPATTLTPIGQSLPQPPQVIQQQQQREGPEGCNLFIYHLPQEFGDNELMQMFLPFGTVISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 503          
BLAST of Bruno-like protein vs. Ensembl Zebrafish
Match: celf5a (cugbp, Elav-like family member 5a [Source:ZFIN;Acc:ZDB-GENE-050208-746])

HSP 1 Score: 358.221 bits (918), Expect = 4.049e-117
Identity = 209/470 (44.47%), Postives = 282/470 (60.00%), Query Frame = 2
Query:  221 ENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQ--YIRNCNEYILAAQIQQINLFSNLSSVYPS---------NSIVSMPSSHPVPMIDYSVP------INNFPQT-DQITMKPIVD---IQPIPPEAVHRTIVTPGSLLSYPFLNVQIPT-VYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            ++  KLF+GQIPRN  +K+++ +FE FG I E  +L+D+ TG HKGCAF+T+  ++SA   Q ALH++K L GM RP+QVKPA      +S   GE+          RKLFVGML+K QT+E+V  +F  +G IEECTVL+  +GNSKGCAFVKF  H +A +AI+ALH SQ M GASSSLVVKFADTDK++ IR++QQ +    I N  I +    YS Y   +  +  + + ++   Y+     +    QI Q+    N++S+ P+         +  ++  SS P  +   +VP      +N F     Q    P V+      +PP +      T    L   F  VQ  T +YP         S  Q    ++      GPEGCNLFIYHLPQE GD +L Q+F+ FG VISSKV++DRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:   75 QDAIKLFIGQIPRNLEEKDLKPLFEQFGKIHELTVLKDRYTGMHKGCAFLTYCARESAIKAQNALHEQKTLPGMTRPIQVKPA------DSESRGED----------RKLFVGMLNKQQTEEDVYRLFEPYGVIEECTVLRGPDGNSKGCAFVKFSTHAEAQSAISALHGSQTMPGASSSLVVKFADTDKERTIRRMQQMVGQFGIFNPAIALPFSTYSTYAHALMQQQAALMAASHGGYLAPSVAFP-TTQIHQMGAL-NINSLPPTPMTPVSGEFHQTLAGLSSPPANITTSAVPSIVTPIVNGFTSIPHQPNGHPAVEAVYTNGLPPYSTQSP--TAADTLQQAFTGVQQYTAIYPATTLTPIGQSLPQPPQVIQQQQQREGPEGCNLFIYHLPQEFGDNELMQMFLPFGTVISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 524          
BLAST of Bruno-like protein vs. Ensembl Zebrafish
Match: celf3a (cugbp, Elav-like family member 3a [Source:NCBI gene;Acc:57922])

HSP 1 Score: 351.673 bits (901), Expect = 1.270e-115
Identity = 199/482 (41.29%), Postives = 293/482 (60.79%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQIN-------LFSNLSSVYPSNSIVSMP--SSHPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPP----EAVHRTIVTPGSLLSYPFLNVQIPTVYP--NAFSN-GNLTSTTQSSTDVKTTPLP-------------------TGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLF+GQIPRN  +K+++ IFE FG I+E  +++DK TG HKGCAF+T+  ++SA   Q ALH++K L GMNRP+QVKPA      +S   G+           RKLFVGML K  +D +V+ MF  FG IEECTVL+  +G SKGCAFVK+ ++ +A AAI+ALH S+ + GASSSLVVKFADT+K++ IR++QQ    L ++ S + +++  Y+ Y   +  +  + +  + Y+      + A Q+QQ+        + + ++S+ PS+   + P  ++ PVP +   + +N++P              P+P     ++    + T G    +P+   Q P + P   A++   + T+T  ++  +   P P                    GPEGCN+FIYHLPQE  D ++ Q+F+ FGNVIS+KV+VDRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    5 DAIKLFIGQIPRNLEEKDLKPIFEQFGKIYELTVIKDKYTGMHKGCAFLTYCARESALKAQNALHEQKTLPGMNRPIQVKPA------DSEGRGD-----------RKLFVGMLGKQLSDADVRKMFEPFGSIEECTVLRGPDGASKGCAFVKYQSNAEAQAAISALHGSRTLPGASSSLVVKFADTEKERGIRRMQQVASQLGVI-SPMSLHLGAYNAYTQALV-QQQALVAQSAYLSPVAT-VAAVQMQQLAALNPSSIIATPIASITPSSGTSTPPTIAATPVPALPPPIAVNSYP--------------PVPAAPNGQSASEALYTNGV---HPY-QAQSPALDPLQQAYTGMQHYTATYPAAYGLVGQPFPHQPTLVAQQPQQPQQLQQREGPEGCNIFIYHLPQEFTDSEMLQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 448          

HSP 2 Score: 68.1662 bits (165), Expect = 1.028e-11
Identity = 36/94 (38.30%), Postives = 58/94 (61.70%), Query Frame = 2
Query:  533 SDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKL 811
            +D  KLF+G + +N  +++++ +F +FGKI E TV+KD+  G  KGCAF+ +     A  A NALH  + + G +  + VK AD++ +   RKL
Sbjct:    4 ADAIKLFIGQIPRNLEEKDLKPIFEQFGKIYELTVIKDKYTGMHKGCAFLTYCARESALKAQNALHEQKTLPGMNRPIQVKPADSEGRGD-RKL 96          
BLAST of Bruno-like protein vs. Ensembl Zebrafish
Match: celf3a (cugbp, Elav-like family member 3a [Source:NCBI gene;Acc:57922])

HSP 1 Score: 351.673 bits (901), Expect = 1.270e-115
Identity = 199/482 (41.29%), Postives = 293/482 (60.79%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQIN-------LFSNLSSVYPSNSIVSMP--SSHPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPP----EAVHRTIVTPGSLLSYPFLNVQIPTVYP--NAFSN-GNLTSTTQSSTDVKTTPLP-------------------TGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLF+GQIPRN  +K+++ IFE FG I+E  +++DK TG HKGCAF+T+  ++SA   Q ALH++K L GMNRP+QVKPA      +S   G+           RKLFVGML K  +D +V+ MF  FG IEECTVL+  +G SKGCAFVK+ ++ +A AAI+ALH S+ + GASSSLVVKFADT+K++ IR++QQ    L ++ S + +++  Y+ Y   +  +  + +  + Y+      + A Q+QQ+        + + ++S+ PS+   + P  ++ PVP +   + +N++P              P+P     ++    + T G    +P+   Q P + P   A++   + T+T  ++  +   P P                    GPEGCN+FIYHLPQE  D ++ Q+F+ FGNVIS+KV+VDRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    5 DAIKLFIGQIPRNLEEKDLKPIFEQFGKIYELTVIKDKYTGMHKGCAFLTYCARESALKAQNALHEQKTLPGMNRPIQVKPA------DSEGRGD-----------RKLFVGMLGKQLSDADVRKMFEPFGSIEECTVLRGPDGASKGCAFVKYQSNAEAQAAISALHGSRTLPGASSSLVVKFADTEKERGIRRMQQVASQLGVI-SPMSLHLGAYNAYTQALV-QQQALVAQSAYLSPVAT-VAAVQMQQLAALNPSSIIATPIASITPSSGTSTPPTIAATPVPALPPPIAVNSYP--------------PVPAAPNGQSASEALYTNGV---HPY-QAQSPALDPLQQAYTGMQHYTATYPAAYGLVGQPFPHQPTLVAQQPQQPQQLQQREGPEGCNIFIYHLPQEFTDSEMLQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 448          

HSP 2 Score: 68.1662 bits (165), Expect = 1.028e-11
Identity = 36/94 (38.30%), Postives = 58/94 (61.70%), Query Frame = 2
Query:  533 SDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKL 811
            +D  KLF+G + +N  +++++ +F +FGKI E TV+KD+  G  KGCAF+ +     A  A NALH  + + G +  + VK AD++ +   RKL
Sbjct:    4 ADAIKLFIGQIPRNLEEKDLKPIFEQFGKIYELTVIKDKYTGMHKGCAFLTYCARESALKAQNALHEQKTLPGMNRPIQVKPADSEGRGD-RKL 96          
BLAST of Bruno-like protein vs. Ensembl Zebrafish
Match: celf3b (cugbp, Elav-like family member 3b [Source:ZFIN;Acc:ZDB-GENE-110408-50])

HSP 1 Score: 348.206 bits (892), Expect = 1.980e-114
Identity = 196/456 (42.98%), Postives = 278/456 (60.96%), Query Frame = 2
Query:  233 KLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFPQTDQIT----MKPIVDIQP---IPPEAVH----RTIVTPGSLLSYPFLNVQIPTV-YPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            KLF+GQIPRN  +K+++ IFE +G I+E  +++DK TG HKGCAF+T+  ++SA   Q ALH++K L GMNRP+QVKPA      +S   GE+          RKLFVGML K Q+DE+V+ +F  FG I+ECTVL+  +G SKGCAFVKF +H++A +AIN+LH S+ + GASSSLVVKFADT+K++ +R++QQ    L +    + +N   Y+         Y   +   Q +    +Y+  A   QI   + L++     + ++ PS    P    + P++  PQ   +     + P  + QP   I    +H    ++ V     L   +  +Q  T  YP A+   +     Q +   +      GPEGCN+FIYHLPQE  D ++ Q+F+ FGNVIS+KV+VDRATNQSKCFGFVS+D+PA A  AI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    8 KLFIGQIPRNLEEKDLKPIFEQYGKIYELTVIKDKYTGMHKGCAFLTYCARESAVKAQSALHEQKTLPGMNRPIQVKPA------DSEGRGED----------RKLFVGMLGKQQSDEDVRKIFEPFGGIDECTVLRGPDGTSKGCAFVKFQSHSEAQSAINSLHGSRTLPGASSSLVVKFADTEKERGVRRMQQVTSQLGVYTP-VTLNFNAYN--------AYTQALVQQQALVAQAQYLSPAASMQIQQMAALNASGIIATPITPPSGANTPPTLAATPVSALPQPIAVNGYSHLPPTTNGQPASEIYTNGLHPYQAQSPVAALDPLQQAYAGMQHYTAAYPTAYGLVSPQFLQQPTLISQQQLQREGPEGCNVFIYHLPQEFTDSEMLQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPASAQTAIQAMNGFQIGMKRLKVQLKRPKDA 438          

HSP 2 Score: 68.9366 bits (167), Expect = 5.755e-12
Identity = 34/93 (36.56%), Postives = 58/93 (62.37%), Query Frame = 2
Query:  536 DERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKL 811
            D  KLF+G + +N  +++++ +F ++GKI E TV+KD+  G  KGCAF+ +     A  A +ALH  + + G +  + VK AD++ + + RKL
Sbjct:    5 DAIKLFIGQIPRNLEEKDLKPIFEQYGKIYELTVIKDKYTGMHKGCAFLTYCARESAVKAQSALHEQKTLPGMNRPIQVKPADSEGRGEDRKL 97          
BLAST of Bruno-like protein vs. Ensembl Xenopus
Match: tada2a (transcriptional adaptor 2A [Source:Xenbase;Acc:XB-GENE-946815])

HSP 1 Score: 369.392 bits (947), Expect = 6.911e-122
Identity = 217/476 (45.59%), Postives = 287/476 (60.29%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYG--------TIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMID-YSVP------INNFPQTDQI-TMKPIVD------IQPIPPEAVHRTIVTPGSLLSYPFLNV-QIPTVYPNAFSNGNLTSTTQSSTDVKTTPLP-------TGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKE 1561
            +  KLFVGQIPRN  +K+++ +FE FG I+E  +L+D+ TG HKGCAF+T+  +DSA   Q ALH++K L GM RP+QVKPA ++     S  G+           RKLFVGMLSK Q++E V +MF  FG IEEC+VL+  +G+SKGCAFVKF +H +A AAI ALH SQ M GASSSLVVKFADTDK++ +R++QQ +  L I    + + I  YS Y         T+++  + S +  +    +C+       IQQI    NL+ + P+  I      H  P+I   +VP       N FP      +  P +D      I P P ++   T+ +    L   F  V Q   +YP A     LT  T S      TP P        GPEGCNLFIYHLPQE GD +L Q+F+ FGN+ISSKV++DRATNQSKCFGFVS+D+P+ A  AI++MNG+ IG KRLKVQLK+PK+
Sbjct:   45 DAIKLFVGQIPRNLEEKDLKPLFEQFGKIYELTVLKDRYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSE-----SRGGD-----------RKLFVGMLSKQQSEEEVTSMFQAFGSIEECSVLRGPDGSSKGCAFVKFSSHAEAQAAIQALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGIFTPSLALPISPYSAYAQALMQQQTTVLSTSHGSYLSPSVAFPSCH-------IQQIGAV-NLNGL-PAAPITPASGLHSPPVIGTAAVPGLVAPLTNGFPGLVPFPSSHPALDTIYTNSIVPYPAQSPALTVES----LHPSFTGVQQYSAIYPTA----ALTPVTHS------TPQPPPILQQREGPEGCNLFIYHLPQEFGDNELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPSSAQTAIQAMNGFQIGMKRLKVQLKRPKD 481          
BLAST of Bruno-like protein vs. Ensembl Xenopus
Match: tada2a (transcriptional adaptor 2A [Source:Xenbase;Acc:XB-GENE-946815])

HSP 1 Score: 363.999 bits (933), Expect = 1.646e-119
Identity = 214/500 (42.80%), Postives = 290/500 (58.00%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYG--------TIINPEYNSTIPSNQYIRNCN----------------------EYILAAQIQ-QINLFS--------------NLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFP-QTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNV-QIPTVYPNAFSNGNLTSTTQSSTDVKTTPLP-------TGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKE 1561
            +  KLFVGQIPRN  +K+++ +FE FG I+E  +L+D+ TG HKGCAF+T+  +DSA   Q ALH++K L GM RP+QVKPA ++     S  G+           RKLFVGMLSK Q++E V +MF  FG IEEC+VL+  +G+SKGCAFVKF +H +A AAI ALH SQ M GASSSLVVKFADTDK++ +R++QQ +  L I    + + I  YS Y         T+++  + S +  +    +C+                      E++   +I+ +I L S               L++ +P   +V  PSSHP     Y+  I  +P Q+  +T+           E++H +           F  V Q   +YP A     LT  T S      TP P        GPEGCNLFIYHLPQE GD +L Q+F+ FGN+ISSKV++DRATNQSKCFGFVS+D+P+ A  AI++MNG+ IG KRLKVQLK+PK+
Sbjct:   45 DAIKLFVGQIPRNLEEKDLKPLFEQFGKIYELTVLKDRYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSE-----SRGGD-----------RKLFVGMLSKQQSEEEVTSMFQAFGSIEECSVLRGPDGSSKGCAFVKFSSHAEAQAAIQALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGIFTPSLALPISPYSAYAQALMQQQTTVLSTSHGSYLSPSVAFPSCHIQQIGAVNLNGLPAAPITPASGEFLWGCEIRAKIGLHSPPVIGTAAVPGLVAPLTNGFP--GLVPFPSSHPALDTIYTNSIVPYPAQSPALTV-----------ESLHPS-----------FTGVQQYSAIYPTA----ALTPVTHS------TPQPPPILQQREGPEGCNLFIYHLPQEFGDNELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPSSAQTAIQAMNGFQIGMKRLKVQLKRPKD 494          
BLAST of Bruno-like protein vs. Ensembl Xenopus
Match: tada2a (transcriptional adaptor 2A [Source:Xenbase;Acc:XB-GENE-946815])

HSP 1 Score: 326.635 bits (836), Expect = 2.498e-105
Identity = 203/476 (42.65%), Postives = 271/476 (56.93%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYG--------TIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMID-YSVP------INNFPQTDQI-TMKPIVD------IQPIPPEAVHRTIVTPGSLLSYPFLNV-QIPTVYPNAFSNGNLTSTTQSSTDVKTTPLP-------TGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKE 1561
            +  KLFVGQIPRN  +K+++ +FE FG I+E  +L+D+ TG HKGCAF+T+  +DSA   Q ALH++K L GM RP+QVKPA ++     S  G           +RKLFVGMLSK Q++E V +MF  FG IEEC+VL+  +G+SKGCAFVKF +H +A AAI ALH SQ M GASSSLVVKFADTDK++ +R++QQ +  L I    + + I  YS Y         T+++  + S +  +    +C+       IQQI    NL+ + P+  I      H  P+I   +VP       N FP      +  P +D      I P P ++   T+ +    L   F  V Q   +YP A     LT  T S      TP P        GPEGCNLFIYHLPQE GD +L Q+F+ FGN+ISSKV                +D+P+ A  AI++MNG+ IG KRLKVQLK+PK+
Sbjct:   48 DAIKLFVGQIPRNLEEKDLKPLFEQFGKIYELTVLKDRYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSE-----SRGGMYPVH---LPSDRKLFVGMLSKQQSEEEVTSMFQAFGSIEECSVLRGPDGSSKGCAFVKFSSHAEAQAAIQALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGIFTPSLALPISPYSAYAQALMQQQTTVLSTSHGSYLSPSVAFPSCH-------IQQIGAV-NLNGL-PAAPITPASGLHSPPVIGTAAVPGLVAPLTNGFPGLVPFPSSHPALDTIYTNSIVPYPAQSPALTVES----LHPSFTGVQQYSAIYPTA----ALTPVTHS------TPQPPPILQQREGPEGCNLFIYHLPQEFGDNELTQMFLPFGNIISSKV----------------FDNPSSAQTAIQAMNGFQIGMKRLKVQLKRPKD 476          

HSP 2 Score: 69.707 bits (169), Expect = 5.437e-12
Identity = 39/111 (35.14%), Postives = 63/111 (56.76%), Query Frame = 2
Query:  476 KLAKNSSLNGENQTEEQVFS----DERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQ 793
            K +K+  ++G     +Q  S    D  KLFVG + +N  +++++ +F +FGKI E TVLKD+  G  KGCAF+ +     A  A  ALH  + + G +  + VK AD++ +
Sbjct:   24 KASKSCPMSGPEPPAQQSDSMKDLDAIKLFVGQIPRNLEEKDLKPLFEQFGKIYELTVLKDRYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSESR 134          
BLAST of Bruno-like protein vs. Ensembl Xenopus
Match: celf2 (CUGBP, Elav-like family member 2 [Source:NCBI gene;Acc:100125022])

HSP 1 Score: 273.863 bits (699), Expect = 5.305e-85
Identity = 175/479 (36.53%), Postives = 255/479 (53.24%), Query Frame = 2
Query:  233 KLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTG--FHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQY------------IPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSS--HPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVK---TTPLPT------------------GPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPK 1558
            K+FVGQIPR+  +KE++ +FE +G +++  +LRD+       KGC FVTFY + +A   Q ALH+ K L GM+ P+Q+KPA               +E+    ++RKLF+GM+SK   + +++ MF+ FG+IEEC +L+  +G S+GCAFV F     A  AI A+H SQ MEG SS +VVKFADT K K+ R+LQQ               +L+ L +  P  +    Q  +  N    S I            ILA       LFS+    + +N ++S   +  + +  +  +   N+       ++  +  +Q +    V    +   +L     LN  +        + G + + TQ+ + ++      LPT                  GPEG NLFIYHLPQE GD  + Q+FM FGNVIS+KV++D+ TN SKCFGFVSYD+P  A AAI++MNG+ IG KRLKVQLK+ K
Sbjct:   17 KMFVGQIPRSWSEKELKDLFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPA--------------DSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQQQLAQQMQQLNTATWGNLTGLGALTPQYLALLQQATSSSNLGAFSGIQQMAGKWRKKHLILA----NYALFSSALKFFCTNDVLSWKLTFHYLIFFLVAASTANSSAGAAMNSLTSLGTLQGLAGATVGLNNIN--ALAGMAALNGGLGATGLTNGTAGTMDALTQAYSGIQQYAAAALPTLYSQSLLQQQSAAGSQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSK 475          

HSP 2 Score: 58.9214 bits (141), Expect = 1.191e-8
Identity = 34/116 (29.31%), Postives = 63/116 (54.31%), Query Frame = 2
Query:  497 LNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGN---SKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLS 835
            +NG     +Q   D  K+FVG + ++ +++ ++++F  +G + +  VL+D++ N   SKGC FV F     A  A NALH  + + G    + +K AD++K   +   + +I  +S
Sbjct:    1 MNGALDHSDQPDPDAIKMFVGQIPRSWSEKELKDLFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVS 116          
BLAST of Bruno-like protein vs. Ensembl Xenopus
Match: tada2a (transcriptional adaptor 2A [Source:Xenbase;Acc:XB-GENE-946815])

HSP 1 Score: 270.781 bits (691), Expect = 2.576e-84
Identity = 175/456 (38.38%), Postives = 239/456 (52.41%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFPQ-----TDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCF-----GFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKE 1561
            +  KLFVGQIPRN  +K+++ +FE FG I+E  +L+D+ TG HKGCAF+T+  +DSA   Q ALH++K L GM RP+QVKPA ++     S  G+           RKLFVGMLSK Q++E V +MF  FG IEEC+VL+  +G+SKGCAFVKF +H +A AAI ALH SQ M GASSSLVVKFADTDK++ +R++QQ +  L I    + + I  YS Y                          A   QQ  + S     Y S S V+ PS H +  I  +V +N  P         +   P++    +P      T   PG L+ +P  +  + T+Y N+                   P P       +   H P   G  Q   I+       ++   V  +T Q         GFVS+D+P+ A  AI++MNG+ IG KRLKVQLK+PK+
Sbjct:   42 DAIKLFVGQIPRNLEEKDLKPLFEQFGKIYELTVLKDRYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSE-----SRGGD-----------RKLFVGMLSKQQSEEEVTSMFQAFGSIEECSVLRGPDGSSKGCAFVKFSSHAEAQAAIQALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGIFTPSLALPISPYSAYAQ------------------------ALMQQQTTVLSTSHGSYLSPS-VAFPSCH-IQQIG-AVNLNGLPAAPITPASGLHSPPVIGTAAVPGLVAPLTNGFPG-LVPFPSSHPALDTIYTNSI-----------------VPYPAQSPALTVESLH-PSFTGVQQYSAIY-----PTAALTPVTHSTPQPPPILQQREGFVSFDNPSSAQTAIQAMNGFQIGMKRLKVQLKRPKD 430          
BLAST of Bruno-like protein vs. Ensembl Mouse
Match: Celf5 (CUGBP, Elav-like family member 5 [Source:MGI Symbol;Acc:MGI:2442333])

HSP 1 Score: 364.77 bits (935), Expect = 9.212e-121
Identity = 203/464 (43.75%), Postives = 277/464 (59.70%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFS----NLSSVYPSNSIVSMP--SSHPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSN----GNLTSTTQSSTDVKTTPLP--------TGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKE 1561
            +  KLFVGQIPR+  +++++ +FE FG I+E  +L+D  TG HKGCAF+T+  +DSA   Q ALH++K L GM RP+QVKPA ++     S  G +          RKLFVGML+K Q++E+V  +F  FG I+ECTVL+  +G+SKGCAFVKF +HT+A AAI+ALH SQ M GASSSLVVKFADTDK++ +R++QQ +  L IL   + +    YS Y   +  +  + + ++    +         IQQI   S      + + P++ + S P   +  VP +   +P N FP            + P P        V    L+ YP  +  +      AFS       +  T   +    + P P         GPEGCNLFIYHLPQE GD +L Q+F+ FGN+ISSKV++DRATNQSKCFGFVS+D PA A AAI++MNG+ IG KRLKVQLK+PK+
Sbjct:    5 DAIKLFVGQIPRHLHEQDLKPLFEQFGRIYELTVLKDPHTGVHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSE-----SRGGRD----------RKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFPPCHIQQIGAVSLNGLPATPIAPASGLHSPPLLGTAAVPGLMAPIP-NGFP-----------GVLPFPGSHPALETVYANGLVPYPAQSPTVAETLHPAFSGVQQYTAMYPTAAIAPVAHSVPQPPHLLQQQREGPEGCNLFIYHLPQEFGDTELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDHPASAQAAIQAMNGFQIGMKRLKVQLKRPKD 441          
BLAST of Bruno-like protein vs. Ensembl Mouse
Match: Celf4 (CUGBP, Elav-like family member 4 [Source:MGI Symbol;Acc:MGI:1932407])

HSP 1 Score: 360.918 bits (925), Expect = 1.973e-118
Identity = 209/474 (44.09%), Postives = 280/474 (59.07%), Query Frame = 2
Query:  233 KLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPY--YSQY-----------------GTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMP--SSHPVPMIDYSVPINNF----PQTDQITMKPIV---DIQPIPPEAVHRTIVTPGSLLSYPFLNVQ--IPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            KLF+GQIPRN  +K+++ +FE FG I+E  +L+D+ TG HKGCAF+T+  ++SA   Q ALH++K L GMNRP+QVKPA ++    SS   +  +        RKLFVGML+K Q++++V+ +F  FG IEECT+L+  +GNSKGCAFVK+ +H +A AAINALH SQ M GASSSLVVKFADTDK++ +R++QQ    + + N   P+ IP+  Y  Y                 G  +NP         Q +   N   LAA           + + P++   + P  ++  VP I   + +N F    PQ +       V    I P P  A   T   P   L   +  VQ      YP A+  G ++        +       GPEGCNL IYHLPQE GD +L Q+F+ FGNVISSKV+VDRATNQSKCFGFVS+D+PA A  AI++MNG+ IG KRLKVQLK+PK+A
Sbjct:   55 KLFIGQIPRNLDEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCERESALKAQSALHEQKTLPGMNRPIQVKPADSESRGGSSCLRQPPSH-------RKLFVGMLNKQQSEDDVRRLFEAFGNIEECTILRGPDGNSKGCAFVKYSSHAEAQAAINALHGSQTMPGASSSLVVKFADTDKERTMRRMQQMAGQMGMFN---PMAIPFGAYGAYAQALMQQQAALMASVAQGGYLNPMAAFAAAQMQQMAALNMNGLAA-----------APMTPTSGGSTPPGITAPAVPSIPSPIGVNGFTGLPPQANGQPAAEAVFANGIHPYP--AQSPTAADP---LQQAYAGVQQYAGPAYPAAY--GQISQAFPQPPPMIPQQQREGPEGCNLLIYHLPQEFGDAELMQMFLPFGNVISSKVFVDRATNQSKCFGFVSFDNPASAQTAIQAMNGFQIGMKRLKVQLKRPKDA 500          

HSP 2 Score: 67.0106 bits (162), Expect = 3.272e-11
Identity = 35/95 (36.84%), Postives = 57/95 (60.00%), Query Frame = 2
Query:  536 DERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQ 817
            D  KLF+G + +N  +++++ +F +FGKI E TVLKD+  G  KGCAF+ +     A  A +ALH  + + G +  + VK AD++ +     L+Q
Sbjct:   52 DAIKLFIGQIPRNLDEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCERESALKAQSALHEQKTLPGMNRPIQVKPADSESRGGSSCLRQ 146          
BLAST of Bruno-like protein vs. Ensembl Mouse
Match: Celf3 (CUGBP, Elav-like family member 3 [Source:MGI Symbol;Acc:MGI:1926034])

HSP 1 Score: 357.451 bits (916), Expect = 2.337e-118
Identity = 197/449 (43.88%), Postives = 269/449 (59.91%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPG--SLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLFVGQIPR+  +K+++ IFE FG IFE  +++DK TG HKGCAF+T+  +DSA   Q ALH++K L GMNRP+QVKPA      +S   GE+          RKLFVGML K QTDE+V+ MF  FG I+ECTVL+  +G SKGCAFVKF  H +A AAIN LH+S+ + GASSSLVVKFADT+K++ +R++QQ    L +  S I +    YS Y   +  +  + + ++    +    + A Q+Q +   S       +N +++ P +               P + Q    P+  +Q       H T   P   SL++  F   Q P +              Q     +      GP+GCN+FIYHLPQE  D ++ Q+F+ FG+VIS+KV+VDRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    5 DAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPA------DSESRGED----------RKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMF-SPIALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAIS-------ANGLIATPIT---------------PSSAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSLVAPAF--PQPPALVAQQPPPPPQQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 412          
BLAST of Bruno-like protein vs. Ensembl Mouse
Match: Celf3 (CUGBP, Elav-like family member 3 [Source:MGI Symbol;Acc:MGI:1926034])

HSP 1 Score: 358.221 bits (918), Expect = 5.655e-118
Identity = 205/477 (42.98%), Postives = 283/477 (59.33%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSN----LSSVYPSNSIVSMP--SSHPVPMIDYSVPINNF-PQTDQITMKPIVDIQPIPPEAVH----RTIVTPGSLLSYPFLNVQIPT-VYPNAFS------------------NGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLFVGQIPR+  +K+++ IFE FG IFE  +++DK TG HKGCAF+T+  +DSA   Q ALH++K L GMNRP+QVKPA      +S   G+           RKLFVGML K QTDE+V+ MF  FG I+ECTVL+  +G SKGCAFVKF  H +A AAIN LH+S+ + GASSSLVVKFADT+K++ +R++QQ    L +  S I +    YS Y   +  +  + + ++    +    + A Q+Q +   S      + + PS+   + P  ++ PV  I  ++ +N + P   Q T +P  D   + P  VH    ++   P   L   +  +Q  T  YP A+S                          Q     +      GP+GCN+FIYHLPQE  D ++ Q+F+ FG+VIS+KV+VDRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    5 DAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPA------DSESRGD-----------RKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMF-SPIALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAISANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVNGYSPVPTQPTGQPAPDA--LYPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 461          
BLAST of Bruno-like protein vs. Ensembl Mouse
Match: Celf3 (CUGBP, Elav-like family member 3 [Source:MGI Symbol;Acc:MGI:1926034])

HSP 1 Score: 355.91 bits (912), Expect = 1.269e-116
Identity = 209/503 (41.55%), Postives = 286/503 (56.86%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSN----LSSVYPSNSIVSMPS--SHPVPMIDYSVPINNF-PQTDQITMKPIVD------IQPIPPEA---------------VHRTIV---------TPGSLLSYPFLNVQIPTV-YPNAFS------------------NGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLFVGQIPR+  +K+++ IFE FG IFE  +++DK TG HKGCAF+T+  +DSA   Q ALH++K L GMNRP+QVKPA      +S   GE+          RKLFVGML K QTDE+V+ MF  FG I+ECTVL+  +G SKGCAFVKF  H +A AAIN LH+S+ + GASSSLVVKFADT+K++ +R++QQ    L +  S I +    YS Y   +  +  + + ++    +    + A Q+Q +   S      + + PS+   + P+  + PV  I  ++ +N + P   Q T +P  D      + P P EA                H  +V          P   L   +  +Q  T  YP A+S                          Q     +      GP+GCN+FIYHLPQE  D ++ Q+F+ FG+VIS+KV+VDRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    5 DAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPA------DSESRGED----------RKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMF-SPIALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAISANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVNGYSPVPTQPTGQPAPDALYPNGVHPYPDEALSAERSAGGVPIMSQAHSWLVMLSAAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 490          
BLAST of Bruno-like protein vs. UniProt
Match: sp|A0JM51|CELF5_XENTR (CUGBP Elav-like family member 5 OS=Xenopus tropicalis OX=8364 GN=celf5 PE=2 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 3.661e-121
Identity = 217/476 (45.59%), Postives = 287/476 (60.29%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYG--------TIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMID-YSVP------INNFPQTDQI-TMKPIVD------IQPIPPEAVHRTIVTPGSLLSYPFLNV-QIPTVYPNAFSNGNLTSTTQSSTDVKTTPLP-------TGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKE 1561
            +  KLFVGQIPRN  +K+++ +FE FG I+E  +L+D+ TG HKGCAF+T+  +DSA   Q ALH++K L GM RP+QVKPA ++     S  G+           RKLFVGMLSK Q++E V +MF  FG IEEC+VL+  +G+SKGCAFVKF +H +A AAI ALH SQ M GASSSLVVKFADTDK++ +R++QQ +  L I    + + I  YS Y         T+++  + S +  +    +C+       IQQI    NL+ + P+  I      H  P+I   +VP       N FP      +  P +D      I P P ++   T+ +    L   F  V Q   +YP A     LT  T S      TP P        GPEGCNLFIYHLPQE GD +L Q+F+ FGN+ISSKV++DRATNQSKCFGFVS+D+P+ A  AI++MNG+ IG KRLKVQLK+PK+
Sbjct:   45 DAIKLFVGQIPRNLEEKDLKPLFEQFGKIYELTVLKDRYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSE-----SRGGD-----------RKLFVGMLSKQQSEEEVTSMFQAFGSIEECSVLRGPDGSSKGCAFVKFSSHAEAQAAIQALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGIFTPSLALPISPYSAYAQALMQQQTTVLSTSHGSYLSPSVAFPSCH-------IQQIGAV-NLNGL-PAAPITPASGLHSPPVIGTAAVPGLVAPLTNGFPGLVPFPSSHPALDTIYTNSIVPYPAQSPALTVES----LHPSFTGVQQYSAIYPTA----ALTPVTHS------TPQPPPILQQREGPEGCNLFIYHLPQEFGDNELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPSSAQTAIQAMNGFQIGMKRLKVQLKRPKD 481          
BLAST of Bruno-like protein vs. UniProt
Match: sp|Q08E07|CELF3_BOVIN (CUGBP Elav-like family member 3 OS=Bos taurus OX=9913 GN=CELF3 PE=2 SV=1)

HSP 1 Score: 365.155 bits (936), Expect = 9.428e-120
Identity = 205/472 (43.43%), Postives = 284/472 (60.17%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSN----LSSVYPSNSIVSMPS--SHPVPMIDYSVPINNF-PQTDQITMKPIVDIQPIPPEAVH----RTIVTPGSLLSYPFLNVQIPTVYPNAFS--------------NGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLFVGQIPR+  +K+++ IFE FG IFE  +++DK TG HKGCAF+T+  +DSA   Q ALH++K L GMNRP+QVKPA      +S   GE+          RKLFVGML K QTDE+V+ MF  FG I+ECTVL+  +G SKGCAFVKF  H +A AAIN LH+S+ + GASSSLVVKFADT+K++ +R++QQ    L +  S I +    YS Y   +  +  + + ++    +    + A Q+Q +   +      + + PS+   + P+  + PV  I  ++ +N + P   Q T +P  D   + P  VH    ++   P   L   +  +Q  T YP A+S                      Q     +      GP+GCN+FIYHLPQE  D ++ Q+F+ FG+VIS+KV+VDRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    5 DAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPA------DSESRGED----------RKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMF-SPIALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAINANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVNGYSPVPTQPTGQPAPDA--LYPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAYPAAYSLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 457          
BLAST of Bruno-like protein vs. UniProt
Match: sp|Q8N6W0|CELF5_HUMAN (CUGBP Elav-like family member 5 OS=Homo sapiens OX=9606 GN=CELF5 PE=1 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 1.139e-118
Identity = 203/462 (43.94%), Postives = 274/462 (59.31%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDY-SVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLP---------------TGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKE 1561
            +  KLFVGQIPR+  +K+++ +FE FG I+E  +L+D  TG HKGCAF+T+  +DSA   Q ALH++K L GM RP+QVKPA +               E     +RKLFVGML+K Q++E+V  +F  FG I+ECTVL+  +G+SKGCAFVKF +HT+A AAI+ALH SQ M GASSSLVVKFADTDK++ +R++QQ +  L IL   + +    YS Y   +  +  + + ++    +         IQQI   S L+ + P+  I      H  P++   +VP    P T+         + P P        V    L+ YP  +  +      AFS   +   T        TP+                 GPEGCNLFIYHLPQE GD +L Q+F+ FGN+ISSKV++DRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+
Sbjct:   43 DAIKLFVGQIPRHLDEKDLKPLFEQFGRIYELTVLKDPYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADS---------------ESRGGRDRKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFSPCHIQQIGAVS-LNGL-PATPIAPASGLHSPPLLGTTAVPGLVAPITNGF-----AGVVPFPGGHPALETVYANGLVPYPAQSPTVAETLHPAFSG--VQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLPQEFGDTELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKD 480          
BLAST of Bruno-like protein vs. UniProt
Match: sp|Q5SZQ8|CELF3_HUMAN (CUGBP Elav-like family member 3 OS=Homo sapiens OX=9606 GN=CELF3 PE=1 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 1.581e-117
Identity = 205/476 (43.07%), Postives = 284/476 (59.66%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSN----LSSVYPSNSIVSMP--SSHPVPMIDYSVPINNF-PQTDQITMKPIVDIQPIPPEAVH----RTIVTPGSLLSYPFLNVQIPT-VYPNAFS-----------------NGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLFVGQIPR+  +K+++ IFE FG IFE  +++DK TG HKGCAF+T+  +DSA   Q ALH++K L GMNRP+QVKPA      +S   GE+          RKLFVGML K QTDE+V+ MF  FG I+ECTVL+  +G SKGCAFVKF  H +A AAIN LH+S+ + GASSSLVVKFADT+K++ +R++QQ    L +  S I +    YS Y   +  +  + + ++    +    + A Q+Q +   +      + + PS+   + P  ++ PV  I  ++ +N + P   Q T +P  D   + P  VH    ++   P   L   +  +Q  T  YP A+S                         Q     +      GP+GCN+FIYHLPQE  D ++ Q+F+ FG+VIS+KV+VDRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    5 DAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPA------DSESRGED----------RKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMF-SPIALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAINANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVNGYSPVPTQPTGQPAPDA--LYPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 461          
BLAST of Bruno-like protein vs. UniProt
Match: sp|Q8CIN6|CELF3_MOUSE (CUGBP Elav-like family member 3 OS=Mus musculus OX=10090 GN=Celf3 PE=2 SV=1)

HSP 1 Score: 358.221 bits (918), Expect = 3.956e-117
Identity = 205/477 (42.98%), Postives = 283/477 (59.33%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSN----LSSVYPSNSIVSMP--SSHPVPMIDYSVPINNF-PQTDQITMKPIVDIQPIPPEAVH----RTIVTPGSLLSYPFLNVQIPT-VYPNAFS------------------NGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLFVGQIPR+  +K+++ IFE FG IFE  +++DK TG HKGCAF+T+  +DSA   Q ALH++K L GMNRP+QVKPA      +S   G+           RKLFVGML K QTDE+V+ MF  FG I+ECTVL+  +G SKGCAFVKF  H +A AAIN LH+S+ + GASSSLVVKFADT+K++ +R++QQ    L +  S I +    YS Y   +  +  + + ++    +    + A Q+Q +   S      + + PS+   + P  ++ PV  I  ++ +N + P   Q T +P  D   + P  VH    ++   P   L   +  +Q  T  YP A+S                          Q     +      GP+GCN+FIYHLPQE  D ++ Q+F+ FG+VIS+KV+VDRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    5 DAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPA------DSESRGD-----------RKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMF-SPIALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAISANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVNGYSPVPTQPTGQPAPDA--LYPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 461          
BLAST of Bruno-like protein vs. TrEMBL
Match: gnl|BL_ORD_ID|19607347 (tr|A4V6M1|A4V6M1_DUGJA Bruno-like protein (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 666.381 bits (1718), Expect = 0.000e+0
Identity = 324/401 (80.80%), Postives = 357/401 (89.03%), Query Frame = 2
Query:  437 GMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYY-SQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEAINEMKNFNQMLSSTPDINQVFCSS 1636
            G  RPLQVKPAKN L K +++N  NQ  E + SDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKF+NHTDA AAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQ +PDL+ILNS IPI+IPYY SQ G +INPE NS IP+ Q+I NCNEYILAAQIQQINLFSN+  +YPSNSIVSMPS+HPVPMIDYS+PINN P+TDQ+TMKP++D+Q I  + ++R IVTPGS +SYPFLNVQIPT Y  AF N NL+S  Q+S DVK+TPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKE +N+ KN +Q+L+S  DI QV+CSS
Sbjct:    2 GTRRPLQVKPAKNNLTKKTNMNTLNQLGENIASDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFLNHTDARAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQNLPDLNILNSHIPIHIPYYTSQCGPVINPEMNSAIPTTQFIPNCNEYILAAQIQQINLFSNIPPIYPSNSIVSMPSTHPVPMIDYSIPINNLPKTDQMTMKPVLDVQQITQDNLNRPIVTPGSFMSYPFLNVQIPTGYQAAFPNNNLSSINQNSNDVKSTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKETLNDTKNLSQILTSAADIKQVYCSS 402          
BLAST of Bruno-like protein vs. TrEMBL
Match: gnl|BL_ORD_ID|19603954 (tr|D5JG67|D5JG67_DUGJA Bruno 5-like protein OS=Dugesia japonica OX=6161 GN=BRUNOL-5 PE=2 SV=1)

HSP 1 Score: 640.958 bits (1652), Expect = 0.000e+0
Identity = 311/381 (81.63%), Postives = 342/381 (89.76%), Query Frame = 2
Query:  497 LNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYY-SQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEAINEMKNFNQMLSSTPDINQVFCSS 1636
            +N  NQ  E + SDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKF+NHTDA AAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQ +PDL+ILNS IPI+IPYY SQ G +INPE NS IP+ Q+I NCNEYILAAQIQQINLFSN+  +YPSNSIVSMPS+HPVPMIDYS+PINN P+TDQ+TMKP++D+Q I  + ++R IVTPGS +SYPFLNVQIPT Y  AF N NL+S  Q+S DVK+TPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKE +N+ KN +Q+L+S  DI QV+CSS
Sbjct:    1 MNTLNQLGENIASDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFLNHTDARAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQNLPDLNILNSHIPIHIPYYTSQCGPVINPEMNSAIPTTQFIPNCNEYILAAQIQQINLFSNIPPIYPSNSIVSMPSTHPVPMIDYSIPINNLPKTDQMTMKPVLDVQQITQDNLNRPIVTPGSFMSYPFLNVQIPTGYQAAFPNNNLSSINQNSNDVKSTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKETLNDTKNLSQILTSAADIKQVYCSS 381          
BLAST of Bruno-like protein vs. TrEMBL
Match: gnl|BL_ORD_ID|15752958 (tr|R7TIA4|R7TIA4_CAPTE Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_183838 PE=4 SV=1)

HSP 1 Score: 385.956 bits (990), Expect = 1.789e-125
Identity = 215/467 (46.04%), Postives = 288/467 (61.67%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIP---------SNQYIRNCNEYILAAQIQQINLFSN---LSSVYPSNSIVS---MPSSHPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQ----IPTVYPNAFSNGNLTSTTQSSTDV-KTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLFVGQIPRN  +K++R IFE FG I+E  +L+D+ TG HKGCAF+T+  +DSA   Q+ALH++K L GMNRP+QVKPA          + E++ E+      RKLFVGML+K Q++E V+ MF+ +G IEECT+L+DQNGNSKGCAFVKF  H DA AAINALH SQ M GASSSLVVKFADT+K++Q+RK+QQ    L +L+   P  +  +  YG     +                +  I      + A+Q+       N    +++ P++   +   +    P  M+  +  +  FP T Q   + ++D  P   +      +  G  L+  +  VQ    I T YP A+          ++T +  TT    GPEGCNLFIYHLPQE GD +L Q+FM FGNVIS+KVY+DRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:   15 DAIKLFVGQIPRNLEEKDLRPIFEEFGQIYELTVLKDRFTGMHKGCAFLTYCARDSALKAQQALHEQKTLPGMNRPIQVKPA----------DSESRAED------RKLFVGMLNKQQSEEEVRQMFSPYGSIEECTILRDQNGNSKGCAFVKFTTHADAQAAINALHGSQTMPGASSSLVVKFADTEKERQLRKMQQMTGPLGLLS---PFALSQFGTYGAYTQQQLVQQQAALMAAAAAQGSYSINPTMSALTASQVPHALAMQNGLSTAAITPTSGASNPAFLQELTPPTMLSPTAAMTAFPMT-QANGQAVMD--PSGIQQYQAQAMAAGDPLTQAYSGVQQYAGIAT-YPAAYGQFQQALAQHAATIIPTTTAQKEGPEGCNLFIYHLPQEFGDAELAQMFMPFGNVISAKVYIDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 458          

HSP 2 Score: 69.3218 bits (168), Expect = 1.072e-8
Identity = 36/94 (38.30%), Postives = 58/94 (61.70%), Query Frame = 2
Query:  533 SDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKL 811
            +D  KLFVG + +N  +++++ +F +FG+I E TVLKD+  G  KGCAF+ +     A  A  ALH  + + G +  + VK AD++ + + RKL
Sbjct:   14 ADAIKLFVGQIPRNLEEKDLRPIFEEFGQIYELTVLKDRFTGMHKGCAFLTYCARDSALKAQQALHEQKTLPGMNRPIQVKPADSESRAEDRKL 107          
BLAST of Bruno-like protein vs. TrEMBL
Match: gnl|BL_ORD_ID|28298186 (tr|A0A452SSW9|A0A452SSW9_URSAM CUGBP Elav-like family member 5 OS=Ursus americanus OX=9643 GN=CELF5 PE=4 SV=1)

HSP 1 Score: 374.4 bits (960), Expect = 8.808e-121
Identity = 203/447 (45.41%), Postives = 273/447 (61.07%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDY-SVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKE 1561
            +  KLFVGQIPRN  +K+++ +FE FG I+E  +L+D  TG HKGCAF+T+  +DSA   Q ALH++K L GM RP+QVKPA +               E     +RKLFVGML+K Q++E+V  +F  FG I+ECTVL+  +G+SKGCAFVKF +HT+A AAI+ALH SQ M GASSSLVVKFADTDK++ +R++QQ +  L IL   + +    YS Y   +  +  + + ++    +         IQQI   S L+ + P+  I      H  P++   +VP    P T+         + P P        V    L+ YP  +  +      AFS     + T +   V     P GPEGCNLFIYHLPQE GD +L Q+F+ FGN+ISSKV++DRATNQSKCFGFVS+D+PA A  AI++MNG+ IG KRLKVQLK+PK+
Sbjct:   43 DAIKLFVGQIPRNLDEKDLKPLFEQFGRIYELTVLKDPYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADS---------------ESRGGRDRKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFSPCHIQQIGAVS-LNGL-PATPIAPASGLHSPPLLGTTAVPGLVAPITNGF-----AGVVPFPGGHPALETVYANGLVPYPAQSPTVAETLHPAFSGVQQYTGTGAVRPVSGVGPPLGPEGCNLFIYHLPQEFGDTELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPASAQTAIQAMNGFQIGMKRLKVQLKRPKD 467          
BLAST of Bruno-like protein vs. TrEMBL
Match: gnl|BL_ORD_ID|28480678 (tr|A0A452CDX5|A0A452CDX5_BALAS CUGBP Elav-like family member 3 isoform X3 OS=Balaenoptera acutorostrata scammoni OX=310752 GN=CELF3 PE=4 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 6.893e-120
Identity = 207/469 (44.14%), Postives = 287/469 (61.19%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSN----LSSVYPSNSIVSMPS--SHPVPMIDYSVPINNF-PQTDQITMKPIVDIQPIPPEAVH----RTIVTPGSLLSYPFLNVQIPTVYPNAFS--------NGNLTSTTQSSTDVKTTPLPT---GPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLFVGQIPR+  +K+++ IFE FG IFE  +++DK TG HKGCAF+T+  +DSA   Q ALH++K L GMNRP+QVKPA      +S   GE    E     +RKLFVGML K QTDE+V+ MF  FG I+ECTVL+  +G SKGCAFVKF  H +A AAIN LH+S+ + GASSSLVVKFADT+K++ +R++QQ    L +  S I +    YS Y   +  +  + + ++    +    + A Q+Q +   +      + + PS+   + P+  + PV  I  ++ +N + P   Q T +P  D   + P  VH    ++   PG  L   +  +Q  T YP A+S           L +        +         GP+GCN+FIYHLPQE  D ++ Q+F+ FG+VIS+KV+VDRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    5 DAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPA------DSESRGEPSVRE-----DRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMF-SPIALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAINANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVNGYSPVPTQPTGQPAPDA--LYPNGVHPYPAQSPAAPGPPLQQAYAGMQHYTAYPAAYSLVAPAFPQPPALVAQQPPPPPQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 459          
BLAST of Bruno-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000012369.2 (CUGBP Elav-like family member 5 [Source:NCBI gene;Acc:103039850])

HSP 1 Score: 354.369 bits (908), Expect = 2.566e-115
Identity = 209/475 (44.00%), Postives = 279/475 (58.74%), Query Frame = 2
Query:  221 ENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPY--------------YSQYGTIINPEYNSTI-PSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFPQTDQIT-MKPIVDIQPIPPEAVHRTIVTPGSL--------LSYPFLNVQIPT-VYPNAFSN--GNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            ++  KLF+GQIPRN  +K+++ +FE FG I E  +L+D+ TG HKGCAF+T+  ++SA   Q ALH++K L GM RP+QVKPA      +S   GE+          RKLFVGML+K QT+E+V  +F  +G IEECTVL+  +GNSKGCAFVKF  HT+A +AI  LH SQ M GASSSLVVKFADTDK++ IR++QQ +    I N  +   +P+                Q   I+   + + + PS  +         A QI Q+    N++ + P+        S P   +  SVP    P  +  T + P  +  P+  EAV+   + P S         L   F  VQ  T +YP       G            +      GPEGCNLFIYHLPQE GD +L Q+F+ FG+VISSKV++DRATNQSKCFGFVS+D+PA A+AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:  107 QDAIKLFIGQIPRNLEEKDLKPLFEQFGKIHELTVLKDRYTGMHKGCAFLTYCARESAIKAQNALHEQKTLPGMTRPIQVKPA------DSESRGED----------RKLFVGMLNKQQTEEDVYRIFEPYGVIEECTVLRGPDGNSKGCAFVKFSTHTEAQSAIGGLHGSQTMPGASSSLVVKFADTDKERTIRRMQQMVGQFGIFNPAV--ALPFSTYSSTYSTYTHALMQQQAAIMAASHGAYLAPSMAFP--------ATQIHQVGAL-NMNGLPPTPMTPVSGLSSPPANLASSVPSIVTPIVNGFTGIAPQPNGHPV--EAVYANGLPPYSTQSPTAADTLQQAFTGVQQYTAIYPTTTLTPIGQTLPQPPQVIQQQQQQQREGPEGCNLFIYHLPQEFGDNELMQMFLPFGSVISSKVFMDRATNQSKCFGFVSFDNPASAHAAIQAMNGFQIGMKRLKVQLKRPKDA 552          
BLAST of Bruno-like protein vs. Ensembl Cavefish
Match: si:dkey-205h23.2 (si:dkey-205h23.2 [Source:ZFIN;Acc:ZDB-GENE-120215-101])

HSP 1 Score: 300.442 bits (768), Expect = 2.067e-95
Identity = 187/415 (45.06%), Postives = 251/415 (60.48%), Query Frame = 2
Query:  359 CAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQ--YIRNCNEYILAAQIQQINLFSN---LSSVYPSNSIVSMP--SSHPVPMIDYSVPINNF---PQTD-QITMKPIV--DIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            CAF+T+  ++SA   Q ALH++K L GMNRP+QVKPA      +S   GE          +RKLFVGML K Q++E+V+ +F  FG+IEECTVL+  +G SKGCAFVKF +H +A AAIN LH  Q M GASSSLVVKFADTDK++ +R++ Q    L I  S + I    Y  Y   +  +  + + ++Q  Y+        A   Q      N    + + PS+   + P  S+  VP I   + +N F   PQ++ Q   +PI    I P P ++   T+  P   L   +  VQ    Y  AFS   +  +  S+    ++ L   PEGCNLFIYHLPQE GD +L Q+F+ FGNVIS+KV+VDRATNQSKCFGFVS+D+P+ A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:   96 CAFLTYCARESALKAQSALHEQKTLPGMNRPIQVKPA------DSEGRGE----------DRKLFVGMLGKQQSEEDVRRLFEAFGQIEECTVLRGPDGASKGCAFVKFSSHAEAQAAINTLHGGQTMPGASSSLVVKFADTDKERTMRRMHQMAGQLGIF-SPMTIQFGAYGAYTHAMMQQQAALMAASQGSYLNPMAAIAAAQMQQMAAFNVNGLVAAPMTPSSGTSTPPGISATAVPSIAAPIGVNGFSALPQSNGQPASEPIYTNGIHPYPAQS--PTVTDP---LQQAYAGVQ---HYAGAFSFPFIYFSIPSNISSSSSVL--WPEGCNLFIYHLPQEFGDAELMQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPSSAQAAIQAMNGFQIGMKRLKVQLKRPKDA 483          

HSP 2 Score: 55.8398 bits (133), Expect = 7.805e-8
Identity = 30/77 (38.96%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  233 KLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVK 463
            KLFVG + +   ++++R +FEAFG I E  +LR    G  KGCAFV F     A+     LH  + + G +  L VK
Sbjct:  142 KLFVGMLGKQQSEEDVRRLFEAFGQIEECTVLRGPD-GASKGCAFVKFSSHAEAQAAINTLHGGQTMPGASSSLVVK 217          
BLAST of Bruno-like protein vs. Ensembl Cavefish
Match: celf3b (cugbp, Elav-like family member 3b [Source:ZFIN;Acc:ZDB-GENE-110408-50])

HSP 1 Score: 273.478 bits (698), Expect = 2.237e-86
Identity = 163/405 (40.25%), Postives = 236/405 (58.27%), Query Frame = 2
Query:  440 MNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQIN-------LFSNLSSVYPSNSIVSMPS--SHPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPPEA----VHRTIVTPGSLLSYPFLN---VQIPTVYPNAFSN-GNLTSTTQSSTDVKTTPLP-------------TGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            MNRP+QVKPA      +S   GE          +RKLFVGML K Q D++V+ MF  FG+I+ECT+L+  +G SKGCAFVKF +H +A AAIN+LH S+ + GASSSLVVKFADT+K++ +R++QQ    LS+  S + +N+  Y+ Y   +  +  + +  + Y+      +   Q+QQ+        + + ++ + PS+   + PS  + PVP +   + +N +               P+P  A       TI T G    +PF     V +      A++   + T+   ++  + ++P P              GPEGCN+FIYHLPQE  D +L Q+F+ FGNVIS+KV+VDRATNQSKCFGFVS+D+P  A  AI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    1 MNRPIQVKPA------DSEGRGE----------DRKLFVGMLGKQQEDDDVRKMFELFGRIDECTILRAPDGTSKGCAFVKFQSHAEAQAAINSLHGSRTLPGASSSLVVKFADTEKERGLRRMQQVASQLSVF-SPMTLNLGAYNAYAQALVQQQQTLVAQSAYLSPI-ATVATVQMQQMAALNANGIIATPITPITPSSGTNTPPSIAATPVPALPPPIALNGY--------------SPVPTAANGQSASETIYTNGI---HPFQAQSAVAVLDPLQQAYTGMQHYTAAYPAAYGLVSSPFPQQPTLVPQQQQQREGPEGCNIFIYHLPQEFTDSELLQMFVPFGNVISAKVFVDRATNQSKCFGFVSFDNPTSAQTAIQAMNGFQIGMKRLKVQLKRPKDA 370          

HSP 2 Score: 57.7658 bits (138), Expect = 1.380e-8
Identity = 40/103 (38.83%), Postives = 50/103 (48.54%), Query Frame = 2
Query:  233 KLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQ--VFS 535
            KLFVG + +   D ++R +FE FG I E  ILR    G  KGCAFV F     A+    +LH  + L G +  L VK A  +  K   L    Q   Q  VFS
Sbjct:   20 KLFVGMLGKQQEDDDVRKMFELFGRIDECTILR-APDGTSKGCAFVKFQSHAEAQAAINSLHGSRTLPGASSSLVVKFADTE--KERGLRRMQQVASQLSVFS 119          
BLAST of Bruno-like protein vs. Ensembl Cavefish
Match: celf3a (cugbp, Elav-like family member 3a [Source:NCBI gene;Acc:57922])

HSP 1 Score: 270.781 bits (691), Expect = 2.340e-85
Identity = 162/408 (39.71%), Postives = 241/408 (59.07%), Query Frame = 2
Query:  440 MNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQIN-------LFSNLSSVYPSNSIVSMPS--SHPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPP--EAVHRTIVTPGSLLSYPFLNVQIPTVYP--NAFSN-GNLTSTTQSSTDVKTTPLP-------------------TGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            MNRP+QVKPA ++                    +RKLFVGML K Q+D +V+ MF  FG IEECTVL+  +G SKGCAFVK+ ++ +A AAI+ALH S+ + GASSSLVVKFADT+K++ IR++QQ    L ++ S + +++  Y+ Y   +  +  + +  + Y+      + A Q+QQ+        + + ++S+ PS+   + P+  + PVP +   + +N++P        P+    P PP  ++    + T G    +P+   Q P + P   A++   + T+T  ++  +   P P                    GPEGCN+FIYHLPQE  D ++ Q+F+ FGNVIS+KV+VDRATNQSKCFGFVS+D+PA A  AI++MNG+ IG KRLKVQLK+PK+A
Sbjct:    1 MNRPIQVKPADSE-----------------GRGDRKLFVGMLGKQQSDADVRKMFEPFGSIEECTVLRGPDGVSKGCAFVKYQSNAEAQAAISALHGSRTLPGASSSLVVKFADTEKERGIRRMQQVASQLGVI-SPMSLHLGAYNAYTQALV-QQQALVAQSAYLSPVAT-VAAVQMQQLAALNPNSIIATPIASITPSSGTSTPPAIAATPVPALPPQIAVNSYP--------PV----PAPPSGQSASEALYTNGV---HPY-QAQSPALDPLQQAYTGMQHYTATYPAAYGLVGQPFPHQHTLVAQQPQQPQQLQQREGPEGCNIFIYHLPQEFTDSEMLQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPASAQTAIQAMNGFQIGMKRLKVQLKRPKDA 372          

HSP 2 Score: 59.3066 bits (142), Expect = 5.110e-9
Identity = 31/77 (40.26%), Postives = 41/77 (53.25%), Query Frame = 2
Query:  233 KLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVK 463
            KLFVG + +   D ++R +FE FG I E  +LR    G  KGCAFV +     A+    ALH  + L G +  L VK
Sbjct:   19 KLFVGMLGKQQSDADVRKMFEPFGSIEECTVLRGPD-GVSKGCAFVKYQSNAEAQAAISALHGSRTLPGASSSLVVK 94          
BLAST of Bruno-like protein vs. Ensembl Cavefish
Match: celf4 (CUGBP Elav-like family member 4 [Source:NCBI gene;Acc:103032019])

HSP 1 Score: 231.491 bits (589), Expect = 1.504e-69
Identity = 111/207 (53.62%), Postives = 147/207 (71.01%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILN 844
            +  KLFVGQIPRN  +K++R +FE FG I+E  +L+D+ TG HKGCAF+T+  ++SA   Q ALH++K L GMNRP+QVKPA      +S   G+           RKLFVGML+K Q +++V+ +F  FG IEECT+L+  +GNSKGCAFVK+ +H +A AAI+ALH SQ M GASSSLVVKFADTDK++ IR++QQ    + I N
Sbjct:   41 DAIKLFVGQIPRNLDEKDLRPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCARESALKAQTALHEQKTLPGMNRPIQVKPA------DSESRGD-----------RKLFVGMLNKQQCEDDVRRLFESFGSIEECTILRGPDGNSKGCAFVKYSSHAEAQAAISALHGSQTMPGASSSLVVKFADTDKERTIRRMQQMAGQMGIFN 230          

HSP 2 Score: 62.3882 bits (150), Expect = 6.079e-10
Identity = 27/38 (71.05%), Postives = 33/38 (86.84%), Query Frame = 2
Query: 1451 GFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            GFVS+D+P  A AAI+SMNG+ IG KRLKVQLK+PK+A
Sbjct:  390 GFVSFDNPGSAQAAIQSMNGFQIGMKRLKVQLKRPKDA 427          
BLAST of Bruno-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002852.1 (pep scaffold:Pmarinus_7.0:GL477021:232626:260651:-1 gene:ENSPMAG00000002591.1 transcript:ENSPMAT00000002852.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 163.31 bits (412), Expect = 1.278e-46
Identity = 84/205 (40.98%), Postives = 128/205 (62.44%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDK--KTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDL 832
            +  K+FVGQIPR+  +KE+R +FE FGP++E  I+RD+  K    +GC FVTFY + +A   Q ALH+ K L G++ P ++ P+    + +               +ERKLF+GM+SK  ++ +++ MF+ FG++EEC VL+  +G SKGCAF+ +     A  AI  +H SQ MEG ++ L VKFADT K K+ ++LQQ +  +
Sbjct:   50 DAIKMFVGQIPRSWSEKELRDLFEQFGPVYEINIVRDRTQKPPQSRGCCFVTFYTRKAALEAQNALHNIKTLPGLHAPTELVPSTTSSSSSL--------------EERKLFIGMISKKCSENDIRAMFSPFGQMEECRVLRGPDGQSKGCAFITYTARAMAQNAIKGMHQSQTMEGCAAPL-VKFADTQKDKEQKRLQQQLAHM 239          
BLAST of Bruno-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008846.1 (pep scaffold:Pmarinus_7.0:GL480623:147895:156346:1 gene:ENSPMAG00000008007.1 transcript:ENSPMAT00000008846.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.035 bits (336), Expect = 4.966e-38
Identity = 61/84 (72.62%), Postives = 70/84 (83.33%), Query Frame = 2
Query: 1307 GPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPK 1558
            GPEG NLFIYHLPQE GD  L Q FM FG+V+SSKV+VD+ TN SKCFGFVSYD+P  A AAI++MNG+ IGTKRLKVQLK+ K
Sbjct:    1 GPEGANLFIYHLPQEFGDQDLMQTFMPFGSVVSSKVFVDKQTNLSKCFGFVSYDNPISAQAAIQAMNGFQIGTKRLKVQLKRSK 84          
BLAST of Bruno-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007375.1 (pep scaffold:Pmarinus_7.0:GL478911:2009:38506:1 gene:ENSPMAG00000006638.1 transcript:ENSPMAT00000007375.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.584 bits (353), Expect = 7.808e-37
Identity = 81/203 (39.90%), Postives = 116/203 (57.14%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKT--GFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKF------GKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRK 808
            +  K+FVGQIPR+  + E+R +FE FG + E  +LRD+       +GC FVT+  + +A   Q +LH+ K L GM  P+Q+KPA ++  K+S +            +ERKLF+GMLSK  ++ +V+ +F+ F      G     TVLK        C F+ F     A  AI ++H SQ MEG SS++VVKFADT K K+ RK
Sbjct:   15 DAIKMFVGQIPRSWGESELRELFEQFGAVHEVNVLRDRTQTPAVSRGCCFVTYCTRKAALEAQSSLHNIKTLPGMYHPIQMKPADSE--KSSGM------------EERKLFIGMLSKQLSEADVRVIFSPFVGENPLGGAPLDTVLKW-------CGFITFATRMMAQNAIKSMHHSQTMEGCSSAVVVKFADTQKDKEQRK 196          

HSP 2 Score: 53.9138 bits (128), Expect = 5.507e-8
Identity = 29/103 (28.16%), Postives = 55/103 (53.40%), Query Frame = 2
Query:  536 DERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQN---GNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLS 835
            D  K+FVG + ++  +  ++ +F +FG + E  VL+D+      S+GC FV +     A  A ++LH  + + G    + +K AD++K   + + + +I  LS
Sbjct:   15 DAIKMFVGQIPRSWGESELRELFEQFGAVHEVNVLRDRTQTPAVSRGCCFVTYCTRKAALEAQSSLHNIKTLPGMYHPIQMKPADSEKSSGMEERKLFIGMLS 117          
BLAST of Bruno-like protein vs. Ensembl Sea Lamprey
Match: rbm45 (RNA binding motif protein 45 [Source:ZFIN;Acc:ZDB-GENE-070122-4])

HSP 1 Score: 79.337 bits (194), Expect = 5.824e-16
Identity = 51/162 (31.48%), Postives = 93/162 (57.41%), Query Frame = 2
Query:  233 KLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQN-GNSKGCAFVKFVNHTDACAAI 715
            +LF+  + + T + +IR  F  FG + +  I++DK T  HKG AF+ +    ++E C +A+ +   +NG       KP K  +A++ + N     E++   D  ++F+ M+ K  T+E+++  F ++G IE C++LKD+N  +SKG  +V+F+  + A  AI
Sbjct:   19 RLFL-VVSKTTSEADIREKFSRFGELQDLWIVKDKHTKEHKGIAFIKYAR--ASEAC-RAMEE---MNGQPLSGDGKPIKAMVAQSRASNNHRDLEDE---DLTRIFL-MIPKTYTEEDLRENFQEYGDIEYCSILKDKNTKDSKGFGYVRFLKPSQAALAI 169          
BLAST of Bruno-like protein vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 65.855 bits (159), Expect = 7.500e-12
Identity = 46/167 (27.54%), Postives = 87/167 (52.10%), Query Frame = 2
Query:  221 ENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDK-KILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKD-QNGNSKGCAFVKFVNHTDACAAI 715
            E   KLF+G +   T ++ ++  FE +G + + +++RD  T   +G  FVT+    SAE    A+  +   L+G     +V  AK  +++  SL      +       +K+FVG +  N  ++++++ F+++G +E   V++D Q+G  +G  FV F +H DA   +
Sbjct:   30 EQQRKLFIGGLSFETTEESMQKHFEQWGTLTDCVVMRDPHTKRSRGFGFVTYM---SAEEVDAAMEVRPHHLDG-----RVVEAKRAISREDSL------KPGAHLKVKKIFVGGIKDNTDEDHLRDYFSEYGMVESVDVMEDRQSGKKRGFGFVTFSDH-DAVDKV 181          
BLAST of Bruno-like protein vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 68.9366 bits (167), Expect = 8.281e-13
Identity = 50/167 (29.94%), Postives = 81/167 (48.50%), Query Frame = 2
Query:  236 LFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQ 736
            +F+  +  +  +K +   F  FG I    I  D+  G  KG  FV F  + +A+    AL+   +LNG  + + V P  ++  ++S L       E+  +    L+V  ++   TDE  Q +F KFG I   ++ KD +G  KG  FV +  H DA  A+ AL+ S+
Sbjct:  128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDE-NGKSKGFGFVHFEEEGAAKEAIDALNGM-LLNG--QEIYVAPHLSRKERDSQL-------EETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSE 283          

HSP 2 Score: 63.1586 bits (152), Expect = 5.691e-11
Identity = 52/170 (30.59%), Postives = 78/170 (45.88%), Query Frame = 2
Query:  215 TMENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQT---EEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAI 715
            T  +Y  L+V  I   T D++ + +F  FGPI    + +D   G  KG  FV +   + A    +AL+D + LNG    L V  A+ K  +   L  + +    E+        LFV  L  +  DE ++  F  +G I    V++ +NG SKG  FV F    +A  AI
Sbjct:  214 TKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDA-DGKLKGFGFVNYEKHEDAVKAVEALNDSE-LNG--EKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAI 379          

HSP 3 Score: 51.9878 bits (123), Expect = 1.655e-7
Identity = 30/90 (33.33%), Postives = 47/90 (52.22%), Query Frame = 2
Query: 1322 NLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGY-----------HIGTKRLKVQLKKPK 1558
            N+FI +L  +I +  LY  F  FG+++SSK+  D    +SK FGFV +++   A  AI ++NG            H+  K    QL++ K
Sbjct:  127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDE-NGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETK 215          
BLAST of Bruno-like protein vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 57.7658 bits (138), Expect = 2.043e-9
Identity = 47/172 (27.33%), Postives = 79/172 (45.93%), Query Frame = 2
Query:  236 LFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKD-QNGNSKGCAFVKFVNHTDACAAINALHASQKMEG 748
            L+VG + +   +  ++  F+  GPI    I+ DK    +   AFV ++    A    + L+ K+I             +N + K   +N   Q+++    D   LFVG L+ N  DE ++N F  F       V+ D Q G+S+G  FV F +  DA  A++++   Q + G
Sbjct:   77 LYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNK-NVNYAFVEYHQSHDANIALQTLNGKQI-------------ENNIVK---INWAFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQG-QDLNG 230          

HSP 2 Score: 51.2174 bits (121), Expect = 2.507e-7
Identity = 27/86 (31.40%), Postives = 46/86 (53.49%), Query Frame = 2
Query:  221 ENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNK 478
            ++ F LFVG +  N  D+ +R  F+ F       ++ D +TG  +G  FV+F  +D A+N   ++  +  LNG  RPL++  A  +
Sbjct:  159 DDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQD-LNG--RPLRINWAAKR 241          
BLAST of Bruno-like protein vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 53.5286 bits (127), Expect = 4.270e-8
Identity = 22/67 (32.84%), Postives = 38/67 (56.72%), Query Frame = 2
Query: 1319 CNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHI 1519
              +F+  L   I D  L + F H G VI ++V  +R T++S+ +G+V +++ + A  AI+ M G  I
Sbjct:  168 ATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEI 234          
BLAST of Bruno-like protein vs. Ensembl Yeast
Match: SNP1 (Component of U1 snRNP required for mRNA splicing via spliceosome; substrate of the arginine methyltransferase Hmt1p; may interact with poly(A) polymerase to regulate polyadenylation; homolog of human U1 70K protein; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001323])

HSP 1 Score: 47.7506 bits (112), Expect = 2.048e-6
Identity = 20/66 (30.30%), Postives = 38/66 (57.58%), Query Frame = 2
Query: 1325 LFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIG 1522
            +FI  LP ++ +++L + F+ FG +   ++  D+ T +SK + F+ + DP  +  A K + G H G
Sbjct:  109 IFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEI-GVHRG 173          
BLAST of Bruno-like protein vs. Ensembl Yeast
Match: HSH49 (U2-snRNP associated splicing factor; similar to the mammalian splicing factor SAP49; proposed to function as a U2-snRNP assembly factor along with Hsh155p and binding partner Cus1p; contains two RNA recognition motifs (RRM) [Source:SGD;Acc:S000005846])

HSP 1 Score: 45.4394 bits (106), Expect = 6.393e-6
Identity = 41/165 (24.85%), Postives = 77/165 (46.67%), Query Frame = 2
Query:  236 LFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGK-IEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALH 727
            ++VG I      +++  +F    P+      +DK    ++G AF+ FY++  A+   K +++   L   +R ++V+   N      + N  +   + +     KLF+  L+ +   + +  +F KFGK I E  +    NG  K CA+V F +   A  AI +L+
Sbjct:   11 VYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYAIKIMNNTVRL--YDRLIKVRQVTN---STGTTNLPSNISKDMILPIAKLFIKNLADSIDSDQLVKIFNKFGKLIREPEIFYLSNGKLK-CAYVYFEDFEKADLAIKSLN 169          
BLAST of Bruno-like protein vs. Ensembl Nematostella
Match: EDO30576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0E1])

HSP 1 Score: 201.06 bits (510), Expect = 2.311e-58
Identity = 100/198 (50.51%), Postives = 132/198 (66.67%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQ 817
            N  KLFVGQ+PR   +K++R IFE +G I+E  IL+DK TG HKGCAF+TF  +D+    QK LH+KK L GM+ P+QVKPA                + +  SD+RKLFVGM+SK+  +E+++ MF+ FG IEE TVL++ +  SKGCAF+KF N   A  AI  +H S  MEG SS LVVKFADT+K+K  +K+Q 
Sbjct:   18 NSVKLFVGQVPRTWEEKDLRPIFEPYGQIYELTILKDKYTGQHKGCAFLTFCSRDACNAAQKHLHEKKTLPGMHHPIQVKPA----------------DSETKSDDRKLFVGMISKHAKEEDLRVMFSPFGTIEELTVLRNADSTSKGCAFIKFANRMQAQNAIATMHNSTTMEGCSSPLVVKFADTEKEKLQKKMQH 199          

HSP 2 Score: 123.635 bits (309), Expect = 2.338e-30
Identity = 56/86 (65.12%), Postives = 66/86 (76.74%), Query Frame = 2
Query: 1307 GPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            GP+G NLFIYHLPQE  D  L Q F  FG VIS+KV++D+ TN SKCFGFVSYD+   A  AI+ MNG+ IG KRLKVQLK+PK+A
Sbjct:  366 GPDGSNLFIYHLPQEFTDADLMQTFQPFGTVISAKVFIDKQTNMSKCFGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQLKRPKDA 451          

HSP 3 Score: 62.003 bits (149), Expect = 3.133e-10
Identity = 36/95 (37.89%), Postives = 57/95 (60.00%), Query Frame = 2
Query:  533 SDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDAC-AAINALHASQKMEGASSSLVVKFADTDKQKQIRKL 811
            S+  KLFVG + +   +++++ +F  +G+I E T+LKD+  G  KGCAF+ F +  DAC AA   LH  + + G    + VK AD++ +   RKL
Sbjct:   17 SNSVKLFVGQVPRTWEEKDLRPIFEPYGQIYELTILKDKYTGQHKGCAFLTFCSR-DACNAAQKHLHEKKTLPGMHHPIQVKPADSETKSDDRKL 110          
BLAST of Bruno-like protein vs. Ensembl Nematostella
Match: EDO35559 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL64])

HSP 1 Score: 132.494 bits (332), Expect = 5.717e-34
Identity = 73/174 (41.95%), Postives = 95/174 (54.60%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKME 745
            N  KLFVGQ+PR   +K++R IFE +G I+E  IL+DK TG HKG         D+    QK LH+KK L GM                               D+RKLFVGM+SK+  +E+++ MF+ FG IEE TVL++ +  SKGCAF+KF N   A  AI  +H S  ME
Sbjct:   18 NSVKLFVGQVPRTWEEKDLRPIFEPYGQIYELTILKDKYTGQHKGW--------DACNAAQKHLHEKKTLPGM-------------------------------DDRKLFVGMISKHAKEEDLRVMFSPFGTIEELTVLRNADSTSKGCAFIKFANRMQAQNAIATMHNSTTME 152          

HSP 2 Score: 125.176 bits (313), Expect = 1.998e-31
Identity = 57/90 (63.33%), Postives = 67/90 (74.44%), Query Frame = 2
Query: 1295 PLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            P   GP+G NLFIYHLPQE  D  L Q F  FG VIS+KV++D+ TN SKCFGFVSYD+   A  AI+ MNG+ IG KRLKVQLK+PK+A
Sbjct:  290 PQKEGPDGSNLFIYHLPQEFTDADLMQTFQPFGTVISAKVFIDKQTNMSKCFGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQLKRPKDA 379          
BLAST of Bruno-like protein vs. Ensembl Nematostella
Match: EDO29519 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3E7])

HSP 1 Score: 125.561 bits (314), Expect = 9.504e-34
Identity = 57/90 (63.33%), Postives = 67/90 (74.44%), Query Frame = 2
Query: 1295 PLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            P   GP+G NLFIYHLPQE  D  L Q F  FG VIS+KV++D+ TN SKCFGFVSYD+   A  AI+ MNG+ IG KRLKVQLK+PK+A
Sbjct:   66 PQKEGPDGSNLFIYHLPQEFTDADLMQTFQPFGTVISAKVFIDKQTNMSKCFGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQLKRPKDA 155          
BLAST of Bruno-like protein vs. Ensembl Nematostella
Match: EDO35562 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL69])

HSP 1 Score: 75.8702 bits (185), Expect = 2.833e-17
Identity = 35/68 (51.47%), Postives = 48/68 (70.59%), Query Frame = 2
Query:  539 ERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKM 742
            +RKLFVGM+SK+  +E+++ MF+ FG IEE TVL++ +  SKGCAF+KF N   A  AI  +H S  M
Sbjct:    1 DRKLFVGMISKHAKEEDLRVMFSPFGTIEELTVLRNADSTSKGCAFIKFANRMQAQNAIATMHNSTTM 68          

HSP 2 Score: 51.2174 bits (121), Expect = 1.460e-8
Identity = 23/67 (34.33%), Postives = 41/67 (61.19%), Query Frame = 2
Query:  233 KLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKIL 433
            KLFVG I ++  ++++R++F  FG I E  +LR+  +   KGCAF+ F ++  A+N    +H+   +
Sbjct:    3 KLFVGMISKHAKEEDLRVMFSPFGTIEELTVLRNADST-SKGCAFIKFANRMQAQNAIATMHNSTTM 68          
BLAST of Bruno-like protein vs. Ensembl Nematostella
Match: EDO34879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN30])

HSP 1 Score: 77.7962 bits (190), Expect = 1.324e-15
Identity = 58/195 (29.74%), Postives = 96/195 (49.23%), Query Frame = 2
Query:  215 TMENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQ 799
            T +    L +  +P +   ++I+ IF   G +    ++RD+ TG   G AFV +   D+ ++  KA+ +   +NG    LQ K  K   A+ SS   +N            L++  L K+  +E V+ +F  FGKI    VLKD +G  +G  FV+F    +A  AI+ L+ ++ + G +  L VKFA+    +Q
Sbjct:    5 TSDERTNLIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNY---DNPDDANKAVRE---MNGAR--LQNKTLKVSFARPSSTEIKNAN----------LYISGLPKDMKEEEVEALFKPFGKIITSKVLKDVSGEGRGTGFVRFDKRCEAQTAIDDLN-NKTLPGTNVKLTVKFANPPNSRQ 180          

HSP 2 Score: 73.1738 bits (178), Expect = 4.089e-14
Identity = 41/102 (40.20%), Postives = 56/102 (54.90%), Query Frame = 2
Query: 1304 TGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEAINEMKNFNQMLSSTP 1609
            T  E  NL I ++P  +    + +IF   GNV S K+  DRAT QS  + FV+YD+P  AN A++ MNG  +  K LKV   +P     E+KN N  +S  P
Sbjct:    5 TSDERTNLIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFARPSST--EIKNANLYISGLP 104          

HSP 3 Score: 47.3654 bits (111), Expect = 8.622e-6
Identity = 28/83 (33.73%), Postives = 45/83 (54.22%), Query Frame = 2
Query: 1310 PEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPK 1558
            P+G  +F+Y LPQE   L LY++F  +G + + ++ +D+       +GFV+  +   A  AI  +NG     K L+V  K PK
Sbjct:  252 PQGWCIFVYGLPQEATPLFLYKLFSPYGAITNIELKLDKG------YGFVNMSNYEEACHAICCLNGTPQHGKILQVSFKTPK 328          
BLAST of Bruno-like protein vs. Ensembl Medaka
Match: celf3b (CUGBP Elav-like family member 3 [Source:NCBI gene;Acc:101160192])

HSP 1 Score: 366.696 bits (940), Expect = 5.022e-121
Identity = 209/491 (42.57%), Postives = 291/491 (59.27%), Query Frame = 2
Query:  194 LVLIDLLTMENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPE---YNSTIPSNQYIRNCNEYILAAQIQQIN-------LFSNLSSVYPSNSIVSMPS--SHPVPMIDYSVPINNFP---------QTDQITMKPIVDIQPIPPEAV-----------HRTIVTPGS--LLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            L+   L+   +  KLFVGQIPRN  +K+++ IFE FG I+E  +++DK TG HKGCAF+T+  ++SA   Q ALH++K L GMNRP+QVKPA      +S   GE          +RKLFVGML K QTDE+V+ +F  FG I+ECTVL+  +G SKGCAFVKF  H +A AAIN+LH S+ M GASSSLVVKFADT+K++ +R++QQ    L I  S + +N P Y+ Y   +N +   + + +  + Y+      + A Q+QQ+        + + ++ + PS+   + P+  + PVP +   + +N +          QT+ +    +   Q   P A+           H T   P +  L+  PF   Q              T   Q     +      GPEGCN+FIYHLPQE  D ++ Q+F+ FGNVIS+KV+VDRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:   28 LLHFVLMKEADAIKLFVGQIPRNLEEKDLKPIFEQFGKIYELTVIKDKYTGMHKGCAFLTYCARESALKAQSALHEQKTLPGMNRPIQVKPA------DSEGRGE----------DRKLFVGMLGKQQTDEDVRRLFEPFGTIDECTVLRGPDGTSKGCAFVKFQGHAEAQAAINSLHGSRTMPGASSSLVVKFADTEKERGLRRMQQVASQLGIF-SPMTLNFPAYNAYTQAVNAQLVQHQALVAQSAYLSPVAT-VAAVQMQQMAALNANGIIATPITPITPSSGTNTPPAIAATPVPALPPPIGMNGYSSVPAPTNGQQTETLYTNGVHQYQAQSPAALDPLQQAYAGMQHYTAAYPAAYGLVGQPFPQQQ--------------TLVAQQHQQPQQQQQREGPEGCNIFIYHLPQEFSDSEMLQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 486          
BLAST of Bruno-like protein vs. Ensembl Medaka
Match: si:dkey-205h23.2 (CUGBP Elav-like family member 6 [Source:NCBI gene;Acc:101171151])

HSP 1 Score: 357.451 bits (916), Expect = 1.631e-117
Identity = 209/473 (44.19%), Postives = 279/473 (58.99%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQY-----------------GTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMP--SSHPVPMIDYSVPINNF----PQTD-QITMKPIV--DIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLF+GQIPRN  +K+++ +FE FG I+E  +L+D+ TG HKGCAF+T+  ++SA   Q ALH++K L GMNRP+QVKPA      +S   GE          +RKLFVGML K Q++++V+ +F  FG+IEECTVL+  +G SKGCAFVKF +H +A AAIN+LH  Q M GASSSLVVKFADTDK++ +R++ Q    L I  S + I    Y  Y                 G+ +NP         Q +   N   L A           + + PS+   + P  S+  VP I   + +N F    PQT+ Q T +PI    I P P ++   T+  P   L   +  VQ       A     ++        +       GPEGCNLFIYHLPQE GD +L Q+F+ FGNVIS+KV+VDRATNQSKCFGFVS+D+P+ A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:   40 DAIKLFIGQIPRNLEEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCARESALKAQSALHEQKTLPGMNRPIQVKPA------DSEGRGE----------DRKLFVGMLGKQQSEDDVRRLFETFGQIEECTVLRGPDGASKGCAFVKFSSHAEAQAAINSLHGGQTMPGASSSLVVKFADTDKERTLRRMHQMAGQLGIF-SPMTIQFGAYGTYSHAQMMQQQAALMAATQGSYLNPMAAIAAAQMQQMAAFNVNGLVA-----------TPMTPSSGTSTPPGISATAVPSIATPIGVNGFSALPPQTNGQPTSEPIYTNGIHPYPAQSP--TVTDP---LQQAYAGVQHYAAAYPAAYA-PISQAFPQQPTIIPQQQREGPEGCNLFIYHLPQEFGDAELMQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPSSAQAAIQAMNGFQIGMKRLKVQLKRPKDA 478          
BLAST of Bruno-like protein vs. Ensembl Medaka
Match: si:dkey-205h23.2 (CUGBP Elav-like family member 6 [Source:NCBI gene;Acc:101171151])

HSP 1 Score: 357.451 bits (916), Expect = 1.631e-117
Identity = 209/473 (44.19%), Postives = 279/473 (58.99%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQY-----------------GTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMP--SSHPVPMIDYSVPINNF----PQTD-QITMKPIV--DIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            +  KLF+GQIPRN  +K+++ +FE FG I+E  +L+D+ TG HKGCAF+T+  ++SA   Q ALH++K L GMNRP+QVKPA      +S   GE          +RKLFVGML K Q++++V+ +F  FG+IEECTVL+  +G SKGCAFVKF +H +A AAIN+LH  Q M GASSSLVVKFADTDK++ +R++ Q    L I  S + I    Y  Y                 G+ +NP         Q +   N   L A           + + PS+   + P  S+  VP I   + +N F    PQT+ Q T +PI    I P P ++   T+  P   L   +  VQ       A     ++        +       GPEGCNLFIYHLPQE GD +L Q+F+ FGNVIS+KV+VDRATNQSKCFGFVS+D+P+ A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:   40 DAIKLFIGQIPRNLEEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCARESALKAQSALHEQKTLPGMNRPIQVKPA------DSEGRGE----------DRKLFVGMLGKQQSEDDVRRLFETFGQIEECTVLRGPDGASKGCAFVKFSSHAEAQAAINSLHGGQTMPGASSSLVVKFADTDKERTLRRMHQMAGQLGIF-SPMTIQFGAYGTYSHAQMMQQQAALMAATQGSYLNPMAAIAAAQMQQMAAFNVNGLVA-----------TPMTPSSGTSTPPGISATAVPSIATPIGVNGFSALPPQTNGQPTSEPIYTNGIHPYPAQSP--TVTDP---LQQAYAGVQHYAAAYPAAYA-PISQAFPQQPTIIPQQQREGPEGCNLFIYHLPQEFGDAELMQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPSSAQAAIQAMNGFQIGMKRLKVQLKRPKDA 478          
BLAST of Bruno-like protein vs. Ensembl Medaka
Match: celf5b (CUGBP Elav-like family member 5 [Source:NCBI gene;Acc:101171069])

HSP 1 Score: 355.91 bits (912), Expect = 1.988e-116
Identity = 212/470 (45.11%), Postives = 278/470 (59.15%), Query Frame = 2
Query:  221 ENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPS--NSIVSMPSSHPVPMIDYSVP------INNFPQT-DQITMKPIVDI---QPIPPEAVHRTIVTPGSLLSYPFLNVQIPT-VYPNAFSNGNLTSTTQSSTDVKTTP---------LPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            ++  KLF+GQIPRN  +K+++ +FE FG I E  +L+D+ TG HKGCAF+T+  ++SA   Q ALH++K L GM RP+QVKPA      +S   GE          +RKLFVGML+K QT+E+V  +F  +G IEECTVL+  +GNSKGCAFVKF  HT+A +AI ALH SQ M GASSSLVVKFADTDK++ IR++QQ +    I N  I +    YS Y         +   S+      +    A QI Q+    N++S+ P+    + +  SS P  +   +VP      +N F     Q    P V+      +PP +           L   F  VQ  T +YP        T+ T  S  +   P            GPEGCNLFIYHLPQE GD +L Q+F+ FG VISSKV++DRATNQSKCFGFVS+D+PA A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:   74 QDAIKLFIGQIPRNLEEKDLKPLFEQFGKIHELTVLKDRYTGMHKGCAFLTYCARESAIKAQNALHEQKTLPGMTRPIQVKPA------DSESRGE----------DRKLFVGMLNKQQTEEDVYRLFEPYGVIEECTVLRGPDGNSKGCAFVKFSAHTEAQSAIGALHGSQTMPGASSSLVVKFADTDKERTIRRMQQMVGQFGIFNPAIALPFSTYSSYAHAQQAAIMAA--SHGGYLTPSVAFPATQIHQMGPL-NINSLPPTPMTPVSAGLSSPPANITTSAVPSIVTPIVNGFTGIPHQPNGHPAVETVYTNGLPPYSTQSP--NAADTLQQAFTGVQQYTAIYP-------ATTLTPISQTLPQAPQVIQQQQQQQREGPEGCNLFIYHLPQEFGDNELMQMFLPFGTVISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDA 515          
BLAST of Bruno-like protein vs. Ensembl Medaka
Match: si:dkey-205h23.2 (CUGBP Elav-like family member 6 [Source:NCBI gene;Acc:101171151])

HSP 1 Score: 349.362 bits (895), Expect = 5.950e-114
Identity = 213/497 (42.86%), Postives = 282/497 (56.74%), Query Frame = 2
Query:  233 KLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQY-----------------GTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMP--SSHPVPMIDYSVPINNF----PQTD-QITMKPIV--DIQPIPPEAVHRTIVTPGSLLSYPFLNVQ--------IPTVYPNAFS-------------------NGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEA 1564
            KLF+GQIPRN  +K+++ +FE FG I+E  +L+D+ TG HKGCAF+T+  ++SA   Q ALH++K L GMNRP+QVKPA      +S   GE          +RKLFVGML K Q++++V+ +F  FG+IEECTVL+  +G SKGCAFVKF +H +A AAIN+LH  Q M GASSSLVVKFADTDK++ +R++ Q    L I  S + I    Y  Y                 G+ +NP         Q +   N   L A           + + PS+   + P  S+  VP I   + +N F    PQT+ Q T +PI    I P P ++   T+  P   L   +  VQ               AF                    +  +     SS  V+      GPEGCNLFIYHLPQE GD +L Q+F+ FGNVIS+KV+VDRATNQSKCFGFVS+D+P+ A AAI++MNG+ IG KRLKVQLK+PK+A
Sbjct:   43 KLFIGQIPRNLEEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCARESALKAQSALHEQKTLPGMNRPIQVKPA------DSEGRGE----------DRKLFVGMLGKQQSEDDVRRLFETFGQIEECTVLRGPDGASKGCAFVKFSSHAEAQAAINSLHGGQTMPGASSSLVVKFADTDKERTLRRMHQMAGQLGIF-SPMTIQFGAYGTYSHAQMMQQQAALMAATQGSYLNPMAAIAAAQMQQMAAFNVNGLVA-----------TPMTPSSGTSTPPGISATAVPSIATPIGVNGFSALPPQTNGQPTSEPIYTNGIHPYPAQSP--TVTDP---LQQAYAGVQHYAAAYPAAYAPISQAFPQQPTIIPQQQREVHFCLHPDWPVQYVAASSKSVEGW-REIGPEGCNLFIYHLPQEFGDAELMQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPSSAQAAIQAMNGFQIGMKRLKVQLKRPKDA 505          

HSP 2 Score: 70.0922 bits (170), Expect = 2.340e-12
Identity = 36/93 (38.71%), Postives = 58/93 (62.37%), Query Frame = 2
Query:  536 DERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKL 811
            D  KLF+G + +N  +++++ +F +FGKI E TVLKD+  G  KGCAF+ +     A  A +ALH  + + G +  + VK AD++ + + RKL
Sbjct:   40 DAIKLFIGQIPRNLEEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCARESALKAQSALHEQKTLPGMNRPIQVKPADSEGRGEDRKL 132          
BLAST of Bruno-like protein vs. Planmine SMEST
Match: SMESG000046617.1 (SMESG000046617.1)

HSP 1 Score: 973.77 bits (2516), Expect = 0.000e+0
Identity = 471/473 (99.58%), Postives = 473/473 (100.00%), Query Frame = 2
Query:  218 MENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEAINEMKNFNQMLSSTPDINQVFCSS 1636
            MENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPI+IPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFPQTDQITMKPIVD+QPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEAINEMKNFNQMLSSTPDINQVFCSS
Sbjct:    1 MENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPIHIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFPQTDQITMKPIVDMQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEAINEMKNFNQMLSSTPDINQVFCSS 473          
BLAST of Bruno-like protein vs. Planmine SMEST
Match: SMESG000046617.1 (SMESG000046617.1)

HSP 1 Score: 920.998 bits (2379), Expect = 0.000e+0
Identity = 445/447 (99.55%), Postives = 447/447 (100.00%), Query Frame = 2
Query:  218 MENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPK 1558
            MENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPI+IPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFPQTDQITMKPIVD+QPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPK
Sbjct:    1 MENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPIHIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFPQTDQITMKPIVDMQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPK 447          
BLAST of Bruno-like protein vs. Planmine SMEST
Match: SMESG000046617.1 (SMESG000046617.1)

HSP 1 Score: 752.666 bits (1942), Expect = 0.000e+0
Identity = 365/367 (99.46%), Postives = 367/367 (100.00%), Query Frame = 2
Query:  536 DERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFPQTDQITMKPIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEAINEMKNFNQMLSSTPDINQVFCSS 1636
            DERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPI+IPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFPQTDQITMKPIVD+QPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEAINEMKNFNQMLSSTPDINQVFCSS
Sbjct:    9 DERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPIHIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAAQIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFPQTDQITMKPIVDMQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEAINEMKNFNQMLSSTPDINQVFCSS 375          

HSP 2 Score: 55.0694 bits (131), Expect = 7.914e-8
Identity = 30/77 (38.96%), Postives = 43/77 (55.84%), Query Frame = 2
Query:  233 KLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVK 463
            KLFVG + +N  D+ ++ +F  FG I E  +L+D+  G  KGCAFV F +   A     ALH  + + G +  L VK
Sbjct:   12 KLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQN-GNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVK 87          
BLAST of Bruno-like protein vs. Planmine SMEST
Match: SMESG000026947.1 (SMESG000026947.1)

HSP 1 Score: 366.311 bits (939), Expect = 1.784e-120
Identity = 224/501 (44.71%), Postives = 290/501 (57.88%), Query Frame = 2
Query:  233 KLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYG-----------TIINP--------EYNSTIPSNQYI-------RNCNEYI---------------LAAQIQQINLFSNLSSVYP-------------SNSIVSMPSSH---PVPMIDYSVPINNFPQTDQITMKPIVDIQPIPPEAV--HRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPK 1558
            KLFVGQIPR+  + ++R +FE +G I+EF ILRDK TG HKGCAF+T+ H+ S+E CQ+ALHD+K L GM RPLQVKPAK                E+  ++ERKLFVGML+KNQT+E+V+ +F  FG+IEECTVL+DQNGNSKGCAFVKF +  +A AAI+ALH SQ M+GASSS+VVKFADT+K++Q RKLQQ I  L+++NS + +     + YG            I NP        +  S +PS   I        N   YI                +AQ   IN  +N  +  P             SNS ++M S +   PV  I  S  I+N   +D      +     +  + V  + +  +  S  S P   +  P      F    L S T    D++     +GPE CNLFIYHLP E GD  L Q+F  FG + S+KVYVDRATNQSKCFGFVSY + A A AAI++MNG+ +G KRLKVQLK+PK
Sbjct:   45 KLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAK----------------EERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNL--SDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPI-GQFGQSGL-SLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPK 525          

HSP 2 Score: 62.003 bits (149), Expect = 7.496e-10
Identity = 35/113 (30.97%), Postives = 65/113 (57.52%), Query Frame = 2
Query:  476 KLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKL 811
            K++     NG++ +     SD  KLFVG + ++  + +++ MF ++G+I E ++L+D+  G  KGCAF+ + +   + A   ALH  + + G +  L VK A  +++ + RKL
Sbjct:   22 KISNGPESNGKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKL 134          
BLAST of Bruno-like protein vs. Planmine SMEST
Match: SMESG000026947.1 (SMESG000026947.1)

HSP 1 Score: 266.929 bits (681), Expect = 1.085e-82
Identity = 133/236 (56.36%), Postives = 171/236 (72.46%), Query Frame = 2
Query:  224 NYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQ 931
            +  KLFVGQIPR+  + ++R +FE +G I+EF ILRDK TG HKGCAF+T+ H+ S+E CQ+ALHD+K L GM RPLQVKPAK                E+  ++ERKLFVGML+KNQT+E+V+ +F  FG+IEECTVL+DQNGNSKGCAFVKF +  +A AAI+ALH SQ M+GASSS+VVKFADT+K++Q RKLQQ I  L+++NS + +     +Q G  I   Y  TI  NQ
Sbjct:   38 DAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAK----------------EERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLAL-----AQLGGNI---YGQTILDNQ 249          

HSP 2 Score: 62.3882 bits (150), Expect = 4.778e-10
Identity = 35/113 (30.97%), Postives = 65/113 (57.52%), Query Frame = 2
Query:  476 KLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKL 811
            K++     NG++ +     SD  KLFVG + ++  + +++ MF ++G+I E ++L+D+  G  KGCAF+ + +   + A   ALH  + + G +  L VK A  +++ + RKL
Sbjct:   18 KISNGPESNGKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKL 130          
The following BLAST results are available for this feature:
BLAST of Bruno-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CELF52.371e-11943.94CUGBP Elav-like family member 5 [Source:HGNC Symbo... [more]
CELF33.293e-11843.07CUGBP Elav-like family member 3 [Source:HGNC Symbo... [more]
CELF31.812e-11643.43CUGBP Elav-like family member 3 [Source:HGNC Symbo... [more]
CELF31.981e-11342.52CUGBP Elav-like family member 3 [Source:HGNC Symbo... [more]
CELF66.518e-11243.46CUGBP Elav-like family member 6 [Source:HGNC Symbo... [more]
back to top
BLAST of Bruno-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-751.258e-6852.66Putative RNA-binding protein [Source:UniProtKB/Tr... [more]
unc-751.630e-6752.66Putative RNA-binding protein [Source:UniProtKB/Tr... [more]
etr-11.380e-5347.94ELAV-Type RNA binding-protein family [Source:UniP... [more]
etr-11.380e-5347.94ELAV-Type RNA binding-protein family [Source:UniP... [more]
etr-11.380e-5347.94ELAV-Type RNA binding-protein family [Source:UniP... [more]
back to top
BLAST of Bruno-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bru28.430e-9339.66gene:FBgn0262475 transcript:FBtr0304859[more]
bru28.430e-9339.66gene:FBgn0262475 transcript:FBtr0332232[more]
bru22.475e-6238.70gene:FBgn0262475 transcript:FBtr0304863[more]
bru25.209e-5641.28gene:FBgn0262475 transcript:FBtr0332234[more]
bru25.209e-5641.28gene:FBgn0262475 transcript:FBtr0304862[more]
back to top
BLAST of Bruno-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
celf5a6.783e-11845.45cugbp, Elav-like family member 5a [Source:ZFIN;Acc... [more]
celf5a4.049e-11744.47cugbp, Elav-like family member 5a [Source:ZFIN;Acc... [more]
celf3a1.270e-11541.29cugbp, Elav-like family member 3a [Source:NCBI gen... [more]
celf3a1.270e-11541.29cugbp, Elav-like family member 3a [Source:NCBI gen... [more]
celf3b1.980e-11442.98cugbp, Elav-like family member 3b [Source:ZFIN;Acc... [more]
back to top
BLAST of Bruno-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tada2a6.911e-12245.59transcriptional adaptor 2A [Source:Xenbase;Acc:XB-... [more]
tada2a1.646e-11942.80transcriptional adaptor 2A [Source:Xenbase;Acc:XB-... [more]
tada2a2.498e-10542.65transcriptional adaptor 2A [Source:Xenbase;Acc:XB-... [more]
celf25.305e-8536.53CUGBP, Elav-like family member 2 [Source:NCBI gene... [more]
tada2a2.576e-8438.38transcriptional adaptor 2A [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of Bruno-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Celf59.212e-12143.75CUGBP, Elav-like family member 5 [Source:MGI Symbo... [more]
Celf41.973e-11844.09CUGBP, Elav-like family member 4 [Source:MGI Symbo... [more]
Celf32.337e-11843.88CUGBP, Elav-like family member 3 [Source:MGI Symbo... [more]
Celf35.655e-11842.98CUGBP, Elav-like family member 3 [Source:MGI Symbo... [more]
Celf31.269e-11641.55CUGBP, Elav-like family member 3 [Source:MGI Symbo... [more]
back to top
BLAST of Bruno-like protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A0JM51|CELF5_XENTR3.661e-12145.59CUGBP Elav-like family member 5 OS=Xenopus tropica... [more]
sp|Q08E07|CELF3_BOVIN9.428e-12043.43CUGBP Elav-like family member 3 OS=Bos taurus OX=9... [more]
sp|Q8N6W0|CELF5_HUMAN1.139e-11843.94CUGBP Elav-like family member 5 OS=Homo sapiens OX... [more]
sp|Q5SZQ8|CELF3_HUMAN1.581e-11743.07CUGBP Elav-like family member 3 OS=Homo sapiens OX... [more]
sp|Q8CIN6|CELF3_MOUSE3.956e-11742.98CUGBP Elav-like family member 3 OS=Mus musculus OX... [more]
back to top
BLAST of Bruno-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|196073470.000e+080.80tr|A4V6M1|A4V6M1_DUGJA Bruno-like protein (Fragmen... [more]
gnl|BL_ORD_ID|196039540.000e+081.63tr|D5JG67|D5JG67_DUGJA Bruno 5-like protein OS=Dug... [more]
gnl|BL_ORD_ID|157529581.789e-12546.04tr|R7TIA4|R7TIA4_CAPTE Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|282981868.808e-12145.41tr|A0A452SSW9|A0A452SSW9_URSAM CUGBP Elav-like fam... [more]
gnl|BL_ORD_ID|284806786.893e-12044.14tr|A0A452CDX5|A0A452CDX5_BALAS CUGBP Elav-like fam... [more]
back to top
BLAST of Bruno-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000012369.22.566e-11544.00CUGBP Elav-like family member 5 [Source:NCBI gene;... [more]
si:dkey-205h23.22.067e-9545.06si:dkey-205h23.2 [Source:ZFIN;Acc:ZDB-GENE-120215-... [more]
celf3b2.237e-8640.25cugbp, Elav-like family member 3b [Source:ZFIN;Acc... [more]
celf3a2.340e-8539.71cugbp, Elav-like family member 3a [Source:NCBI gen... [more]
celf41.504e-6953.62CUGBP Elav-like family member 4 [Source:NCBI gene;... [more]
back to top
BLAST of Bruno-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002852.11.278e-4640.98pep scaffold:Pmarinus_7.0:GL477021:232626:260651:-... [more]
ENSPMAT00000008846.14.966e-3872.62pep scaffold:Pmarinus_7.0:GL480623:147895:156346:1... [more]
ENSPMAT00000007375.17.808e-3739.90pep scaffold:Pmarinus_7.0:GL478911:2009:38506:1 ge... [more]
rbm455.824e-1631.48RNA binding motif protein 45 [Source:ZFIN;Acc:ZDB-... [more]
HNRNPA07.500e-1227.54heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
back to top
BLAST of Bruno-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PAB18.281e-1329.94Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
PUB12.043e-927.33Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
NSR14.270e-832.84Nucleolar protein that binds nuclear localization ... [more]
SNP12.048e-630.30Component of U1 snRNP required for mRNA splicing v... [more]
HSH496.393e-624.85U2-snRNP associated splicing factor; similar to th... [more]
back to top
BLAST of Bruno-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO305762.311e-5850.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355595.717e-3441.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO295199.504e-3463.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355622.833e-1751.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348791.324e-1529.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Bruno-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
celf3b5.022e-12142.57CUGBP Elav-like family member 3 [Source:NCBI gene;... [more]
si:dkey-205h23.21.631e-11744.19CUGBP Elav-like family member 6 [Source:NCBI gene;... [more]
si:dkey-205h23.21.631e-11744.19CUGBP Elav-like family member 6 [Source:NCBI gene;... [more]
celf5b1.988e-11645.11CUGBP Elav-like family member 5 [Source:NCBI gene;... [more]
si:dkey-205h23.25.950e-11442.86CUGBP Elav-like family member 6 [Source:NCBI gene;... [more]
back to top
BLAST of Bruno-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046617.10.000e+099.58SMESG000046617.1[more]
SMESG000046617.10.000e+099.55SMESG000046617.1[more]
SMESG000046617.17.914e-899.46SMESG000046617.1[more]
SMESG000026947.11.784e-12044.71SMESG000026947.1[more]
SMESG000026947.11.085e-8256.36SMESG000026947.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001900 ID=SMED30001900|Name=Bruno-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1713bp
CTTTTGAGGGAAAAATAATTCTTTTATTAATAATGTTTCATCATTGGAAT
ATAAAATAAAATATTAGGAGAAAACATAAGTTAACCAACAATATTAGCCA
CATATTTCGTTTAATTATTGGTCTATCACTTTTCATTTTAACCAATTGTC
TTGAGATAATGGAGAGTTTATCCTTAATTTTTATTATAAATCACTGGTTT
TGATAGACTTATTAACAATGGAAAATTATTTCAAACTTTTCGTTGGTCAG
ATACCTCGAAATACACCAGATAAAGAAATTAGACTTATTTTTGAAGCTTT
TGGACCAATCTTTGAATTTTTAATTTTAAGGGACAAGAAAACTGGTTTTC
ATAAAGGATGTGCTTTTGTTACATTTTATCATAAAGACTCTGCAGAAAAT
TGTCAAAAGGCGTTACATGACAAGAAAATCCTAAACGGGATGAATCGACC
ACTTCAAGTGAAACCAGCTAAAAATAAGTTAGCAAAAAATTCAAGTTTGA
ATGGGGAAAATCAGACAGAAGAGCAGGTTTTCAGTGATGAAAGGAAATTG
TTTGTTGGAATGTTGAGTAAAAATCAAACTGATGAAAATGTACAAAATAT
GTTCACAAAATTTGGCAAAATCGAAGAGTGCACTGTATTGAAAGACCAAA
ATGGAAATAGTAAAGGATGTGCCTTTGTCAAATTCGTGAACCACACCGAT
GCTTGTGCAGCAATAAACGCTCTTCATGCCAGTCAAAAAATGGAGGGTGC
TTCATCCAGCCTTGTGGTTAAATTTGCTGACACGGATAAACAAAAACAAA
TAAGAAAATTGCAGCAATATATTCCAGATTTAAGCATTTTAAATTCGCGC
ATTCCTATTAATATTCCATACTATTCACAATACGGTACAATAATTAATCC
AGAATATAATTCAACAATTCCTTCAAACCAATATATTCGAAATTGTAACG
AATATATTCTTGCTGCTCAAATTCAACAAATAAATTTGTTTTCTAATTTA
TCATCGGTCTACCCATCTAATTCAATAGTGTCAATGCCATCCAGCCATCC
GGTACCAATGATTGACTATTCTGTTCCTATTAACAACTTTCCACAAACTG
ACCAAATAACAATGAAACCAATTGTTGATATACAGCCAATACCTCCAGAA
GCTGTACACCGAACCATCGTAACTCCAGGATCACTCTTATCATATCCTTT
TCTTAATGTTCAAATTCCTACAGTATATCCAAACGCCTTTTCCAATGGAA
ATTTAACAAGTACAACACAAAGTTCAACAGATGTGAAAACCACTCCTTTG
CCAACAGGTCCTGAAGGCTGCAATCTATTTATTTATCATCTGCCACAAGA
AATTGGTGATTTACAATTATATCAAATTTTTATGCATTTTGGAAACGTTA
TCAGTTCTAAAGTTTATGTTGACAGAGCAACAAATCAAAGCAAATGTTTT
GGATTTGTCAGCTACGATGATCCGGCATGTGCCAATGCCGCCATCAAATC
TATGAATGGATATCATATCGGAACAAAAAGATTAAAAGTTCAGTTAAAAA
AACCAAAAGAAGCAATAAACGAAATGAAAAACTTCAATCAAATGTTATCA
TCAACTCCCGACATAAACCAAGTATTTTGTTCATCCTAATGATTGTGATA
TTTTACAGGATTTTCTCGACCATATTGAAAGCCTGATTGGTGATATGTAA
AATGACCCACCGT
back to top

protein sequence of SMED30001900-orf-1

>SMED30001900-orf-1 ID=SMED30001900-orf-1|Name=SMED30001900-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=474bp
MENYFKLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAF
VTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQT
EEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKG
CAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQ
YIPDLSILNSRIPINIPYYSQYGTIINPEYNSTIPSNQYIRNCNEYILAA
QIQQINLFSNLSSVYPSNSIVSMPSSHPVPMIDYSVPINNFPQTDQITMK
PIVDIQPIPPEAVHRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTT
QSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVY
VDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKEAI
NEMKNFNQMLSSTPDINQVFCSS*
back to top
Aliases
The feature 'Bruno-like protein' has the following synonyms
Synonym
bruli-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0004519embryonic pharynx neuron
PLANA:0004517blastomere
PLANA:0000429neoblast
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000008Stage 8
PLANA:0000002Stage 2
PLANA:0000006Stage 6
PLANA:0000007Stage 7
PLANA:0000004Stage 4
PLANA:0000005Stage 5
PLANA:0000003Stage 3
Vocabulary: INTERPRO
TermDefinition
IPR002343Hud_Sxl_RNA
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: cellular component
TermDefinition
GO:1990904ribonucleoprotein complex
GO:0016604nuclear body
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:00973227SK snRNA binding
GO:0003723RNA binding
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
GO:0007283spermatogenesis
GO:0008380RNA splicing
GO:0030317flagellated sperm motility
GO:0030575nuclear body organization
GO:0048026positive regulation of mRNA splicing, via spliceosome
GO:0098781ncRNA transcription
GO:0000381regulation of alternative mRNA splicing, via spliceosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002343Paraneoplastic encephalomyelitis antigenPRINTSPR00961HUDSXLRNAcoord: 129..141
score: 35.13
coord: 114..129
score: 25.62
coord: 170..187
score: 38.15
coord: 5..20
score: 29.79
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 110..185
e-value: 3.6E-20
score: 83.0
coord: 369..442
e-value: 2.0E-20
score: 83.8
coord: 6..82
e-value: 5.0E-20
score: 82.5
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 370..440
e-value: 1.3E-16
score: 60.2
coord: 111..173
e-value: 4.2E-16
score: 58.5
coord: 7..72
e-value: 8.4E-16
score: 57.6
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 5..86
score: 16.398
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 109..189
score: 16.449
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 368..446
score: 15.852
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 96..197
e-value: 4.1E-26
score: 93.0
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 2..95
e-value: 9.6E-24
score: 85.5
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 339..445
e-value: 3.6E-25
score: 90.3
NoneNo IPR availablePANTHERPTHR24012RNA BINDING PROTEINcoord: 5..450
NoneNo IPR availablePANTHERPTHR24012:SF716CUGBP ELAV-LIKE FAMILY MEMBER 6coord: 5..450
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 3..92
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 107..448