SMED30001889

Overview
NameSMED30001889
Smed IDSMED30001889
Length (bp)831
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30001889 (SMED30001889) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30001889 (SMED30001889) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30001889 (SMED30001889) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30001889 (SMED30001889) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001889

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30001889SMESG000021903.1 Contig1531GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30001889 vs. Ensembl Human
Match: COMMD5 (COMM domain containing 5 [Source:HGNC Symbol;Acc:HGNC:17902])

HSP 1 Score: 63.5438 bits (153), Expect = 9.427e-12
Identity = 35/149 (23.49%), Postives = 72/149 (48.32%), Query Frame = 3
Query:  231 VGLCRRICENSSGSSFFSMTYLLFKQIIKLPENKVNESSVRLSLEECKLPTSYIDIFMQNVLDKNAYVKLQLIAASSMVRNVYLVSSSWNINIALCSNSVGKIMEPVIALTLKLSSGKQLRFEVNAKQFHNLRFQVSNILKSIINLQNR 677
            +G+   + E   G+    M + L +Q ++LP   +   + R  L+E  +P   +      V      + L  +A        ++    W +++A+ ++++ + ++P + + LKLS G   RFEV   +F  LR+ V+ +LK + +L+ R
Sbjct:   17 LGVSANLPEEQLGALLAGM-HTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPL-LDSVAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKEMADLEKR 163          
BLAST of SMED30001889 vs. Ensembl Human
Match: COMMD5 (COMM domain containing 5 [Source:HGNC Symbol;Acc:HGNC:17902])

HSP 1 Score: 63.5438 bits (153), Expect = 2.068e-11
Identity = 35/149 (23.49%), Postives = 72/149 (48.32%), Query Frame = 3
Query:  231 VGLCRRICENSSGSSFFSMTYLLFKQIIKLPENKVNESSVRLSLEECKLPTSYIDIFMQNVLDKNAYVKLQLIAASSMVRNVYLVSSSWNINIALCSNSVGKIMEPVIALTLKLSSGKQLRFEVNAKQFHNLRFQVSNILKSIINLQNR 677
            +G+   + E   G+    M + L +Q ++LP   +   + R  L+E  +P   +      V      + L  +A        ++    W +++A+ ++++ + ++P + + LKLS G   RFEV   +F  LR+ V+ +LK + +L+ R
Sbjct:   71 LGVSANLPEEQLGALLAGM-HTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPL-LDSVAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKEMADLEKR 217          
BLAST of SMED30001889 vs. Ensembl Human
Match: COMMD5 (COMM domain containing 5 [Source:HGNC Symbol;Acc:HGNC:17902])

HSP 1 Score: 63.5438 bits (153), Expect = 2.068e-11
Identity = 35/149 (23.49%), Postives = 72/149 (48.32%), Query Frame = 3
Query:  231 VGLCRRICENSSGSSFFSMTYLLFKQIIKLPENKVNESSVRLSLEECKLPTSYIDIFMQNVLDKNAYVKLQLIAASSMVRNVYLVSSSWNINIALCSNSVGKIMEPVIALTLKLSSGKQLRFEVNAKQFHNLRFQVSNILKSIINLQNR 677
            +G+   + E   G+    M + L +Q ++LP   +   + R  L+E  +P   +      V      + L  +A        ++    W +++A+ ++++ + ++P + + LKLS G   RFEV   +F  LR+ V+ +LK + +L+ R
Sbjct:   71 LGVSANLPEEQLGALLAGM-HTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPL-LDSVAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKEMADLEKR 217          
BLAST of SMED30001889 vs. Ensembl Human
Match: COMMD5 (COMM domain containing 5 [Source:HGNC Symbol;Acc:HGNC:17902])

HSP 1 Score: 63.5438 bits (153), Expect = 2.068e-11
Identity = 35/149 (23.49%), Postives = 72/149 (48.32%), Query Frame = 3
Query:  231 VGLCRRICENSSGSSFFSMTYLLFKQIIKLPENKVNESSVRLSLEECKLPTSYIDIFMQNVLDKNAYVKLQLIAASSMVRNVYLVSSSWNINIALCSNSVGKIMEPVIALTLKLSSGKQLRFEVNAKQFHNLRFQVSNILKSIINLQNR 677
            +G+   + E   G+    M + L +Q ++LP   +   + R  L+E  +P   +      V      + L  +A        ++    W +++A+ ++++ + ++P + + LKLS G   RFEV   +F  LR+ V+ +LK + +L+ R
Sbjct:   71 LGVSANLPEEQLGALLAGM-HTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPL-LDSVAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKEMADLEKR 217          
BLAST of SMED30001889 vs. Ensembl Human
Match: COMMD5 (COMM domain containing 5 [Source:HGNC Symbol;Acc:HGNC:17902])

HSP 1 Score: 63.5438 bits (153), Expect = 2.068e-11
Identity = 35/149 (23.49%), Postives = 72/149 (48.32%), Query Frame = 3
Query:  231 VGLCRRICENSSGSSFFSMTYLLFKQIIKLPENKVNESSVRLSLEECKLPTSYIDIFMQNVLDKNAYVKLQLIAASSMVRNVYLVSSSWNINIALCSNSVGKIMEPVIALTLKLSSGKQLRFEVNAKQFHNLRFQVSNILKSIINLQNR 677
            +G+   + E   G+    M + L +Q ++LP   +   + R  L+E  +P   +      V      + L  +A        ++    W +++A+ ++++ + ++P + + LKLS G   RFEV   +F  LR+ V+ +LK + +L+ R
Sbjct:   71 LGVSANLPEEQLGALLAGM-HTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPL-LDSVAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKEMADLEKR 217          
BLAST of SMED30001889 vs. Ensembl Zebrafish
Match: commd5 (COMM domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-040801-71])

HSP 1 Score: 56.6102 bits (135), Expect = 3.011e-9
Identity = 24/66 (36.36%), Postives = 44/66 (66.67%), Query Frame = 3
Query:  495 WNINIALCSNSVGKIMEPVIALTLKLSSGKQLRFEVNAKQFHNLRFQVSNILKSIINLQNRQVLKI 692
            W +++A+ ++S+ + ++P I + +KLS G   +FEV   +F  LR+ VS ILK + +++ R +LKI
Sbjct:  145 WRVDVAISTSSLSRALQPSILMQMKLSDGHTHQFEVPVAKFQELRYNVSLILKEMNDIEKRSILKI 210          
BLAST of SMED30001889 vs. Ensembl Xenopus
Match: ENSXETT00000045522.1 (COMM domain containing 5 [Source:NCBI gene;Acc:100380154])

HSP 1 Score: 78.9518 bits (193), Expect = 6.209e-17
Identity = 56/196 (28.57%), Postives = 102/196 (52.04%), Query Frame = 3
Query:  132 KIPLLWRTAKQY----PQDKYKLVFKAVRRSIANQPDVGLCRRICENSSGS----SFF-SMTYLLFKQIIKLPENKVNESSVRLSLEECKLPTSYIDIFMQNVLDKNAYVKLQLIAASSMVRNVYLVSSSWNINIALCSNSVGKIMEPVIALTLKLSSGKQLRFEVNAKQFHNLRFQVSNILKSIINLQNRQVLKI 692
            +IP+   T  +Y     +D ++ + KAV  ++  +      + I EN+  S    SF  S  Y L K  ++LP + + +   +  L++ ++P  +I+ F  N++  N    L+  A    VR   L    W +++A+ ++S+ + ++P I + LKLS G   RFEV   +F  LR+ V+ ILK + +L+ R +L+I
Sbjct:   27 RIPVEVETMVKYMKDLDKDTFRKILKAVVGALEGKDSRESVQLILENTLISEEKLSFLISGAYTLLKVALRLPVSTLKQEVFKEDLKDLRIPDDFIEDF-ANIVYGNRRPILENAALKHGVRLPALEDMRWRVDVAISTSSLSRALQPSILVQLKLSDGTSHRFEVPVAKFQELRYNVALILKEMNDLEKRSILRI 221          
BLAST of SMED30001889 vs. Ensembl Mouse
Match: Commd5 (COMM domain containing 5 [Source:MGI Symbol;Acc:MGI:1913648])

HSP 1 Score: 53.9138 bits (128), Expect = 3.304e-8
Identity = 38/163 (23.31%), Postives = 76/163 (46.63%), Query Frame = 3
Query:  240 CRRICENSSGSS---------FFSMTYLLFKQIIKLPENKVNESSVRLSLEECKLPTSYIDIF-------MQNVLDKNAYVKLQLIAASSMVRNVYLVSS-SWNINIALCSNSVGKIMEPVIALTLKLSSGKQLRFEVNAKQFHNLRFQVSNILKSIINLQNR 677
            CR   ++   S+           + T+ L +Q ++LP   +   + +  L+E  +P   I           + +LD  A  +      SS+ R    VS+  W +++A+ +++  + ++P + + LKL+ G   RFEV   +F  LR+ V+ +LK +  L+ +
Sbjct:   64 CREAVQHLGASANLSEERLAVLLAGTHTLLQQALRLPPASLKPDAFQDELQELGIPQDMIGDLASLAFGSQRPLLDSVAQQQ-----GSSLPR----VSNFRWRVDVAISTSAQSRSLQPSVLMQLKLTDGSAHRFEVPIAKFQELRYSVALVLKEMAELERK 217          
BLAST of SMED30001889 vs. Ensembl Mouse
Match: Commd5 (COMM domain containing 5 [Source:MGI Symbol;Acc:MGI:1913648])

HSP 1 Score: 53.9138 bits (128), Expect = 3.304e-8
Identity = 38/163 (23.31%), Postives = 76/163 (46.63%), Query Frame = 3
Query:  240 CRRICENSSGSS---------FFSMTYLLFKQIIKLPENKVNESSVRLSLEECKLPTSYIDIF-------MQNVLDKNAYVKLQLIAASSMVRNVYLVSS-SWNINIALCSNSVGKIMEPVIALTLKLSSGKQLRFEVNAKQFHNLRFQVSNILKSIINLQNR 677
            CR   ++   S+           + T+ L +Q ++LP   +   + +  L+E  +P   I           + +LD  A  +      SS+ R    VS+  W +++A+ +++  + ++P + + LKL+ G   RFEV   +F  LR+ V+ +LK +  L+ +
Sbjct:   64 CREAVQHLGASANLSEERLAVLLAGTHTLLQQALRLPPASLKPDAFQDELQELGIPQDMIGDLASLAFGSQRPLLDSVAQQQ-----GSSLPR----VSNFRWRVDVAISTSAQSRSLQPSVLMQLKLTDGSAHRFEVPIAKFQELRYSVALVLKEMAELERK 217          
BLAST of SMED30001889 vs. UniProt/SwissProt
Match: sp|Q5E9K1|COMD5_BOVIN (COMM domain-containing protein 5 OS=Bos taurus OX=9913 GN=COMMD5 PE=2 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.196e-11
Identity = 33/136 (24.26%), Postives = 72/136 (52.94%), Query Frame = 3
Query:  270 SSFFSMTYLLFKQIIKLPENKVNESSVRLSLEECKLPTSYIDIFMQNVLDKNAYVKLQLIAASSMVRNVYLVSSSWNINIALCSNSVGKIMEPVIALTLKLSSGKQLRFEVNAKQFHNLRFQVSNILKSIINLQNR 677
             +  + T+ L +Q ++LP   +   + +  L+E  +P   + + + +V+  +    L  +A        ++    W +++A+ ++++ + ++P + + LKLS G  LRFEV   +F  LRF V+ +LK + +L+ R
Sbjct:   83 GALIAGTHTLLQQALRLPPASLKPDTFKNQLQELCIPQDLV-VDLASVVFGSQRPLLDSVARQQGAWLPHIADFRWRVDVAISTSALARSLQPSVLMHLKLSDGSALRFEVPTAKFQELRFAVALVLKEMADLEKR 217          
BLAST of SMED30001889 vs. UniProt/SwissProt
Match: sp|Q9GZQ3|COMD5_HUMAN (COMM domain-containing protein 5 OS=Homo sapiens OX=9606 GN=COMMD5 PE=1 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 9.933e-11
Identity = 35/149 (23.49%), Postives = 72/149 (48.32%), Query Frame = 3
Query:  231 VGLCRRICENSSGSSFFSMTYLLFKQIIKLPENKVNESSVRLSLEECKLPTSYIDIFMQNVLDKNAYVKLQLIAASSMVRNVYLVSSSWNINIALCSNSVGKIMEPVIALTLKLSSGKQLRFEVNAKQFHNLRFQVSNILKSIINLQNR 677
            +G+   + E   G+    M + L +Q ++LP   +   + R  L+E  +P   +      V      + L  +A        ++    W +++A+ ++++ + ++P + + LKLS G   RFEV   +F  LR+ V+ +LK + +L+ R
Sbjct:   71 LGVSANLPEEQLGALLAGM-HTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPL-LDSVAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKEMADLEKR 217          
BLAST of SMED30001889 vs. UniProt/SwissProt
Match: sp|Q9ERR2|COMD5_RAT (COMM domain-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Commd5 PE=2 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 3.006e-8
Identity = 37/162 (22.84%), Postives = 72/162 (44.44%), Query Frame = 3
Query:  240 CRRICENSSGSS---------FFSMTYLLFKQIIKLPENKVNESSVRLSLEECKLPTSYIDIF-------MQNVLDKNAYVKLQLIAASSMVRNVYLVSSSWNINIALCSNSVGKIMEPVIALTLKLSSGKQLRFEVNAKQFHNLRFQVSNILKSIINLQNR 677
            CR   E    S+           + T+ L +Q ++LP   +   + +  L+E  +P   I           + +LD  A  +      SS+    Y     W +++A+ +++  + ++P + + LKL+ G   RFEV   +F  LR+ V+ +LK +  L+ +
Sbjct:   64 CREAVEQLGASANLSEERLAVLLAGTHTLLQQALRLPPASLKPDAFQEELQELGIPQDLIGDLASLAFGSQRPLLDSVAQQQ-----GSSLPHVSYF---RWRVDVAISTSAQSRSLQPSVLMQLKLTDGSAHRFEVPIAKFQELRYSVALVLKEMAELEKK 217          
BLAST of SMED30001889 vs. UniProt/SwissProt
Match: sp|Q8R395|COMD5_MOUSE (COMM domain-containing protein 5 OS=Mus musculus OX=10090 GN=Commd5 PE=1 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 1.966e-7
Identity = 38/163 (23.31%), Postives = 76/163 (46.63%), Query Frame = 3
Query:  240 CRRICENSSGSS---------FFSMTYLLFKQIIKLPENKVNESSVRLSLEECKLPTSYIDIF-------MQNVLDKNAYVKLQLIAASSMVRNVYLVSS-SWNINIALCSNSVGKIMEPVIALTLKLSSGKQLRFEVNAKQFHNLRFQVSNILKSIINLQNR 677
            CR   ++   S+           + T+ L +Q ++LP   +   + +  L+E  +P   I           + +LD  A  +      SS+ R    VS+  W +++A+ +++  + ++P + + LKL+ G   RFEV   +F  LR+ V+ +LK +  L+ +
Sbjct:   64 CREAVQHLGASANLSEERLAVLLAGTHTLLQQALRLPPASLKPDAFQDELQELGIPQDMIGDLASLAFGSQRPLLDSVAQQQ-----GSSLPR----VSNFRWRVDVAISTSAQSRSLQPSVLMQLKLTDGSAHRFEVPIAKFQELRYSVALVLKEMAELERK 217          
BLAST of SMED30001889 vs. TrEMBL
Match: A0A4W5LHT8 (COMM domain containing 5 OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.962e-16
Identity = 53/192 (27.60%), Postives = 100/192 (52.08%), Query Frame = 3
Query:  132 KIPLLWRTAKQYPQDKYKLVFKAVRRSIANQPDVGLCRRICENSSG-----SSFFSMTYLLFKQIIKLPENKVNESSVRLSLEECKLPTSYIDIFMQNVLDKNAYVKLQLIAASSMVRNVYLVSSSWNINIALCSNSVGKIMEPVIALTLKLSSGKQLRFEVNAKQFHNLRFQVSNILKSIINLQNRQVLKI 692
            +I ++ +  K   Q+ ++ + KAV  +I  +      + I EN++      S   +  Y L K+ +++P + + +   +  L E ++P  +I  F  +V+  N    L+ +A     R   L    W +++A+ ++S+ + ++P I + +KLS GK  RFEV   +F  LR+ V+ ILK + +L+ R VLKI
Sbjct:   26 EIEIMAKQLKDLDQEMFRKILKAVVSAIEGKDCREAMKAIAENAALPEERLSYVVAGMYRLLKEALRIPTSSLKQEVFKEDLRELRIPEEFITDFA-SVVFGNRRTALEAVATQQGPRLPSLKDFRWRVDVAISTSSLARALQPSILMQMKLSDGKAHRFEVPVSKFQELRYNVALILKEMNDLEKRSVLKI 216          
BLAST of SMED30001889 vs. TrEMBL
Match: B5X6J0 (COMM domain-containing protein 5 OS=Salmo salar OX=8030 GN=COMD5 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 6.349e-16
Identity = 53/192 (27.60%), Postives = 100/192 (52.08%), Query Frame = 3
Query:  132 KIPLLWRTAKQYPQDKYKLVFKAVRRSIANQPDVGLCRRICENSSG-----SSFFSMTYLLFKQIIKLPENKVNESSVRLSLEECKLPTSYIDIFMQNVLDKNAYVKLQLIAASSMVRNVYLVSSSWNINIALCSNSVGKIMEPVIALTLKLSSGKQLRFEVNAKQFHNLRFQVSNILKSIINLQNRQVLKI 692
            +I ++ +  K   Q+ ++ + KAV  +I  +      + I EN++      S   +  Y L K+ +++P + + +   +  L E ++P  +I  F  +V+  N    L+ +A     R   L    W +++A+ ++S+ + ++P I + +KLS GK  RFEV   +F  LR+ V+ ILK + +L+ R VLKI
Sbjct:   26 EIEIMAKQLKDLDQEMFRKILKAVVSAIEGKDCREAMKVIAENAALPEERLSYVVAGMYRLLKEALRIPTSSLKQEVFKEDLRELRIPEEFITDFA-SVVFGNRRTALEAVATQQGPRLPSLKDFRWRVDVAISTSSLARALQPSILMQMKLSDGKAHRFEVPVSKFQELRYNVALILKEMNDLEKRSVLKI 216          
BLAST of SMED30001889 vs. TrEMBL
Match: C1BI65 (COMM domain-containing protein 5 OS=Oncorhynchus mykiss OX=8022 GN=COMD5 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.354e-15
Identity = 52/192 (27.08%), Postives = 99/192 (51.56%), Query Frame = 3
Query:  132 KIPLLWRTAKQYPQDKYKLVFKAVRRSIANQPDVGLCRRICENSSG-----SSFFSMTYLLFKQIIKLPENKVNESSVRLSLEECKLPTSYIDIFMQNVLDKNAYVKLQLIAASSMVRNVYLVSSSWNINIALCSNSVGKIMEPVIALTLKLSSGKQLRFEVNAKQFHNLRFQVSNILKSIINLQNRQVLKI 692
            +I ++ +  K   Q+ ++ + KAV  +I  +      + I EN++      S   +  Y L K+ +++P + + +   +  L E ++P  +I  F  +V+  N    L+ +A     R   L    W +++A+ ++S+ + ++P I + +KLS GK  RFEV   +F  LR+ V+ ILK + +L+ R VL I
Sbjct:   26 EIEIMAKQLKDLDQEMFRKILKAVVSAIEGKDCRDAMKAIAENAAVPEERLSYVVAGMYRLLKEALRIPTSSLKQEVFKEDLRELRIPEEFITDFA-SVVFGNRRTALEAVATQQGPRLPSLKDFRWRVDVAISTSSLARALQPSILMQMKLSDGKAHRFEVPVSKFQELRYNVALILKEMNDLEKRSVLSI 216          
BLAST of SMED30001889 vs. TrEMBL
Match: A0A060XXQ1 (COMM domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00047782001 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.476e-15
Identity = 52/192 (27.08%), Postives = 99/192 (51.56%), Query Frame = 3
Query:  132 KIPLLWRTAKQYPQDKYKLVFKAVRRSIANQPDVGLCRRICENSSG-----SSFFSMTYLLFKQIIKLPENKVNESSVRLSLEECKLPTSYIDIFMQNVLDKNAYVKLQLIAASSMVRNVYLVSSSWNINIALCSNSVGKIMEPVIALTLKLSSGKQLRFEVNAKQFHNLRFQVSNILKSIINLQNRQVLKI 692
            +I ++ +  K   Q+ ++ + KAV  +I  +      + I EN++      S   +  Y L K+ +++P + + +   +  L E ++P  +I  F  +V+  N    L+ +A     R   L    W +++A+ ++S+ + ++P I + +KLS GK  RFEV   +F  LR+ V+ ILK + +L+ R VL I
Sbjct:   26 EIEIMAKQLKDLDQEMFRKILKAVVSAIEGKDCREAMKAIAENAAVPEERLSYVVAGMYRLLKEALRIPTSSLKQEVFKEDLRELRIPEEFITDFA-SVVFGNRRTALEAVATQQGPRLPSLKDFRWRVDVAISTSSLARALQPSILMQMKLSDGKAHRFEVPVSKFQELRYNVALILKEMNDLEKRSVLNI 216          
BLAST of SMED30001889 vs. TrEMBL
Match: A0A3M6T8C9 (COMM domain-containing protein OS=Pocillopora damicornis OX=46731 GN=pdam_00004318 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.386e-14
Identity = 52/200 (26.00%), Postives = 100/200 (50.00%), Query Frame = 3
Query:  111 LPDSVIEKIPLLWRTAKQYPQDKYKLVFKAVRRSIANQPDVGLCRRICENSSG----SSFFSMTYLLFKQIIKLPENKVNESSVRLSLEECKLPTSYIDIFMQNVLDKNAYVKLQLIAASSMVRN--VYLVSSSWNINIALCSNSVGKIMEPVIALTLKLSSGKQLRFEVNAKQFHNLRFQVSNILKSIINLQNRQVLKI 692
            +PD +   IP L +  K   +   +++   +   +   PD GL +++   +      SS ++  Y L +  ++LP+  +     +  L E K+P   I      V  +    +L   AA+   RN    L S  W +++A+ ++++ +++EP + + LKLS GK   FEV+  +FH LR+ V+ +LK +  ++ + +LKI
Sbjct:   24 IPDEIKRMIPHLTKIDKALFRKILQVIISVLEGKV---PDDGLLQKLQSETVTEDVISSLYAGLYSLLRSALRLPQTSLKPEQFKADLGELKIPAELIPDLSSVVFGEK---RLAFDAAALQNRNHLPTLDSLRWRVDVAISTSALNRVLEPTVLMELKLSDGKVHTFEVSLSKFHELRYNVAYVLKEMEEIEKKSILKI 217          
BLAST of SMED30001889 vs. Ensembl Cavefish
Match: commd5 (COMM domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-040801-71])

HSP 1 Score: 67.3958 bits (163), Expect = 3.233e-13
Identity = 48/188 (25.53%), Postives = 91/188 (48.40%), Query Frame = 3
Query:  132 KIPLLWRTAKQYPQDKYKLVFKAVRRSIANQPDVGLCRRICENSSGSSFFSMTYLLFKQIIKLPENKVNESSVRLSLEECKLPTSYI-DIFMQNVLDKNAYVKLQLIAASSMVRNVYLVSSSWNINIALCSNSVGKIMEPVIALTLKLSSGKQLRFEVNAKQFHNLRFQVSNILKSIINLQNRQVLKI 692
            +IP    T  +  +D  K +F+ + + + +  +   C    E  S     S  + L ++ ++ P + V +   +  L E ++   +I DI   +V+  N    L         R   L+   W +++A+ ++S+ + ++P + + LKLS G   RFEV   +F  LR+ V+ ILK + +L+ R +LKI
Sbjct:   11 RIPAEVETLSKDLKDLDKELFRKILKVVVSAVEGKDCGEAMEKLS--RIVSGLFKLLREALRFPGSSVKQEGFKEDLRELRISEEFIADI--ASVVFGNRRSALDAAVTQRGPRLPSLMEFRWRVDVAISTSSLARALQPSVLMQLKLSDGNVHRFEVPVSKFQELRYNVALILKEMNDLEKRSILKI 194          
BLAST of SMED30001889 vs. Ensembl Cavefish
Match: commd5 (COMM domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-040801-71])

HSP 1 Score: 66.2402 bits (160), Expect = 8.491e-13
Identity = 40/142 (28.17%), Postives = 73/142 (51.41%), Query Frame = 3
Query:  270 SSFFSMTYLLFKQIIKLPENKVNESSVRLSLEECKLPTSYI-DIFMQNVLDKNAYVKLQLIAASSMVRNVYLVSSSWNINIALCSNSVGKIMEPVIALTLKLSSGKQLRFEVNAKQFHNLRFQVSNILKSIINLQNRQVLKI 692
            S   S  + L ++ ++ P + V +   +  L E ++   +I DI   +V+  N    L         R   L+   W +++A+ ++S+ + ++P + + LKLS G   RFEV   +F  LR+ V+ ILK + +L+ R +LKI
Sbjct:   58 SRIVSGLFKLLREALRFPGSSVKQEGFKEDLRELRISEEFIADI--ASVVFGNRRSALDAAVTQRGPRLPSLMEFRWRVDVAISTSSLARALQPSVLMQLKLSDGNVHRFEVPVSKFQELRYNVALILKEMNDLEKRSILKI 197          
BLAST of SMED30001889 vs. Ensembl Nematostella
Match: EDO40800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S655])

HSP 1 Score: 67.781 bits (164), Expect = 1.254e-13
Identity = 40/142 (28.17%), Postives = 78/142 (54.93%), Query Frame = 3
Query:  270 SSFFSMTYLLFKQIIKLPENKVNESSVRLSLEECKLPTSYI-DIFMQNVLDKNAYVKLQLIAASSMVRNVYLVSSSWNINIALCSNSVGKIMEPVIALTLKLSSGKQLRFEVNAKQFHNLRFQVSNILKSIINLQNRQVLKI 692
            S+ FS  Y L    ++LP   +     + +L E ++P  +I DI   +V+      +L+  A  +  R   L +  W +++A+ ++++ + +EP I +  KLS+G+   FEV   +FH LR+ V+ +LK + +++ + +LKI
Sbjct:   80 SAVFSGLYTLLTSALRLPLKSLKAEQFKANLTEIRIPPEFIPDI--SSVVFGEKRQQLEKRALENRCRLPKLDALRWRVDVAISTSALNRSLEPSIMMETKLSNGETHTFEVPVTKFHQLRYNVAYVLKEMEDVEKKNILKI 219          
BLAST of SMED30001889 vs. Ensembl Medaka
Match: commd5 (COMM domain-containing protein 5 [Source:NCBI gene;Acc:101158778])

HSP 1 Score: 76.2554 bits (186), Expect = 2.770e-16
Identity = 48/195 (24.62%), Postives = 98/195 (50.26%), Query Frame = 3
Query:  132 KIPLLWRTAKQYPQDKYKLVFKAVRRSIANQPDVGLCRRICENS-----SGSSFFSMTYLLFKQIIKLPENKVNESSVRLSLEECKLPTSYIDIFMQNVLDKNAYVKLQLIAASSMVRNVYLVSSS---WNINIALCSNSVGKIMEPVIALTLKLSSGKQLRFEVNAKQFHNLRFQVSNILKSIINLQNRQVLKI 692
            +I  + R+ K   QD ++ + KAV  ++  +      R I E +       S   +  + +  +  ++P   + + + +  L E ++P  +I  F   V           + A+S+ ++ +L +     W +++A+ ++S+ + ++P + + +KLS GK  RFEV   +FH LR+ V+ ILK + +L+ R +LKI
Sbjct:   19 EIESMSRSLKDVDQDLFRKLLKAVVSALEGKDCREAMRSIAETTVIPQERLSHIIAGMHRVLSEATRIPAALLKQEAFKEDLRELRIPEDFITDFCSVVFGSRRAA----LEAASLQKDPHLPTVDEFKWRVDVAISTSSLARALQPSVLMQMKLSDGKFHRFEVPVTKFHELRYNVALILKEMNDLEKRSILKI 209          
BLAST of SMED30001889 vs. Planmine SMEST
Match: SMESG000021903.1 (SMESG000021903.1)

HSP 1 Score: 436.032 bits (1120), Expect = 5.207e-157
Identity = 215/217 (99.08%), Postives = 216/217 (99.54%), Query Frame = 3
Query:   48 MTLYQQKNVMSYSSNVIIDNILPDSVIEKIPLLWRTAKQYPQDKYKLVFKAVRRSIANQPDVGLCRRICENSSGSSFFSMTYLLFKQIIKLPENKVNESSVRLSLEECKLPTSYIDIFMQNVLDKNAYVKLQLIAASSMVRNVYLVSSSWNINIALCSNSVGKIMEPVIALTLKLSSGKQLRFEVNAKQFHNLRFQVSNILKSIINLQNRQVLKIGT 698
            MTLYQQKNVMSYSSNVIIDNILPDSVIEKIPLLWRTAKQYPQDKYKLVFKAVRRSIANQPDVGLCRRICENSSGSSFFSMTYLLFKQIIKLPENKVNESSVRLSLEECKLPTSYIDIFMQNVLDKNAYVKLQLIA SSMVRNVYLVSSSWNINIALCSNSVGKIMEP+IALTLKLSSGKQLRFEVNAKQFHNLRFQVSNILKSIINLQNRQVLKIGT
Sbjct:    1 MTLYQQKNVMSYSSNVIIDNILPDSVIEKIPLLWRTAKQYPQDKYKLVFKAVRRSIANQPDVGLCRRICENSSGSSFFSMTYLLFKQIIKLPENKVNESSVRLSLEECKLPTSYIDIFMQNVLDKNAYVKLQLIATSSMVRNVYLVSSSWNINIALCSNSVGKIMEPIIALTLKLSSGKQLRFEVNAKQFHNLRFQVSNILKSIINLQNRQVLKIGT 217          
The following BLAST results are available for this feature:
BLAST of SMED30001889 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COMMD59.427e-1223.49COMM domain containing 5 [Source:HGNC Symbol;Acc:H... [more]
COMMD52.068e-1123.49COMM domain containing 5 [Source:HGNC Symbol;Acc:H... [more]
COMMD52.068e-1123.49COMM domain containing 5 [Source:HGNC Symbol;Acc:H... [more]
COMMD52.068e-1123.49COMM domain containing 5 [Source:HGNC Symbol;Acc:H... [more]
COMMD52.068e-1123.49COMM domain containing 5 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of SMED30001889 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001889 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001889 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
commd53.011e-936.36COMM domain containing 5 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of SMED30001889 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000045522.16.209e-1728.57COMM domain containing 5 [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of SMED30001889 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Commd53.304e-823.31COMM domain containing 5 [Source:MGI Symbol;Acc:MG... [more]
Commd53.304e-823.31COMM domain containing 5 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of SMED30001889 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q5E9K1|COMD5_BOVIN1.196e-1124.26COMM domain-containing protein 5 OS=Bos taurus OX=... [more]
sp|Q9GZQ3|COMD5_HUMAN9.933e-1123.49COMM domain-containing protein 5 OS=Homo sapiens O... [more]
sp|Q9ERR2|COMD5_RAT3.006e-822.84COMM domain-containing protein 5 OS=Rattus norvegi... [more]
sp|Q8R395|COMD5_MOUSE1.966e-723.31COMM domain-containing protein 5 OS=Mus musculus O... [more]
back to top
BLAST of SMED30001889 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4W5LHT83.962e-1627.60COMM domain containing 5 OS=Hucho hucho OX=62062 P... [more]
B5X6J06.349e-1627.60COMM domain-containing protein 5 OS=Salmo salar OX... [more]
C1BI651.354e-1527.08COMM domain-containing protein 5 OS=Oncorhynchus m... [more]
A0A060XXQ12.476e-1527.08COMM domain-containing protein OS=Oncorhynchus myk... [more]
A0A3M6T8C91.386e-1426.00COMM domain-containing protein OS=Pocillopora dami... [more]
back to top
BLAST of SMED30001889 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
commd53.233e-1325.53COMM domain containing 5 [Source:ZFIN;Acc:ZDB-GENE... [more]
commd58.491e-1328.17COMM domain containing 5 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of SMED30001889 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001889 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001889 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO408001.254e-1328.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30001889 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
commd52.770e-1624.62COMM domain-containing protein 5 [Source:NCBI gene... [more]
back to top
BLAST of SMED30001889 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000021903.15.207e-15799.08SMESG000021903.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001889 ID=SMED30001889|Name=SMED30001889|organism=Schmidtea mediterranea sexual|type=transcript|length=831bp
CCTTTAAAGATTTAAATTGATCTAGTTTAATTAAATATTTTATTGAAATG
ACTCTTTACCAACAGAAAAATGTTATGTCTTATTCGAGTAACGTTATAAT
TGATAATATTTTACCAGACAGTGTTATCGAAAAAATTCCATTATTATGGC
GTACAGCTAAGCAATATCCTCAAGATAAATATAAATTAGTTTTTAAAGCT
GTTCGACGAAGTATAGCCAATCAACCCGACGTTGGATTATGTCGAAGGAT
TTGTGAAAATTCTTCTGGATCATCATTTTTTTCCATGACTTATTTATTGT
TCAAACAAATCATAAAATTACCAGAAAACAAAGTTAATGAATCTTCAGTG
CGTTTAAGTTTAGAAGAGTGCAAACTTCCTACTTCATATATTGATATATT
TATGCAAAATGTTTTGGATAAGAACGCATACGTGAAATTGCAATTAATTG
CAGCATCTTCTATGGTTAGGAATGTATATCTTGTTAGTTCGTCTTGGAAT
ATTAACATCGCCCTGTGTTCCAATTCTGTTGGTAAGATAATGGAGCCGGT
AATCGCACTGACATTGAAACTGTCATCGGGCAAGCAGTTGAGATTCGAGG
TGAACGCAAAGCAATTCCACAACCTGCGGTTCCAGGTGTCAAACATTCTC
AAGTCCATTATCAATTTGCAGAATCGGCAAGTGCTCAAGATTGGAACGTG
AATACCATTGATCCAGTCTTCATCGGTAGTTGATTTGTATTGATTGTCCA
CCAATTGATTGATTTGAATACATTTTTATGTCGTTTTCCGTTTCTATGAA
TTTTAATCACTGTTGCCATAGTTATTTCTGG
back to top

protein sequence of SMED30001889-orf-1

>SMED30001889-orf-1 ID=SMED30001889-orf-1|Name=SMED30001889-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=218bp
MTLYQQKNVMSYSSNVIIDNILPDSVIEKIPLLWRTAKQYPQDKYKLVFK
AVRRSIANQPDVGLCRRICENSSGSSFFSMTYLLFKQIIKLPENKVNESS
VRLSLEECKLPTSYIDIFMQNVLDKNAYVKLQLIAASSMVRNVYLVSSSW
NINIALCSNSVGKIMEPVIALTLKLSSGKQLRFEVNAKQFHNLRFQVSNI
LKSIINLQNRQVLKIGT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR017920COMM
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated