Potassium voltage-gated channel protein

Overview
NamePotassium voltage-gated channel protein
Smed IDSMED30001885
Length (bp)2071
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Potassium voltage-gated channel protein (SMED30001885) t-SNE clustered cells

Violin plots show distribution of expression levels for Potassium voltage-gated channel protein (SMED30001885) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Potassium voltage-gated channel protein (SMED30001885) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Potassium voltage-gated channel protein (SMED30001885) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001885

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30001885h1SMcG0007446 dd_Smed_v4_9740_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Potassium voltage-gated channel protein vs. Ensembl Human
Match: KCNC1 (potassium voltage-gated channel subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:6233])

HSP 1 Score: 389.423 bits (999), Expect = 1.046e-127
Identity = 204/444 (45.95%), Postives = 279/444 (62.84%), Query Frame = 2
Query:  251 DSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALA----NYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDT--------------DKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFR-IPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKN-------HFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 1504
            D   R+++N+GG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHPGVF+ +LNYYRTGKLH P DVCGPLYEEEL FWG+D   VEPCCWMTY +HR  EE L       +D               D   + ++  +  L +        +W + Q +IWA+FEDPYSS  ++ VA  ++FFI++SI +FCL+T   F  I N   I    N +        +T    +Y+E +C +WFT E ++R +  P+K  F+K+ +NIIDF+A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER      +       HF +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVIFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Human
Match: KCNC1 (potassium voltage-gated channel subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:6233])

HSP 1 Score: 390.578 bits (1002), Expect = 4.389e-127
Identity = 204/444 (45.95%), Postives = 279/444 (62.84%), Query Frame = 2
Query:  251 DSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALA----NYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDT--------------DKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFR-IPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKN-------HFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 1504
            D   R+++N+GG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHPGVF+ +LNYYRTGKLH P DVCGPLYEEEL FWG+D   VEPCCWMTY +HR  EE L       +D               D   + ++  +  L +        +W + Q +IWA+FEDPYSS  ++ VA  ++FFI++SI +FCL+T   F  I N   I    N +        +T    +Y+E +C +WFT E ++R +  P+K  F+K+ +NIIDF+A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER      +       HF +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVIFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Human
Match: KCNC2 (potassium voltage-gated channel subfamily C member 2 [Source:HGNC Symbol;Acc:HGNC:6234])

HSP 1 Score: 372.089 bits (954), Expect = 2.780e-120
Identity = 209/445 (46.97%), Postives = 282/445 (63.37%), Query Frame = 2
Query:  386 EYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDID-IDTDKVSKDDLYAK-FGLEEKHQ----SGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKN-------HFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKTPAGLTPLLSNPPFSLK--NHPLNTIPSFT-VGNRNELL 1672
            E+FFDRHPGVF+ VLNYYRTGKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY +HR  EE L I    D I  D    +DL AK  G+E+        G    W +LQ ++WA+FEDPYSS +++ +A  ++FFI++SI +FCL+T   F I       V + +S  + +   +T    +YVE +C +WFT E ++R + +P+K  F+K+ +NIIDF+A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER      +        F +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P        PA   P  S+P F     N   N+  S T +G  N LL
Sbjct:  101 EFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEPVINGTS-VVLQYEIETDPALTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP--------PA---PQASSPTFCKTELNMACNSTQSDTCLGKDNRLL 533          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Human
Match: KCNC2 (potassium voltage-gated channel subfamily C member 2 [Source:HGNC Symbol;Acc:HGNC:6234])

HSP 1 Score: 372.089 bits (954), Expect = 5.707e-120
Identity = 209/445 (46.97%), Postives = 282/445 (63.37%), Query Frame = 2
Query:  386 EYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDID-IDTDKVSKDDLYAK-FGLEEKHQ----SGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKN-------HFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKTPAGLTPLLSNPPFSLK--NHPLNTIPSFT-VGNRNELL 1672
            E+FFDRHPGVF+ VLNYYRTGKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY +HR  EE L I    D I  D    +DL AK  G+E+        G    W +LQ ++WA+FEDPYSS +++ +A  ++FFI++SI +FCL+T   F I       V + +S  + +   +T    +YVE +C +WFT E ++R + +P+K  F+K+ +NIIDF+A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER      +        F +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P        PA   P  S+P F     N   N+  S T +G  N LL
Sbjct:  101 EFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEPVINGTS-VVLQYEIETDPALTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP--------PA---PQASSPTFCKTELNMACNSTQSDTCLGKDNRLL 533          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Human
Match: KCNC2 (potassium voltage-gated channel subfamily C member 2 [Source:HGNC Symbol;Acc:HGNC:6234])

HSP 1 Score: 372.474 bits (955), Expect = 9.586e-120
Identity = 209/445 (46.97%), Postives = 282/445 (63.37%), Query Frame = 2
Query:  386 EYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDID-IDTDKVSKDDLYAK-FGLEEKHQ----SGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKN-------HFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKTPAGLTPLLSNPPFSLK--NHPLNTIPSFT-VGNRNELL 1672
            E+FFDRHPGVF+ VLNYYRTGKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY +HR  EE L I    D I  D    +DL AK  G+E+        G    W +LQ ++WA+FEDPYSS +++ +A  ++FFI++SI +FCL+T   F I       V + +S  + +   +T    +YVE +C +WFT E ++R + +P+K  F+K+ +NIIDF+A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER      +        F +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P        PA   P  S+P F     N   N+  S T +G  N LL
Sbjct:  101 EFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEPVINGTS-VVLQYEIETDPALTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP--------PA---PQASSPTFCKTELNMACNSTQSDTCLGKDNRLL 533          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Celegans
Match: shw-3 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A0A3B1DVP6])

HSP 1 Score: 519.62 bits (1337), Expect = 4.095e-179
Identity = 264/447 (59.06%), Postives = 343/447 (76.73%), Query Frame = 2
Query:  248 MDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNL---HNISVSDNSSWA--------ISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESV 1555
            MDSE R+ILN+GG RHETYK TLKKIPATRLS+LT  LANYDPVLNEYFFDRHPGVF+Q+LNYYRTGKLHYP DVCGPL+EEEL++WGLDSN+ EPCCWMT +  R T++ L+ L+++DI+ D+    +LY +FG E+ + +  +  W+K++ +IW +F++P SS S++ +A I+VFF++ +I+ FCLKT    RIP L    N S +  S+ +        I K++ + H  F Y+E ICN+WFTIEI+ R    PS+F +L++PVNIID +A L+FY+D++ S    +        LEFFSIIRIMRLFKLT H +GL IL+HTFRAS KEL+LLVFFL + +V+FA+L+YYAER + N  N F SIP GLWWAIVTMTT+GYGD+ PHTY+G  +G++CA+ GVLTI+LPVPVIVSNF+MFYSHTQARSK+PKKRR VL ++ V
Sbjct:   22 MDSEYRIILNVGGVRHETYKHTLKKIPATRLSRLTTNLANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPLDVCGPLFEEELKYWGLDSNECEPCCWMTLSGTRDTQDVLKTLDELDIEVDQTEGPELYKRFGWEDDYHNDSLSAWQKIKPRIWRLFDEPNSSRSAQFIAAISVFFLITAIIVFCLKTHPGLRIPELAPFGNFSRNHRSTSSRIHPAQINIDKANSRPHPTFMYIETICNIWFTIEILARFSSCPSRFEYLRAPVNIIDIVATLTFYIDLLSSMFGATAD------LEFFSIIRIMRLFKLTHHNSGLKILMHTFRASAKELMLLVFFLVLGVVVFASLVYYAERVESNEDNQFVSIPIGLWWAIVTMTTIGYGDITPHTYLGRLIGSICALAGVLTIALPVPVIVSNFAMFYSHTQARSKMPKKRRGVLSMDQV 462          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Celegans
Match: shw-3 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A0A3B1DVP6])

HSP 1 Score: 519.62 bits (1337), Expect = 4.491e-179
Identity = 265/451 (58.76%), Postives = 344/451 (76.27%), Query Frame = 2
Query:  236 RGANMDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNL---HNISVSDNSSWA--------ISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESV 1555
            R   MDSE R+ILN+GG RHETYK TLKKIPATRLS+LT  LANYDPVLNEYFFDRHPGVF+Q+LNYYRTGKLHYP DVCGPL+EEEL++WGLDSN+ EPCCWMT +  R T++ L+ L+++DI+ D+    +LY +FG E+ + +  +  W+K++ +IW +F++P SS S++ +A I+VFF++ +I+ FCLKT    RIP L    N S +  S+ +        I K++ + H  F Y+E ICN+WFTIEI+ R    PS+F +L++PVNIID +A L+FY+D++ S    +        LEFFSIIRIMRLFKLT H +GL IL+HTFRAS KEL+LLVFFL + +V+FA+L+YYAER + N  N F SIP GLWWAIVTMTT+GYGD+ PHTY+G  +G++CA+ GVLTI+LPVPVIVSNF+MFYSHTQARSK+PKKRR VL ++ V
Sbjct:   15 RQTVMDSEYRIILNVGGVRHETYKHTLKKIPATRLSRLTTNLANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPLDVCGPLFEEELKYWGLDSNECEPCCWMTLSGTRDTQDVLKTLDELDIEVDQTEGPELYKRFGWEDDYHNDSLSAWQKIKPRIWRLFDEPNSSRSAQFIAAISVFFLITAIIVFCLKTHPGLRIPELAPFGNFSRNHRSTSSRIHPAQINIDKANSRPHPTFMYIETICNIWFTIEILARFSSCPSRFEYLRAPVNIIDIVATLTFYIDLLSSMFGATAD------LEFFSIIRIMRLFKLTHHNSGLKILMHTFRASAKELMLLVFFLVLGVVVFASLVYYAERVESNEDNQFVSIPIGLWWAIVTMTTIGYGDITPHTYLGRLIGSICALAGVLTIALPVPVIVSNFAMFYSHTQARSKMPKKRRGVLSMDQV 459          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Celegans
Match: shw-3 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A0A3B1DVP6])

HSP 1 Score: 518.85 bits (1335), Expect = 4.830e-179
Identity = 264/447 (59.06%), Postives = 343/447 (76.73%), Query Frame = 2
Query:  248 MDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNL---HNISVSDNSSWA--------ISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESV 1555
            MDSE R+ILN+GG RHETYK TLKKIPATRLS+LT  LANYDPVLNEYFFDRHPGVF+Q+LNYYRTGKLHYP DVCGPL+EEEL++WGLDSN+ EPCCWMT +  R T++ L+ L+++DI+ D+    +LY +FG E+ + +  +  W+K++ +IW +F++P SS S++ +A I+VFF++ +I+ FCLKT    RIP L    N S +  S+ +        I K++ + H  F Y+E ICN+WFTIEI+ R    PS+F +L++PVNIID +A L+FY+D++ S    +        LEFFSIIRIMRLFKLT H +GL IL+HTFRAS KEL+LLVFFL + +V+FA+L+YYAER + N  N F SIP GLWWAIVTMTT+GYGD+ PHTY+G  +G++CA+ GVLTI+LPVPVIVSNF+MFYSHTQARSK+PKKRR VL ++ V
Sbjct:    1 MDSEYRIILNVGGVRHETYKHTLKKIPATRLSRLTTNLANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPLDVCGPLFEEELKYWGLDSNECEPCCWMTLSGTRDTQDVLKTLDELDIEVDQTEGPELYKRFGWEDDYHNDSLSAWQKIKPRIWRLFDEPNSSRSAQFIAAISVFFLITAIIVFCLKTHPGLRIPELAPFGNFSRNHRSTSSRIHPAQINIDKANSRPHPTFMYIETICNIWFTIEILARFSSCPSRFEYLRAPVNIIDIVATLTFYIDLLSSMFGATAD------LEFFSIIRIMRLFKLTHHNSGLKILMHTFRASAKELMLLVFFLVLGVVVFASLVYYAERVESNEDNQFVSIPIGLWWAIVTMTTIGYGDITPHTYLGRLIGSICALAGVLTIALPVPVIVSNFAMFYSHTQARSKMPKKRRGVLSMDQV 441          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 520.39 bits (1339), Expect = 1.352e-177
Identity = 270/514 (52.53%), Postives = 366/514 (71.21%), Query Frame = 2
Query:  248 MDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISVSDNSSWA----------ISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRP-----KTPAGLTPLLSNPPFS-LKNHPLNTIPSFTVGNRNELLPILNPTGDTISTLRSSPKKYKAN 1741
            MD+E+RVILN+GG RHETY   LKKIPATRLS+LT  LANYDPVLNEYFFDRHPGVFS +LNYYRTGKLHYPT+VCGPL+EEELEFWGLD+NQVEPCCWMTYT+HR T++TL ++  +D+D D  +++++  KFG E+ + +G++  W++L+ ++WA+F++P+SS  +++++V+ + F++ISI+ FCLKT   FRIP++   +   N S            + K++ + H  F YVE + N+WF+ E + R +  P+   FL++PVN+IDF+A +SFY+D  L          N + +EFFSIIRI+RLFKLT+H  GL IL+ TF+AS +EL LLVFF+ + IVIFAAL+YYAER +HN +N F+SIP GLWWA++T+ T+G+GD+VP T +G  VG++CA+ GVLTI+LPVPVIVSNF+MFYSH QARSKLPKKRRRVL    ++P      T   ++ L    P S   ++P +  P     N   LL +  P G T       PKK   N
Sbjct:   97 MDTEHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCCWMTYTQHRDTQDTLAVIESLDLDGDPPTQEEIAKKFGWEDDYYTGNMSQWQRLKPRVWALFDEPWSSKYARVISVVNIIFVIISIVCFCLKTHPSFRIPDIDISTTMGNFSAPLNGVQMNNIYVGKTATRAHPSFFYVELLSNIWFSGEFLTRMVFCPNVATFLRTPVNLIDFIATVSFYIDWALDRTLSG---SNRDSVEFFSIIRILRLFKLTQHSTGLKILIQTFKASAQELFLLVFFVLLGIVIFAALVYYAERVEHNEENQFSSIPVGLWWAVITICTIGFGDLVPQTSLGRLVGSVCALMGVLTIALPVPVIVSNFAMFYSHAQARSKLPKKRRRVLQPHEIKPVVGRSTTAVMISALTQRGPVSGGGSNPSDGGPLSAFSNNTPLL-VCPPDGST------KPKKLSQN 600          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 508.449 bits (1308), Expect = 9.191e-175
Identity = 256/448 (57.14%), Postives = 344/448 (76.79%), Query Frame = 2
Query:  248 MDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNL---HNISVSDNSSW-----AISKSSPQT--HQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRP 1561
            MD+E+RVILN+GG RHETY   LKKIPATRLS+LT  LANYDPVLNEYFFDRHPGVFS +LNYYRTGKLHYPT+VCGPL+EEELEFWGLD+NQVEPCCWMTYT+HR T++TL ++  +D+D D  +++++  KFG E+ + +G++  W++L+ ++WA+F++P+SS  +++++ ++V FI+ S  SF LKT   F+IP++   +++ V D   +      I    P T  H  F YV+ ICN+WFTIE++IRSL  PS   F++SP+ IID ++  +F+ + +L  +    Q  +L  L+F S+I ++RLFKLT+H +GL IL+ TF+AS +EL LLVFF+ + IVIFAAL+YYAER Q N  N F SIP GLWW++VT++TVG+GDMVP TY+GM VG+LCA+ GVLTI+LPVPVIVSNFS  YSH+QAR+KLPKKRRRVL    V+P
Sbjct:    1 MDTEHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCCWMTYTQHRDTQDTLAVIESLDLDGDPPTQEEIAKKFGWEDDYYTGNMSQWQRLKPRVWALFDEPWSSKYARVISSLSVAFILASTCSFILKTDPSFQIPDIDVFYSLRVVDEGGFKNYHKTIGTDKPVTSPHPNFFYVDLICNIWFTIELLIRSLFCPSFHKFVRSPLTIIDVISTGAFFFESLLHAILI--QTGSLVTLDFLSMICVLRLFKLTQHFSGLKILIQTFKASAQELFLLVFFVILAIVIFAALVYYAERSQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQARAKLPKKRRRVLQAHEVKP 446          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0089275)

HSP 1 Score: 612.453 bits (1578), Expect = 0.000e+0
Identity = 303/453 (66.89%), Postives = 373/453 (82.34%), Query Frame = 2
Query:  245 NMDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISV---SDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVR----PKTPAGLT 1582
            NMDSENRV+LN+GG RHETYKATLKKIPATRLS+LTEALANYDP+LNEYFFDRHPGVF+QVLNYYRTGKLHYPTDVCGPL+EEELEFWGLDSNQVEPCCWMTYT+HR T+ETL +L+ +D+DT+K S+++L  KFG EE +  G I WW++++ +IW++F++PYSS ++K + V++VFFI ISILSFCLKT    R+P + NI+V   + ++ W + K+    H  F Y+E +CN WFT EI++R + +P+K+ F+KS VNIID++A LSFY+D++L     +  +EN ++LEFFSIIRIMRLFKLTRH +GL IL+ TFRAS KEL LLVFFL + IVIFA+L+YYAER Q N  N FNSIP GLWWA+VTMTTVGYGDM P TYIGM VGALCA+ GVLTI+LPVPVIVSNF+M+YSHTQAR+KLPKKRRRVLPVE  R    P  P G++
Sbjct:    5 NMDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRF--ASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPRLPGAPGGVS 455          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0332185)

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 303/453 (66.89%), Postives = 373/453 (82.34%), Query Frame = 2
Query:  245 NMDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISV---SDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVR----PKTPAGLT 1582
            NMDSENRV+LN+GG RHETYKATLKKIPATRLS+LTEALANYDP+LNEYFFDRHPGVF+QVLNYYRTGKLHYPTDVCGPL+EEELEFWGLDSNQVEPCCWMTYT+HR T+ETL +L+ +D+DT+K S+++L  KFG EE +  G I WW++++ +IW++F++PYSS ++K + V++VFFI ISILSFCLKT    R+P + NI+V   + ++ W + K+    H  F Y+E +CN WFT EI++R + +P+K+ F+KS VNIID++A LSFY+D++L     +  +EN ++LEFFSIIRIMRLFKLTRH +GL IL+ TFRAS KEL LLVFFL + IVIFA+L+YYAER Q N  N FNSIP GLWWA+VTMTTVGYGDM P TYIGM VGALCA+ GVLTI+LPVPVIVSNF+M+YSHTQAR+KLPKKRRRVLPVE  R    P  P G++
Sbjct:    5 NMDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRF--ASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPRLPGAPGGVS 455          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0289989)

HSP 1 Score: 611.298 bits (1575), Expect = 0.000e+0
Identity = 303/453 (66.89%), Postives = 373/453 (82.34%), Query Frame = 2
Query:  245 NMDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISV---SDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVR----PKTPAGLT 1582
            NMDSENRV+LN+GG RHETYKATLKKIPATRLS+LTEALANYDP+LNEYFFDRHPGVF+QVLNYYRTGKLHYPTDVCGPL+EEELEFWGLDSNQVEPCCWMTYT+HR T+ETL +L+ +D+DT+K S+++L  KFG EE +  G I WW++++ +IW++F++PYSS ++K + V++VFFI ISILSFCLKT    R+P + NI+V   + ++ W + K+    H  F Y+E +CN WFT EI++R + +P+K+ F+KS VNIID++A LSFY+D++L     +  +EN ++LEFFSIIRIMRLFKLTRH +GL IL+ TFRAS KEL LLVFFL + IVIFA+L+YYAER Q N  N FNSIP GLWWA+VTMTTVGYGDM P TYIGM VGALCA+ GVLTI+LPVPVIVSNF+M+YSHTQAR+KLPKKRRRVLPVE  R    P  P G++
Sbjct:   20 NMDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRF--ASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPRLPGAPGGVS 470          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0332184)

HSP 1 Score: 610.912 bits (1574), Expect = 0.000e+0
Identity = 311/504 (61.71%), Postives = 392/504 (77.78%), Query Frame = 2
Query:  245 NMDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISV---SDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVR----PKTPAGLTPLLSNPPFSLKNHPLNTIPSFTVGNRNELLPILNPTGDTISTLRSSPKKYK 1735
            NMDSENRV+LN+GG RHETYKATLKKIPATRLS+LTEALANYDP+LNEYFFDRHPGVF+QVLNYYRTGKLHYPTDVCGPL+EEELEFWGLDSNQVEPCCWMTYT+HR T+ETL +L+ +D+DT+K S+++L  KFG EE +  G I WW++++ +IW++F++PYSS ++K + V++VFFI ISILSFCLKT    R+P + NI+V   + ++ W + K+    H  F Y+E +CN WFT EI++R + +P+K+ F+KS VNIID++A LSFY+D++L     +  +EN ++LEFFSIIRIMRLFKLTRH +GL IL+ TFRAS KEL LLVFFL + IVIFA+L+YYAER Q N  N FNSIP GLWWA+VTMTTVGYGDM P TYIGM VGALCA+ GVLTI+LPVPVIVSNF+M+YSHTQAR+KLPKKRRRVLPVE  R    P  P G++     P     + P+ +  +      N+   +++P  D  +T+   P+  K
Sbjct:    5 NMDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRF--ASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPRLPGAPGGVSG-CGTPGSGPHSGPMGSGGTGPRRMNNKTKDLVSPKSDEYTTMIGKPRDGK 505          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0089274)

HSP 1 Score: 607.446 bits (1565), Expect = 0.000e+0
Identity = 303/453 (66.89%), Postives = 373/453 (82.34%), Query Frame = 2
Query:  245 NMDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISV---SDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVR----PKTPAGLT 1582
            NMDSENRV+LN+GG RHETYKATLKKIPATRLS+LTEALANYDP+LNEYFFDRHPGVF+QVLNYYRTGKLHYPTDVCGPL+EEELEFWGLDSNQVEPCCWMTYT+HR T+ETL +L+ +D+DT+K S+++L  KFG EE +  G I WW++++ +IW++F++PYSS ++K + V++VFFI ISILSFCLKT    R+P + NI+V   + ++ W + K+    H  F Y+E +CN WFT EI++R + +P+K+ F+KS VNIID++A LSFY+D++L     +  +EN ++LEFFSIIRIMRLFKLTRH +GL IL+ TFRAS KEL LLVFFL + IVIFA+L+YYAER Q N  N FNSIP GLWWA+VTMTTVGYGDM P TYIGM VGALCA+ GVLTI+LPVPVIVSNF+M+YSHTQAR+KLPKKRRRVLPVE  R    P  P G++
Sbjct:    5 NMDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRF--ASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPRLPGAPGGVS 455          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Zebrafish
Match: kcnc1a (potassium voltage-gated channel, Shaw-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-061220-10])

HSP 1 Score: 391.349 bits (1004), Expect = 1.307e-127
Identity = 208/445 (46.74%), Postives = 294/445 (66.07%), Query Frame = 2
Query:  251 DSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALA----NYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETL--------QILNDIDIDTDKVSKD-------DLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFR-IPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKN-------HFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 1504
            D ++RV++N+GG RH+TY++TL+ +P TRL+ L E  A    +YD  ++E+FFDRHPGVF+ +LNYYRTGKLH P DVCGPLYEEEL FWG+D   VEPCCWMTY +HR  EE L        ++ ND D+DT+ +          ++  +  + +   +    +W++ Q ++WA+FEDPYSS  ++ VA  ++FFI++SI +FCL+T   F  I N   ++  DN+S    ++  +T    +Y+E +C +WFT E ++R    P K  F+K+ +NIIDF+A+L FYL++ LS +  S   + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER   N  +       HF +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    5 DEKDRVVINVGGIRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDAQIDEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHREAEEALDSFGGGPVEMGND-DMDTEALGDPGDGDEELEMTKRLAVGDSPDTKGAGFWQRWQRRVWALFEDPYSSKYARWVAFASLFFILVSITTFCLETHEAFNPIINRTYVNTQDNTSRFHLET--ETVVYLTYIEGVCVVWFTFEFLMRVTFCPDKKKFIKNTLNIIDFVAILPFYLEVGLSGLSSSEAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPNDPRASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 446          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Zebrafish
Match: kcnc2 (potassium voltage-gated channel, Shaw-related subfamily, member 2 [Source:ZFIN;Acc:ZDB-GENE-070410-118])

HSP 1 Score: 389.808 bits (1000), Expect = 1.776e-127
Identity = 212/450 (47.11%), Postives = 285/450 (63.33%), Query Frame = 2
Query:  242 ANMDSENRVILNIGGFRHETYKATLKKIPATRLSKLTE---------------ALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAK-FGLEE-KHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHF-----RIPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKN-------HFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 1504
               D   RVILN+GG RHETY++TLK +P TRL+ L                     Y    NEYFFDRHPGVF+ VLNYYRTGKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY +HR  EE L +  ++++DT+   +DD Y K  G+E+     G +  W + Q  IW +F+DPYSS +++ +A  ++FFI++SI +FCL+T   F     +   L N +++D S     +   +T    +YVE +C LWFT E ++R   +P K  F+KS +NIIDF+A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER   +  +        F +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    2 GKFDERERVILNVGGTRHETYRSTLKTLPGTRLALLASESDLELVLDQLQQVPGFIEYSARSNEYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETDVEPCCWMTYRQHRDAEEALDVF-EMNVDTE---EDDEYGKRLGIEDVVSADGTVSRWRRWQPVIWNLFDDPYSSRAARFIAFASLFFIMVSITTFCLETHEAFNTIINKTDPLRNETLTDIS----QQYEIETDPALTYVEGVCVLWFTFEFLVRITFSPDKLEFIKSVLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPNDPTASHHTMFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMVVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 443          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Zebrafish
Match: kcnc1a (potassium voltage-gated channel, Shaw-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-061220-10])

HSP 1 Score: 391.349 bits (1004), Expect = 2.172e-127
Identity = 208/445 (46.74%), Postives = 294/445 (66.07%), Query Frame = 2
Query:  251 DSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALA----NYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETL--------QILNDIDIDTDKVSKD-------DLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFR-IPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKN-------HFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 1504
            D ++RV++N+GG RH+TY++TL+ +P TRL+ L E  A    +YD  ++E+FFDRHPGVF+ +LNYYRTGKLH P DVCGPLYEEEL FWG+D   VEPCCWMTY +HR  EE L        ++ ND D+DT+ +          ++  +  + +   +    +W++ Q ++WA+FEDPYSS  ++ VA  ++FFI++SI +FCL+T   F  I N   ++  DN+S    ++  +T    +Y+E +C +WFT E ++R    P K  F+K+ +NIIDF+A+L FYL++ LS +  S   + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER   N  +       HF +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    5 DEKDRVVINVGGIRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDAQIDEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHREAEEALDSFGGGPVEMGND-DMDTEALGDPGDGDEELEMTKRLAVGDSPDTKGAGFWQRWQRRVWALFEDPYSSKYARWVAFASLFFILVSITTFCLETHEAFNPIINRTYVNTQDNTSRFHLET--ETVVYLTYIEGVCVVWFTFEFLMRVTFCPDKKKFIKNTLNIIDFVAILPFYLEVGLSGLSSSEAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPNDPRASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 446          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Zebrafish
Match: kcnc1a (potassium voltage-gated channel, Shaw-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-061220-10])

HSP 1 Score: 390.963 bits (1003), Expect = 3.632e-127
Identity = 208/445 (46.74%), Postives = 294/445 (66.07%), Query Frame = 2
Query:  251 DSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALA----NYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETL--------QILNDIDIDTDKVSKD-------DLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFR-IPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKN-------HFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 1504
            D ++RV++N+GG RH+TY++TL+ +P TRL+ L E  A    +YD  ++E+FFDRHPGVF+ +LNYYRTGKLH P DVCGPLYEEEL FWG+D   VEPCCWMTY +HR  EE L        ++ ND D+DT+ +          ++  +  + +   +    +W++ Q ++WA+FEDPYSS  ++ VA  ++FFI++SI +FCL+T   F  I N   ++  DN+S    ++  +T    +Y+E +C +WFT E ++R    P K  F+K+ +NIIDF+A+L FYL++ LS +  S   + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER   N  +       HF +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    5 DEKDRVVINVGGIRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDAQIDEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHREAEEALDSFGGGPVEMGND-DMDTEALGDPGDGDEELEMTKRLAVGDSPDTKGAGFWQRWQRRVWALFEDPYSSKYARWVAFASLFFILVSITTFCLETHEAFNPIINRTYVNTQDNTSRFHLET--ETVVYLTYIEGVCVVWFTFEFLMRVTFCPDKKKFIKNTLNIIDFVAILPFYLEVGLSGLSSSEAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPNDPRASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 446          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Zebrafish
Match: kcnc2 (potassium voltage-gated channel, Shaw-related subfamily, member 2 [Source:ZFIN;Acc:ZDB-GENE-070410-118])

HSP 1 Score: 390.578 bits (1002), Expect = 3.942e-127
Identity = 212/450 (47.11%), Postives = 285/450 (63.33%), Query Frame = 2
Query:  242 ANMDSENRVILNIGGFRHETYKATLKKIPATRLSKLTE---------------ALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAK-FGLEE-KHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHF-----RIPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKN-------HFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 1504
               D   RVILN+GG RHETY++TLK +P TRL+ L                     Y    NEYFFDRHPGVF+ VLNYYRTGKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY +HR  EE L +  ++++DT+   +DD Y K  G+E+     G +  W + Q  IW +F+DPYSS +++ +A  ++FFI++SI +FCL+T   F     +   L N +++D S     +   +T    +YVE +C LWFT E ++R   +P K  F+KS +NIIDF+A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER   +  +        F +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    2 GKFDERERVILNVGGTRHETYRSTLKTLPGTRLALLASESDLELVLDQLQQVPGFIEYSARSNEYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETDVEPCCWMTYRQHRDAEEALDVF-EMNVDTE---EDDEYGKRLGIEDVVSADGTVSRWRRWQPVIWNLFDDPYSSRAARFIAFASLFFIMVSITTFCLETHEAFNTIINKTDPLRNETLTDIS----QQYEIETDPALTYVEGVCVLWFTFEFLVRITFSPDKLEFIKSVLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPNDPTASHHTMFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMVVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 443          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Xenopus
Match: KCNC2 (potassium channel, voltage gated Shaw related subfamily C, member 2 [Source:NCBI gene;Acc:100489216])

HSP 1 Score: 405.216 bits (1040), Expect = 5.260e-133
Identity = 212/461 (45.99%), Postives = 294/461 (63.77%), Query Frame = 2
Query:  242 ANMDSENRVILNIGGFRHETYKATLKKIPATRLSKLT--------------EALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVS-----KDDLYAKFGLEE-KHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKN-------HFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLP 1543
              +D   R+ILN+GG RHETY++TLK +P TRL+ L                   N     NE+FFDRHPGVF+ VLNYYRTGKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY +HR  EE L I    D+ T +       ++DL  +  +E+     G +  W +LQ ++WA+FEDPYSS +++ +A  ++FFI++SI +FCL+T   F    ++     +N +  IS    +T    +YVE +C +WFT E ++R +  P K  F+++ +NIIDF+A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER   +  +        F +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P
Sbjct:    2 GKIDENERIILNVGGTRHETYRSTLKTVPGTRLALLACESQSEQGLDQQTVSGSFNITSRGNEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLITGEPPPIDEYEEDLGKRLAIEDVVCPDGKVGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNTI-INKTETVNNGTELISLIEIETDPALTYVEGVCVVWFTFEFLVRVIFCPDKLEFIRNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPSDPSASKHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKYIP 461          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Xenopus
Match: KCNC2 (potassium channel, voltage gated Shaw related subfamily C, member 2 [Source:NCBI gene;Acc:100489216])

HSP 1 Score: 405.601 bits (1041), Expect = 7.248e-133
Identity = 212/461 (45.99%), Postives = 294/461 (63.77%), Query Frame = 2
Query:  242 ANMDSENRVILNIGGFRHETYKATLKKIPATRLSKLT--------------EALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVS-----KDDLYAKFGLEE-KHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKN-------HFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLP 1543
              +D   R+ILN+GG RHETY++TLK +P TRL+ L                   N     NE+FFDRHPGVF+ VLNYYRTGKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY +HR  EE L I    D+ T +       ++DL  +  +E+     G +  W +LQ ++WA+FEDPYSS +++ +A  ++FFI++SI +FCL+T   F    ++     +N +  IS    +T    +YVE +C +WFT E ++R +  P K  F+++ +NIIDF+A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER   +  +        F +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P
Sbjct:    2 GKIDENERIILNVGGTRHETYRSTLKTVPGTRLALLACESQSEQGLDQQTVSGSFNITSRGNEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLITGEPPPIDEYEEDLGKRLAIEDVVCPDGKVGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNT-IINKTETVNNGTELISLIEIETDPALTYVEGVCVVWFTFEFLVRVIFCPDKLEFIRNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPSDPSASKHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKYIP 461          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 389.808 bits (1000), Expect = 5.291e-127
Identity = 222/466 (47.64%), Postives = 301/466 (64.59%), Query Frame = 2
Query:  239 GANMDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALA----NYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFR-IPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAER-------FQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKTPAGLTPLLSNP 1600
            G N DS+ ++++N+GG RHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VF+ VLNYYRTGKLH P DVCGPLYEEEL FWG+D   VE CCWM Y +HR  EE L      +   ++   D    +  L+E  +   +  W++LQ K+WA+FEDPYSS +++ +A  ++FFI+ISI +FCL+T   F  + N   +    N +   +    +T    +YVE IC +WFT E +IR +  P K  F+KS +NIIDF+A+L FYL+I LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER          +    F +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLPKK+ + +P    +P +P    P L +P
Sbjct:   30 GKNEDSD-KIVINVGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKTDEFFFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEPTEEEEDGD--LKRLCLQEDGRK--LGRWKRLQPKVWALFEDPYSSKAARYIAFASLFFILISITTFCLETHEAFNDVNNKTEVFTQGNITRTETILEMETEPFLTYVEGICVIWFTFEFLIRVIFCPDKMEFIKSSLNIIDFVAILPFYLEIGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAAPDDITGSKHTDFKNIPIGFWWAVVTMTTLGYGDMYPVTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKNKHIP-RPPQPGSPNYCKPDLQSP 489          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 389.808 bits (1000), Expect = 6.364e-127
Identity = 222/466 (47.64%), Postives = 301/466 (64.59%), Query Frame = 2
Query:  239 GANMDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALA----NYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFR-IPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAER-------FQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKTPAGLTPLLSNP 1600
            G N DS+ ++++N+GG RHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VF+ VLNYYRTGKLH P DVCGPLYEEEL FWG+D   VE CCWM Y +HR  EE L      +   ++   D    +  L+E  +   +  W++LQ K+WA+FEDPYSS +++ +A  ++FFI+ISI +FCL+T   F  + N   +    N +   +    +T    +YVE IC +WFT E +IR +  P K  F+KS +NIIDF+A+L FYL+I LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER          +    F +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLPKK+ + +P    +P +P    P L +P
Sbjct:   30 GKNEDSD-KIVINVGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKTDEFFFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEPTEEEEDGD--LKRLCLQEDGRK--LGRWKRLQPKVWALFEDPYSSKAARYIAFASLFFILISITTFCLETHEAFNDVNNKTEVFTQGNITRTETILEMETEPFLTYVEGICVIWFTFEFLIRVIFCPDKMEFIKSSLNIIDFVAILPFYLEIGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAAPDDITGSKHTDFKNIPIGFWWAVVTMTTLGYGDMYPVTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKNKHIP-RPPQPGSPNYCKPDLQSP 489          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 389.808 bits (1000), Expect = 9.832e-127
Identity = 222/466 (47.64%), Postives = 301/466 (64.59%), Query Frame = 2
Query:  239 GANMDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALA----NYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFR-IPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAER-------FQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKTPAGLTPLLSNP 1600
            G N DS+ ++++N+GG RHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VF+ VLNYYRTGKLH P DVCGPLYEEEL FWG+D   VE CCWM Y +HR  EE L      +   ++   D    +  L+E  +   +  W++LQ K+WA+FEDPYSS +++ +A  ++FFI+ISI +FCL+T   F  + N   +    N +   +    +T    +YVE IC +WFT E +IR +  P K  F+KS +NIIDF+A+L FYL+I LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER          +    F +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLPKK+ + +P    +P +P    P L +P
Sbjct:   30 GKNEDSD-KIVINVGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKTDEFFFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEPTEEEEDGD--LKRLCLQEDGRK--LGRWKRLQPKVWALFEDPYSSKAARYIAFASLFFILISITTFCLETHEAFNDVNNKTEVFTQGNITRTETILEMETEPFLTYVEGICVIWFTFEFLIRVIFCPDKMEFIKSSLNIIDFVAILPFYLEIGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAAPDDITGSKHTDFKNIPIGFWWAVVTMTTLGYGDMYPVTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKNKHIP-RPPQPGSPNYCKPDLQSP 489          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Mouse
Match: Kcnc1 (potassium voltage gated channel, Shaw-related subfamily, member 1 [Source:MGI Symbol;Acc:MGI:96667])

HSP 1 Score: 389.037 bits (998), Expect = 9.393e-128
Identity = 204/444 (45.95%), Postives = 279/444 (62.84%), Query Frame = 2
Query:  251 DSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALA----NYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDT--------------DKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFR-IPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKN-------HFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 1504
            D   R+++N+GG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHPGVF+ +LNYYRTGKLH P DVCGPLYEEEL FWG+D   VEPCCWMTY +HR  EE L       +D               D   + ++  +  L +        +W + Q +IWA+FEDPYSS  ++ VA  ++FFI++SI +FCL+T   F  I N   I    N +        +T    +Y+E +C +WFT E ++R +  P+K  F+K+ +NIIDF+A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER      +       HF +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Mouse
Match: Kcnc1 (potassium voltage gated channel, Shaw-related subfamily, member 1 [Source:MGI Symbol;Acc:MGI:96667])

HSP 1 Score: 390.578 bits (1002), Expect = 2.678e-127
Identity = 204/444 (45.95%), Postives = 279/444 (62.84%), Query Frame = 2
Query:  251 DSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALA----NYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDT--------------DKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFR-IPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKN-------HFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 1504
            D   R+++N+GG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHPGVF+ +LNYYRTGKLH P DVCGPLYEEEL FWG+D   VEPCCWMTY +HR  EE L       +D               D   + ++  +  L +        +W + Q +IWA+FEDPYSS  ++ VA  ++FFI++SI +FCL+T   F  I N   I    N +        +T    +Y+E +C +WFT E ++R +  P+K  F+K+ +NIIDF+A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER      +       HF +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Mouse
Match: Kcnc2 (potassium voltage gated channel, Shaw-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:96668])

HSP 1 Score: 376.711 bits (966), Expect = 3.016e-121
Identity = 213/451 (47.23%), Postives = 285/451 (63.19%), Query Frame = 2
Query:  386 EYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDID-IDTDKVSKDDLYAK-FGLEEKHQ----SGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISVSDNSSWAISKSSP------QTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKN-------HFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKTPAGLTPLLSNPPFSLK--NHPLNTIPSFT-VGNRNELL 1672
            E+FFDRHPGVF+ VLNYYRTGKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY +HR  EE L I    D I  D    +DL AK  G+E+        G    W KLQ ++WA+FEDPYSS +++ +A  ++FFI++SI +FCL+T   F I       V + +   I+ +SP      +T    +YVE +C +WFT E ++R + +P+K  F+K+ +NIIDF+A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER      +        F +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P        PA   PL S+P F     N   N+  S T +G  N LL
Sbjct:  105 EFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGRWRKLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNI-------VKNKTEPVINGTSPVLQYEIETDPALTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP--------PA---PLASSPTFCKTELNMACNSTQSDTCLGKENRLL 537          

HSP 2 Score: 50.447 bits (119), Expect = 7.799e-6
Identity = 22/44 (50.00%), Postives = 30/44 (68.18%), Query Frame = 2
Query:  242 ANMDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYD 373
              ++S  RVILN+GG RHETY++TLK +P TRL+ L  +    D
Sbjct:    2 GKIESNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPQGD 45          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Mouse
Match: Kcnc2 (potassium voltage gated channel, Shaw-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:96668])

HSP 1 Score: 376.326 bits (965), Expect = 3.984e-121
Identity = 213/451 (47.23%), Postives = 285/451 (63.19%), Query Frame = 2
Query:  386 EYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDID-IDTDKVSKDDLYAK-FGLEEKHQ----SGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISVSDNSSWAISKSSP------QTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKN-------HFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKTPAGLTPLLSNPPFSLK--NHPLNTIPSFT-VGNRNELL 1672
            E+FFDRHPGVF+ VLNYYRTGKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY +HR  EE L I    D I  D    +DL AK  G+E+        G    W KLQ ++WA+FEDPYSS +++ +A  ++FFI++SI +FCL+T   F I       V + +   I+ +SP      +T    +YVE +C +WFT E ++R + +P+K  F+K+ +NIIDF+A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER      +        F +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P        PA   PL S+P F     N   N+  S T +G  N LL
Sbjct:  105 EFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGRWRKLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNI-------VKNKTEPVINGTSPVLQYEIETDPALTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP--------PA---PLASSPTFCKTELNMACNSTQSDTCLGKENRLL 537          

HSP 2 Score: 50.447 bits (119), Expect = 7.521e-6
Identity = 22/44 (50.00%), Postives = 30/44 (68.18%), Query Frame = 2
Query:  242 ANMDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYD 373
              ++S  RVILN+GG RHETY++TLK +P TRL+ L  +    D
Sbjct:    2 GKIESNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPQGD 45          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Mouse
Match: Kcnc3 (potassium voltage gated channel, Shaw-related subfamily, member 3 [Source:MGI Symbol;Acc:MGI:96669])

HSP 1 Score: 371.318 bits (952), Expect = 1.037e-117
Identity = 209/466 (44.85%), Postives = 283/466 (60.73%), Query Frame = 2
Query:  263 RVILNIGGFRHETYKATLKKIPATRLSKLTEALA----NYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQ---------------------------------WWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISVSDNSSWAISKSSPQ--------THQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHN-----SKNH--FNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 1504
            ++++N+GG RHETY++TL+ +P TRL+ LTE  A    +YDP  +E+FFDRHPGVF+ VLNYYRTGKLH P DVCGPL+EEEL FWG+D   VE CCWMTY +HR  EE L      D   +  +        GL+++  +G                                    WW + Q ++WA+FEDPYSS +++ VA  ++FFI+ISI +FCL+T   F   ++ N +V+  S   I  + P+        T    +YVE +C +WFT E ++R    P K  FLKS +NIID +A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER   +       NH  F +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:   91 KIVINVGGVRHETYRSTLRTLPGTRLAGLTEPEAAARFDYDPGTDEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDETDVEACCWMTYRQHRDAEEALDSFEAPDSSANANANAGGAHDAGLDDEAGAGGGGLDGAGGELKRLCFQDAGGGAGGPAGGAGGAGGTWWRRWQPRVWALFEDPYSSRAARYVAFASLFFILISITTFCLETHEGFI--HISNKTVTQASP--IPGAPPENITNVEVETEPFLTYVEGVCVVWFTFEFLMRVTFCPDKVEFLKSSLNIIDCVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 552          
BLAST of Potassium voltage-gated channel protein vs. UniProt/SwissProt
Match: sp|P17972|KCNAW_DROME (Potassium voltage-gated channel protein Shaw OS=Drosophila melanogaster OX=7227 GN=Shaw PE=2 SV=1)

HSP 1 Score: 607.446 bits (1565), Expect = 0.000e+0
Identity = 303/453 (66.89%), Postives = 373/453 (82.34%), Query Frame = 2
Query:  245 NMDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISV---SDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVR----PKTPAGLT 1582
            NMDSENRV+LN+GG RHETYKATLKKIPATRLS+LTEALANYDP+LNEYFFDRHPGVF+QVLNYYRTGKLHYPTDVCGPL+EEELEFWGLDSNQVEPCCWMTYT+HR T+ETL +L+ +D+DT+K S+++L  KFG EE +  G I WW++++ +IW++F++PYSS ++K + V++VFFI ISILSFCLKT    R+P + NI+V   + ++ W + K+    H  F Y+E +CN WFT EI++R + +P+K+ F+KS VNIID++A LSFY+D++L     +  +EN ++LEFFSIIRIMRLFKLTRH +GL IL+ TFRAS KEL LLVFFL + IVIFA+L+YYAER Q N  N FNSIP GLWWA+VTMTTVGYGDM P TYIGM VGALCA+ GVLTI+LPVPVIVSNF+M+YSHTQAR+KLPKKRRRVLPVE  R    P  P G++
Sbjct:    5 NMDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRF--ASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPRLPGAPGGVS 455          
BLAST of Potassium voltage-gated channel protein vs. UniProt/SwissProt
Match: sp|G5EFC3|KCNAG_CAEEL (Potassium voltage-gated channel protein egl-36 OS=Caenorhabditis elegans OX=6239 GN=egl-36 PE=1 SV=1)

HSP 1 Score: 506.523 bits (1303), Expect = 5.087e-172
Identity = 263/447 (58.84%), Postives = 337/447 (75.39%), Query Frame = 2
Query:  236 RGANMDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTD---KVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNL--HNISVSDNSSW-AISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVR 1558
            +G +MD   R++LN+GG RHETY+ATLKKIPATRLS+LT +LAN+DP+LNEYFFDRHP VF+ +LNYYRTGKLHYPTDVCGPL+EEEL++WGLD++  EPCCWM     + T+ETL +L+ +D D +   ++ + D   KFG EE +  G    W KL+ ++W++F++PYSS ++K++A I+V FI ISI SFCLKT   FR+P L   NI++       +I + S +   IF  +E +CN+WFT+E+IIR +  PSK  F KSP+N+ID +A LSFY D ++  + E    E  +++EF S+IRI RLFKLT+H  GL IL+HTFRAS KEL+LLVFFL + IVIFAAL+YYAE+ + N  N F SIP GLWWAI TMTTVGYGDM PHT  G  VG+LCA+ GVLTI+LPVPVIVSNF+MFYSH QAR KLPK+RRRVLPVE +R
Sbjct:   31 KGISMD--ERIVLNVGGVRHETYQATLKKIPATRLSRLTPSLANFDPLLNEYFFDRHPAVFAMILNYYRTGKLHYPTDVCGPLFEEELQYWGLDASDTEPCCWMQLLHAKDTQETLAVLDRMDADHEDDPQLREQDTMKKFGWEEDYFQGKRTRWMKLKPQMWSLFDEPYSSQAAKLIAGISVLFIFISIFSFCLKTHQSFRLPVLIGQNITMPGGVVQPSIERVSTEPLPIFGQIEMLCNIWFTLELIIRFVFCPSKIRFFKSPLNMIDLVATLSFYADAMMVRVVED---EPKDVVEFLSMIRIFRLFKLTQHHQGLQILIHTFRASAKELILLVFFLILGIVIFAALVYYAEKMEANPNNQFQSIPLGLWWAICTMTTVGYGDMTPHTSFGRLVGSLCAVMGVLTIALPVPVIVSNFAMFYSHNQARDKLPKRRRRVLPVEQIR 472          
BLAST of Potassium voltage-gated channel protein vs. UniProt/SwissProt
Match: sp|P48547|KCNC1_HUMAN (Potassium voltage-gated channel subfamily C member 1 OS=Homo sapiens OX=9606 GN=KCNC1 PE=1 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 5.022e-127
Identity = 204/444 (45.95%), Postives = 279/444 (62.84%), Query Frame = 2
Query:  251 DSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALA----NYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDT--------------DKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFR-IPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKN-------HFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 1504
            D   R+++N+GG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHPGVF+ +LNYYRTGKLH P DVCGPLYEEEL FWG+D   VEPCCWMTY +HR  EE L       +D               D   + ++  +  L +        +W + Q +IWA+FEDPYSS  ++ VA  ++FFI++SI +FCL+T   F  I N   I    N +        +T    +Y+E +C +WFT E ++R +  P+K  F+K+ +NIIDF+A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER      +       HF +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVIFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
BLAST of Potassium voltage-gated channel protein vs. UniProt/SwissProt
Match: sp|P15388|KCNC1_MOUSE (Potassium voltage-gated channel subfamily C member 1 OS=Mus musculus OX=10090 GN=Kcnc1 PE=1 SV=1)

HSP 1 Score: 389.037 bits (998), Expect = 6.570e-127
Identity = 204/444 (45.95%), Postives = 279/444 (62.84%), Query Frame = 2
Query:  251 DSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALA----NYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDT--------------DKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFR-IPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKN-------HFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 1504
            D   R+++N+GG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHPGVF+ +LNYYRTGKLH P DVCGPLYEEEL FWG+D   VEPCCWMTY +HR  EE L       +D               D   + ++  +  L +        +W + Q +IWA+FEDPYSS  ++ VA  ++FFI++SI +FCL+T   F  I N   I    N +        +T    +Y+E +C +WFT E ++R +  P+K  F+K+ +NIIDF+A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER      +       HF +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
BLAST of Potassium voltage-gated channel protein vs. UniProt/SwissProt
Match: sp|P25122|KCNC1_RAT (Potassium voltage-gated channel subfamily C member 1 OS=Rattus norvegicus OX=10116 GN=Kcnc1 PE=1 SV=1)

HSP 1 Score: 390.578 bits (1002), Expect = 1.873e-126
Identity = 204/444 (45.95%), Postives = 279/444 (62.84%), Query Frame = 2
Query:  251 DSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALA----NYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDT--------------DKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFR-IPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKN-------HFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 1504
            D   R+++N+GG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHPGVF+ +LNYYRTGKLH P DVCGPLYEEEL FWG+D   VEPCCWMTY +HR  EE L       +D               D   + ++  +  L +        +W + Q +IWA+FEDPYSS  ++ VA  ++FFI++SI +FCL+T   F  I N   I    N +        +T    +Y+E +C +WFT E ++R +  P+K  F+K+ +NIIDF+A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER      +       HF +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
BLAST of Potassium voltage-gated channel protein vs. TrEMBL
Match: A0A267FE93 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007473g1 PE=3 SV=1)

HSP 1 Score: 627.861 bits (1618), Expect = 0.000e+0
Identity = 320/449 (71.27%), Postives = 384/449 (85.52%), Query Frame = 2
Query:  251 DSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISV----SDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKTPAGLTP 1585
            D++NRVILN+GG RHETYKATLKKIPATRLS+LTEALANYDP+LNEYFFDRHPGVF+Q+LNYYRTGKLHYPTDVCGPL+EEELEFWGLDSNQVEPCCWMTYT HR T+ETL IL+ +D+DTDK++ +DLY KFGLE+K+++ ++  W+K++ K+WA+F++PYSS ++KIVAV++VFFIVISILSFCLKT    R+P + N++V    +D  S+A+ K+  + H  F Y+E +CN WFT EI+ R  V P KF FLKSPVNIIDF+A LSFY+D++L+ +    +  + E+LEFFSIIRIMRLFKLTRHIAGL IL+HTF+AS KEL+LLVFFL VFIV+FAAL+YYAER  +N +N F+SIP GLWWAIVTMTTVGYGDM P TY GM VGALCA+TGVLTI+LPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVE+VRPK  AG  P
Sbjct:    3 DADNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPMLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTTHRETQETLTILDRLDLDTDKLAPEDLYKKFGLEDKYENNELNLWQKVKPKLWALFDEPYSSVAAKIVAVVSVFFIVISILSFCLKTFPGLRVPIITNVTVVVDSNDTMSYALYKTRSEPHSAFFYIECVCNSWFTFEIVTRFSVTPDKFEFLKSPVNIIDFIATLSFYMDLVLNQVLSEAE-ASYEVLEFFSIIRIMRLFKLTRHIAGLKILIHTFKASAKELLLLVFFLIVFIVVFAALIYYAERIHYNPENSFDSIPIGLWWAIVTMTTVGYGDMAPKTYAGMFVGALCALTGVLTIALPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKV-AGTGP 449          
BLAST of Potassium voltage-gated channel protein vs. TrEMBL
Match: R7TBS7 (BTB domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_218764 PE=3 SV=1)

HSP 1 Score: 627.476 bits (1617), Expect = 0.000e+0
Identity = 310/445 (69.66%), Postives = 381/445 (85.62%), Query Frame = 2
Query:  251 DSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISVS----DNSS-WAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKTP 1570
            D+ENRVILN+GG RHETYKATLKKIPATRLS+LTEALANYDPVLNEYFFDRHPGVF+QVLNYYRTGKLHYPTDVCGPL+EEELEFWGLD+NQVEPCCWMTYT HR T+ETLQIL+ +D+DTDK +++D+  KFGLEE++ SG++ WW+K++ +IWA+FE+PYSST++KIVA+ ++FFIV+SILSFCLKT  + R+P + N+++S    DN++ W + K     H+ F ++E  CN WFT E++IR +VAP+K  F+++P+NIID +A LSFYLD +L+ +    + EN ++LEFFSIIRIMRLFKLTRH  GL IL+HTF+AS  EL LL+FFL + IVIFA+L++YAER Q+N  N F SIP GLWWAIVTMTTVGYGDMVP TY+GM VGALCA+TGVLTI+LPVPVIVSNFS+FYSHTQAR+KLPKKRRRVLPVE+VRPK P
Sbjct:    3 DAENRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDANQVEPCCWMTYTTHRDTQETLQILDRLDLDTDKPTEEDIMKKFGLEEQYNSGEMNWWQKIKPRIWALFEEPYSSTTAKIVAIGSIFFIVVSILSFCLKTHPNMRVPVIQNVTLSKGNADNTTIWVLEKKGTDAHRAFFFIECACNAWFTFELLIRVVVAPNKLEFMRAPINIIDLVATLSFYLDFLLTRL----KKEN-DILEFFSIIRIMRLFKLTRHSPGLKILIHTFKASAHELSLLIFFLILGIVIFASLIFYAERIQYNPSNDFTSIPVGLWWAIVTMTTVGYGDMVPKTYVGMFVGALCALTGVLTIALPVPVIVSNFSLFYSHTQARAKLPKKRRRVLPVEAVRPKGP 442          
BLAST of Potassium voltage-gated channel protein vs. TrEMBL
Match: A0A4E0S2N2 (Potassium voltage-gated channel protein Shaw OS=Fasciola hepatica OX=6192 GN=D915_001399 PE=3 SV=1)

HSP 1 Score: 626.32 bits (1614), Expect = 0.000e+0
Identity = 328/473 (69.34%), Postives = 383/473 (80.97%), Query Frame = 2
Query:  248 MDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISV------SDNS---------------------------SWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKT 1567
            MDSENRVILN+GG RHETYKATLKKIPATRLS+LTEALANYDP+LNEYFFDRHPGVF+Q+LNYYRTGKLHYPTDVCGPL+EEELEFWGLD+NQVEPCCWMTYT HR T+ETLQILND+D+DT+  ++++LYAKFGL++ +QSG +  W+K + KIW +F++ YSS  +K +AVI+VFFIV+SILSFCLKT+S+ RIP L+N SV      SD                             SW I K + + H IFSY E I N WFT EI +R LV PSK+ F++SPVNIID LAL+SFY+D++L+N+       + + LEFFSIIRIMRLFKLTRHIAGL IL+HTFRAS+KELVLLVFFL VFIVIFAALMYYAERFQ N +N F SIP GLWWAIVTMTTVGYGD VP TY+GM VGA+CAITGV+TISLPVPVIVSNFS FY+HTQA+SKLPKKRRRVLPVE+VRPK+
Sbjct:    1 MDSENRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDANQVEPCCWMTYTSHRETQETLQILNDLDLDTEH-TEEELYAKFGLDDAYQSGQLTLWQKFKPKIWMLFDESYSSLCAKFLAVISVFFIVLSILSFCLKTSSNLRIPQLYNESVLLISTGSDYQTPDEMRTAHELTRLRRSVPPEPVEGELSWTIRKRTVKAHSIFSYFEMISNAWFTFEITVRFLVTPSKYEFIRSPVNIIDLLALISFYVDLLLTNIMSDDA--SYDALEFFSIIRIMRLFKLTRHIAGLKILIHTFRASMKELVLLVFFLMVFIVIFAALMYYAERFQFNPRNDFASIPVGLWWAIVTMTTVGYGDQVPKTYLGMIVGAMCAITGVMTISLPVPVIVSNFSRFYTHTQAQSKLPKKRRRVLPVEAVRPKS 470          
BLAST of Potassium voltage-gated channel protein vs. TrEMBL
Match: A0A267GF75 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000359g2 PE=3 SV=1)

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 316/443 (71.33%), Postives = 380/443 (85.78%), Query Frame = 2
Query:  251 DSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISV----SDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKT 1567
            D++NRVILN+GG RHETYKATLKKIPATRLS+LTEALANYDP+LNEYFFDRHPGVF+Q+LNYYRTGKLHYPTDVCGPL+EEELEFWGLDSNQVEPCCWMTYT HR T+ETL IL+ +D+DTDK++++DLY KFG EE+  S ++ +W++++ K+WA+F++PYSS ++KIVAV++VFFIVISILSFCLKT    R+P + N +V    + ++S+ + K   + H  F Y+E +CN WFT EII R  V P K  FLKSPVNIIDF+A LSFY+D++L+ +  S +  + E+LEFFSIIRIMRLFKLTRHIAGL IL+HTF+AS KEL+LLVFFL VFIV+FAAL+YYAER Q+N +N F+SIP GLWWAIVTMTTVGYGDM P TY GM VGALCA+TGVLTI+LPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVE+VRPK+
Sbjct:    3 DADNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTSHRETQETLGILDRLDLDTDKLAEEDLYKKFGWEEEFLSNELNFWQRIKPKLWALFDEPYSSMAAKIVAVVSVFFIVISILSFCLKTFPGLRVPIISNETVLIDENGSTSFVLHKHRSEPHTAFLYIECVCNSWFTFEIITRFAVTPDKLEFLKSPVNIIDFIATLSFYMDMVLNQVL-SEEETSYEVLEFFSIIRIMRLFKLTRHIAGLKILIHTFKASAKELLLLVFFLIVFIVVFAALIYYAERIQYNPENSFDSIPIGLWWAIVTMTTVGYGDMAPKTYAGMLVGALCALTGVLTIALPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKS 444          
BLAST of Potassium voltage-gated channel protein vs. TrEMBL
Match: A0A1C9TA76 (Delayed rectifier potassium channel Shaw-like member 1 OS=Homarus americanus OX=6706 GN=Shaw1 PE=2 SV=1)

HSP 1 Score: 618.616 bits (1594), Expect = 0.000e+0
Identity = 308/473 (65.12%), Postives = 383/473 (80.97%), Query Frame = 2
Query:  248 MDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISVS---DNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKTPAGLTPLLSNPPFSLKNHPLNTIPSFTVGN 1657
            MDSENRV+LN+GG RHETYKATLKKIPATRLS+LTEALANYDP+LNEYFFDRHPGVF+QVLNYYRTGKLHYPTDVCGPL+EEELE+WGLDSNQVEPCCWMTYT HR T+ETL +L+ +D+DTDK S+++L  KFG E+ + SG++ WW+KL+ K+W++F++PYSS ++K++ VI+VFFI +SILSFCLKT    R+P + N++V    + ++W + K +   H+ F Y+E +CN WFT EI+IR + +P+KF+FLK+ VN+IDF+A LSFY+DI+L     +  +EN ++LEFFSIIRIMRLFKLTRH +GL IL+ TFRAS KEL LLVFFL + IVIFA+L+YYAER Q N  N FNSIP GLWWA+VTMTTVGYGDM P TY+GM VGALCA+ GVLTI+LPVPVIVSNF+M+YSHTQAR+KLPKKRRRVLPVE VR      + P+   P      + +N  P   +GN
Sbjct:    1 MDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEYWGLDSNQVEPCCWMTYTAHRDTQETLAVLDRLDLDTDKPSEEELARKFGFEDDYFSGNLSWWQKLKPKLWSLFDEPYSSQAAKVIGVISVFFICVSILSFCLKTHPDMRVPVIENVTVQTAENTTAWTLDKKATNAHEAFFYIECVCNTWFTFEILIRLIASPNKFMFLKASVNMIDFIATLSFYVDILLQKF--ASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQANPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYVGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEHVR------VGPIAPQPKRGGGPNDMNRGPGPKMGN 465          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Cavefish
Match: kcnc1a (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:103038026])

HSP 1 Score: 385.571 bits (989), Expect = 1.606e-125
Identity = 207/444 (46.62%), Postives = 287/444 (64.64%), Query Frame = 2
Query:  251 DSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALA----NYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETL--------QILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDI------QWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFR-IPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERF-------QHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 1504
            D ++RV++N+GG RH+TY++TL+ +P TRL+ L E  A    +YD  ++E+FFDRHPGVF+ +LNYYRTGKLH P DVCGPLYEEEL FWG+D   VEPCCWMTY +HR  EE L        ++ ND           D   +  + ++   GD         W++ Q ++WA+FEDPYSS  ++ VA  ++FFI++SI +FCL+T   F  I N  +I   DNS+    ++  +T    +Y+E +C +WFT E ++R    P K  F+K+ +NIIDF+A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER        + +   HF +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    5 DEKDRVVINVGGIRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDAQIDEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHREAEEALDSFGGGPAELGNDDTDADGLGDPGDGDEELEMTKRLALGDAPDGKAGGLWQRWQRRVWALFEDPYSSKYARWVAFASLFFILVSITTFCLETHEAFNPIINRTDIDPVDNSTRIYQET--ETEVFLTYIEGVCVVWFTFEFLMRVTFCPDKKKFIKNTLNIIDFVAILPFYLEVGLSGLSSKEAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAKPNDPRASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 446          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Cavefish
Match: kcnc1a (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:103038026])

HSP 1 Score: 385.956 bits (990), Expect = 2.002e-125
Identity = 207/444 (46.62%), Postives = 287/444 (64.64%), Query Frame = 2
Query:  251 DSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALA----NYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETL--------QILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDI------QWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFR-IPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERF-------QHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 1504
            D ++RV++N+GG RH+TY++TL+ +P TRL+ L E  A    +YD  ++E+FFDRHPGVF+ +LNYYRTGKLH P DVCGPLYEEEL FWG+D   VEPCCWMTY +HR  EE L        ++ ND           D   +  + ++   GD         W++ Q ++WA+FEDPYSS  ++ VA  ++FFI++SI +FCL+T   F  I N  +I   DNS+    ++  +T    +Y+E +C +WFT E ++R    P K  F+K+ +NIIDF+A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER        + +   HF +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    5 DEKDRVVINVGGIRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDAQIDEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHREAEEALDSFGGGPAELGNDDTDADGLGDPGDGDEELEMTKRLALGDAPDGKAGGLWQRWQRRVWALFEDPYSSKYARWVAFASLFFILVSITTFCLETHEAFNPIINRTDIDPVDNSTRIYQET--ETEVFLTYIEGVCVVWFTFEFLMRVTFCPDKKKFIKNTLNIIDFVAILPFYLEVGLSGLSSKEAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAKPNDPRASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 446          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Cavefish
Match: kcnc1a (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:103038026])

HSP 1 Score: 383.259 bits (983), Expect = 8.280e-125
Identity = 207/444 (46.62%), Postives = 287/444 (64.64%), Query Frame = 2
Query:  251 DSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALA----NYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETL--------QILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDI------QWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFR-IPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERF-------QHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 1504
            D ++RV++N+GG RH+TY++TL+ +P TRL+ L E  A    +YD  ++E+FFDRHPGVF+ +LNYYRTGKLH P DVCGPLYEEEL FWG+D   VEPCCWMTY +HR  EE L        ++ ND           D   +  + ++   GD         W++ Q ++WA+FEDPYSS  ++ VA  ++FFI++SI +FCL+T   F  I N  +I   DNS+    ++  +T    +Y+E +C +WFT E ++R    P K  F+K+ +NIIDF+A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER        + +   HF +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    5 DEKDRVVINVGGIRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDAQIDEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHREAEEALDSFGGGPAELGNDDTDADGLGDPGDGDEELEMTKRLALGDAPDGKAGGLWQRWQRRVWALFEDPYSSKYARWVAFASLFFILVSITTFCLETHEAFNPIINRTDIDPVDNSTRIYQET--ETEVFLTYIEGVCVVWFTFEFLMRVTFCPDKKKFIKNTLNIIDFVAILPFYLEVGLSGLSSKEAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAKPNDPRASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 446          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Cavefish
Match: kcnc1b (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:103042627])

HSP 1 Score: 383.645 bits (984), Expect = 1.162e-124
Identity = 207/448 (46.21%), Postives = 280/448 (62.50%), Query Frame = 2
Query:  251 DSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQ--------------------WWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFR-IPNLHNISVSDNSSWAISKSSPQTHQI--FSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKN-------HFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 1504
            D E RV+LN+GG RHETY+ TL+ +P TRL++L E     +   +++FFDRHPGVF+ +LNYYRTGKLH P DVCGPLYEEEL FWG+D   VEPCCWMTY +HR  EE L          D   + +L  +   +  H++ D                       W++ Q K+WA+FEDPYSS  ++ VA  ++FFI++SI +FCL+T   F  I N     V DN    + ++ PQT  +   +Y+E +C +WFT E +IR    P K  F+++ +NIIDF+A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER   N  +       +F +IP G WWA+VTMTT+GYGDM P T  GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    5 DDEERVVLNVGGVRHETYRGTLRTLPGTRLARLAE---QAEGAGHDFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELSFWGIDETDVEPCCWMTYRQHREAEEALVSFGGA-APLDNGHRHELEVEVAADGTHEAADGDEGAEMTRRLAHGDAADASGGRWKRWQKKMWALFEDPYSSRYARWVAFASLFFILVSITTFCLETHEAFNPIINRTEYDVVDNE--IVERNVPQTETMVQLTYIEGVCVVWFTFEFLIRITFCPDKLKFVRNALNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFILLIIFLALGVLIFATMIYYAERIGANPNDPRASEHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTTSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 446          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Cavefish
Match: kcnc1b (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:103042627])

HSP 1 Score: 382.874 bits (982), Expect = 2.951e-124
Identity = 207/448 (46.21%), Postives = 280/448 (62.50%), Query Frame = 2
Query:  251 DSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQ--------------------WWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFR-IPNLHNISVSDNSSWAISKSSPQTHQI--FSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKN-------HFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 1504
            D E RV+LN+GG RHETY+ TL+ +P TRL++L E     +   +++FFDRHPGVF+ +LNYYRTGKLH P DVCGPLYEEEL FWG+D   VEPCCWMTY +HR  EE L          D   + +L  +   +  H++ D                       W++ Q K+WA+FEDPYSS  ++ VA  ++FFI++SI +FCL+T   F  I N     V DN    + ++ PQT  +   +Y+E +C +WFT E +IR    P K  F+++ +NIIDF+A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER   N  +       +F +IP G WWA+VTMTT+GYGDM P T  GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    5 DDEERVVLNVGGVRHETYRGTLRTLPGTRLARLAE---QAEGAGHDFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELSFWGIDETDVEPCCWMTYRQHREAEEALVSFGGA-APLDNGHRHELEVEVAADGTHEAADGDEGAEMTRRLAHGDAADASGGRWKRWQKKMWALFEDPYSSRYARWVAFASLFFILVSITTFCLETHEAFNPIINRTEYDVVDNE--IVERNVPQTETMVQLTYIEGVCVVWFTFEFLIRITFCPDKLKFVRNALNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFILLIIFLALGVLIFATMIYYAERIGANPNDPRASEHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTTSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 446          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Sea Lamprey
Match: kcnc1a (potassium voltage-gated channel, Shaw-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-061220-10])

HSP 1 Score: 393.275 bits (1009), Expect = 1.671e-128
Identity = 212/439 (48.29%), Postives = 298/439 (67.88%), Query Frame = 2
Query:  251 DSENRVILNIGGFRHETYKATLKKIPATRLSKLTE--ALAN--YDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDID-TDKVSKD-DLYAKFGLEEKH-QSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISVSDNSSWAISKSSPQ-------THQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHN-----SKNH--FNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 1504
            D   RV++N+GG RHETY+ TL+ +P TRLS LTE  A AN  YD   NE+FFDRHP VF+ +LNYYRTGKLH P++VCGPL+EEEL FWG+D   VEPCCWM Y +HR  EE L    + DI+  D+V++D ++  +FGL+E+    G + +  + Q ++WA+FEDPYSS +++IVA+ ++ FI+ISI +FCL+T   F      N  ++   ++ I+  + Q       T  +  YVE +C  WF+ E ++R +  P K +F+K+ +N+IDF+A+L FYL++ LS++      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA +++YAERF  N     + +H  F +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NFSM+YS   A
Sbjct:   33 DENERVVINVGGTRHETYRGTLRTLPGTRLSWLTEPDAFANFDYDAKGNEFFFDRHPTVFAHILNYYRTGKLHCPSEVCGPLFEEELIFWGIDETDVEPCCWMNYRQHRDAEEALVSFENPDINGNDEVNEDGEVSKRFGLDERSPDGGKLGFLRRWQPRMWALFEDPYSSRAARIVALASLLFILISITTFCLETHEAF------NTVLNKTENYTINNVTTQKVYVDVETDPVLMYVEGVCVAWFSFEFLVRIICCPDKKVFIKNYLNVIDFVAILPFYLEVGLSSLTSKPARDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIFYAERFGANPNDPTASDHTSFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFSMYYSLAMA 465          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004235.1 (pep scaffold:Pmarinus_7.0:GL476413:398954:411573:-1 gene:ENSPMAG00000003870.1 transcript:ENSPMAT00000004235.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 266.159 bits (679), Expect = 1.990e-82
Identity = 164/433 (37.88%), Postives = 257/433 (59.35%), Query Frame = 2
Query:  263 RVILNIGGFRHETYKATLKKIPATRLSKL---------TEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWES-GQMENLE-MLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKR 1528
            RV LN+GG  HE    TL+++P TRL +L         +E   +Y    NEYFFDRHPG F+ VLN+YRTG+LH   ++C   + +EL++WG+D   +E CC   Y  H+  E+  + L   + ++ +  + D +      +K +            K+W + E+P SS ++K +A++++ FIV+S ++  L T     +P+L +    D  S  I   +P+  Q    VE +C  WFT+E ++R + AP+K+ F K  +N+ID +A+L +Y+ I L+       Q +N+  +++ F I+RI+R+ KL RH  GL  L  T R S  EL LL+ FL + I+IF++L+++AE+ + ++K  F+SIP   WWA +TMTTVGYGD+ P T +G  +G LC I GVL I+LP+P+IV+NFS FY   + + K  K+R
Sbjct:    1 RVRLNVGGLVHEVLWRTLERLPRTRLGRLHATNTHGALSELCDDYSIADNEYFFDRHPGAFASVLNFYRTGRLHMSEEMCALSFGQELDYWGVDEIYLETCCQARY--HQKKEQMSEELRR-EAESAREREGDEFEGTCCADKRR------------KLWELLENPNSSLAAKGMAIVSILFIVLSTIALSLNT-----LPDLQH---KDEFSHIID--NPKLAQ----VEAVCIAWFTMEYLLRFMSAPNKWKFFKGALNVIDLMAILPYYITIFLTESSRGVSQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEPDTK--FHSIPASFWWATITMTTVGYGDIYPMTLLGKIIGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAVKRR 402          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Sea Lamprey
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 229.565 bits (584), Expect = 4.317e-69
Identity = 156/417 (37.41%), Postives = 227/417 (54.44%), Query Frame = 2
Query:  245 NMDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTG-KLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYS 1492
             +  +NRV++N+ G R ET   TL + P + L    +    +DP+ NEYFFDR    F  +L YY++G +L  P DV   ++ EE+EF+ L    V           +  E TL        DT              EE++  G     +  Q  +W +FE    S ++K++++++    ++SI   CL+T   FR  N     V  N +    ++S      F  +E  C +WF  E+ +R    PSK  F+K  +N ID LA++ +++ ++L  M +  Q     +L+   ++R++R+FKL+RH   L IL  T +ASL+EL +L FFL V +VIF+  +YY E    + + HF+SIP   WWA+VTMT VGYGDM P T  G  VGALCAITGVLTISLPVPVIVSNF  FY+
Sbjct:    4 QLTCDNRVVINVSGERFETQLKTLDQFPDSLLGHPDKRARYFDPLQNEYFFDRSHVNFDAILFYYQSGGRLCKPVDVPSDVFREEVEFYELGEEAVA----------KYGENTL--------DTP-------------EEENVHG-----KDFQQHVWRLFESRDGSIAAKMLSLMSFVTTILSITVMCLETLPQFRKDN----QVHANRTEFSIRTSIYNLDPFFMLETACVVWFIFELAVRFYACPSKTSFMKDFMNAIDILAIMPYFITVVLEIMQQQDQTRQ-PLLKIIRLVRVLRIFKLSRHCQDLQILGLTLKASLRELAMLSFFLFVAVVIFSGAIYYVE--ADDPQKHFSSIPDAFWWAVVTMTLVGYGDMWPMTVGGKIVGALCAITGVLTISLPVPVIVSNFKYFYN 377          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007589.1 (pep scaffold:Pmarinus_7.0:GL482983:7539:12291:-1 gene:ENSPMAG00000006849.1 transcript:ENSPMAT00000007589.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 226.098 bits (575), Expect = 5.458e-69
Identity = 121/253 (47.83%), Postives = 165/253 (65.22%), Query Frame = 2
Query:  800 SFCLKTASHFRIPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQ-----HNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLP 1543
            +FCL+T   F   N    +V   S      +  +T     Y+E +C +WFTIE ++R L +P+K  F+K+ +NIID +A+L FYL++ LSN+   G  E L  L     +RI+R+FKLTRH  GL +L HT +AS  E +LL+ FL + ++IFA ++YYAER          K HF SIP G WWA+VTMTT+GYGDM P T+ GM VGALCA++GVLTI++PVPVIV+NF M+YS   A+ KLPKK+   +P
Sbjct:   20 TFCLETHEAFT--NASGTTVVPLSPMPTESTEYETAPALMYIEGMCVVWFTIEFMVRILTSPNKREFMKNKLNIIDLIAILPFYLEVGLSNLKSKGAREVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLKASTNEFLLLIIFLALGVLIFATMIYYAERLGAKPGIDEDKTHFTSIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALSGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKNSYMP 270          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Sea Lamprey
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 226.483 bits (576), Expect = 8.096e-68
Identity = 155/412 (37.62%), Postives = 224/412 (54.37%), Query Frame = 2
Query:  260 NRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTG-KLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYS 1492
             RV++N+ G R ET   TL + P + L    +    +DP+ NEYFFDR    F  +L YY++G +L  P DV   ++ EE+EF+ L    V           +  E TL        DT              EE++  G     +  Q  +W +FE    S ++K++++++    ++SI   CL+T   FR  N     V  N +    ++S      F  +E  C +WF  E+ +R    PSK  F+K  +N ID LA++ +++ ++L  M +  Q     +L+   ++R++R+FKL+RH   L IL  T +ASL+EL +L FFL V +VIF+  +YY E    + + HF+SIP   WWA+VTMT VGYGDM P T  G  VGALCAITGVLTISLPVPVIVSNF  FY+
Sbjct:    1 QRVVINVSGERFETQLKTLDQFPDSLLGHPDKRARYFDPLQNEYFFDRSHVNFDAILFYYQSGGRLCKPVDVPSDVFREEVEFYELGEEAVA----------KYGENTL--------DTP-------------EEENVHG-----KDFQQHVWRLFESRDGSIAAKMLSLMSFVTTILSITVMCLETLPQFRKDN----QVHANRTEFSIRTSIYNLDPFFMLETACVVWFIFELAVRFYACPSKTSFMKDFMNAIDILAIMPYFITVVLEIMQQQDQTRQ-PLLKIIRLVRVLRIFKLSRHCQDLQILGLTLKASLRELAMLSFFLFVAVVIFSGAIYYVE--ADDPQKHFSSIPDAFWWAVVTMTLVGYGDMWPMTVGGKIVGALCAITGVLTISLPVPVIVSNFKYFYN 369          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Nematostella
Match: EDO39804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8W8])

HSP 1 Score: 371.703 bits (953), Expect = 9.585e-123
Identity = 202/432 (46.76%), Postives = 280/432 (64.81%), Query Frame = 2
Query:  251 DSENRVILNIGGFRHETYKATLKKIPATRLSKLTE---ALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISVSDNSSWAISKSSPQTHQIFSY--VEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRR 1531
            ++ +RV++N+GG +HETY  TLK IP TRL  +TE    L  +DP  +E+FFDRHPGVF+QVLN+YRTGKLH P DVCGPL+E+EL FWG+D  QVEPCCW+ Y +HR  +  L   +  D D + V   D+     + +  +  +  WW+K Q +IW +FE+PYSS  ++++A IT+F I+ S+  FCL+T   F           DN         P+T + F    +E +C  WFT+E + R +  P K  F K P+N ID  A+L FYL +I+         + + +L    +IR+ R+FKL+RH  GL IL HT R+S  EL LLVFFL + +VIF+++++YAE+       HF +IP   WWA+VTMTT+GYGDMVP T+ G  VG+LCA+ GVL I+LPVPVIVSNFS++YSH +AR KLP+++R
Sbjct:   13 NAGDRVVINVGGQKHETYIGTLKNIPDTRLYWITENGTQLPEFDPNTSEFFFDRHPGVFAQVLNFYRTGKLHCPNDVCGPLFEDELAFWGIDELQVEPCCWLNYKQHREAQANLDPFDHHDSDNESVGDMDMSVYGLVADSIRQRNRTWWKKYQPRIWTMFEEPYSSIPAQVLAFITMFLIISSVCLFCLETVPKF-----------DN---------PKTSEGFVLYILEAVCVAWFTLEFLFRLIFCPDKLSFFKKPMNWIDLGAILPFYLTLIV----RESNFKTIVVLRVVRLIRVFRIFKLSRHSYGLQILGHTLRSSCSELFLLVFFLTIGVVIFSSVIFYAEK--DTKGTHFTTIPHTFWWAVVTMTTLGYGDMVPITWQGQIVGSLCAVCGVLMIALPVPVIVSNFSLYYSHAKARMKLPRRKR 418          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Nematostella
Match: EDO42724 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0S6])

HSP 1 Score: 364.77 bits (935), Expect = 2.784e-120
Identity = 207/431 (48.03%), Postives = 286/431 (66.36%), Query Frame = 2
Query:  260 NRVILNIGGFRHETYKATLKKIPATRLSKLTEA---LANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKD--DLYAKFGLEEKHQSG-DIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRR 1534
            +RV +N+GG RHETYK+TLK IP TRLS + EA    A++DP   EYFFDRHPGVF+ VLNYYRTGKLH P DVCGPL+E+EL FWG+D  QVE CCW+TY +HR  +ETL     ++ + +    +  DL  ++G     +S  D  WWE+ Q +IW + E+P+SST +K++A  T+  I++S+  FCL++   F    L ++ V                     +E IC +WFT+E+++R +  P+K  F K  +N IDFLA++ FY+ +  +N        +++ L    +IRI R+FKL+RH +GL IL HT RAS +EL+LL+FFL + +V+FA+L++Y E+    +K  F  IP   WWA+VTMTTVGYGDM P +  G  +G+LCA+ GVLTI+LPVPVIV+NFS++YSH QAR KLPKKRRR
Sbjct:    1 DRVSINVGGVRHETYKSTLKNIPDTRLSWIAEASAGAADFDPSTGEYFFDRHPGVFANVLNYYRTGKLHCPLDVCGPLFEDELGFWGIDDQQVESCCWLTYRQHRDAQETLAAFEGVEFENEYEDDEEPDL-GRYGFNFAAESEPDKTWWERYQPRIWTLMEEPHSSTLAKVIAYTTLTLILVSVGIFCLESMEKFSEKYLKDLLV--------------------ILEGICVVWFTLELMVRFVFCPAKCEFFKKIMNWIDFLAIVPFYVSLGFNN-----NNNDIDALMIIRLIRIFRIFKLSRHSSGLQILGHTLRASFRELLLLIFFLLIGVVLFASLIFYCEKKIPGTK--FVDIPSSFWWAVVTMTTVGYGDMAPQSPSGKFIGSLCAVCGVLTIALPVPVIVNNFSLYYSHAQARLKLPKKRRR 403          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Nematostella
Match: EDO38237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDJ4])

HSP 1 Score: 321.242 bits (822), Expect = 2.213e-103
Identity = 172/430 (40.00%), Postives = 261/430 (60.70%), Query Frame = 2
Query:  260 NRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQI-----LNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRR 1534
            +R+I+N+GGFRHET  +TL+ IP TRLS + E     +    EYFFDRHP  F QVLN+YRTGKLH PT++CGP++EEEL FWG+D  Q+EPCCW TYT+HR  EE L+       ND+    D+ +++ + +   + E      +  W+++Q ++W   ++P+SS  +KI +  +  FI +SI +FC  T    R  N+                   + +   ++E  C+++F+ E+ +R +  PSK  F +  +N IDF+A++ FY++I   N           ++  F +IRIMRLF+  +   GL I++ T +AS  ELVLL+  + + +V+F++++YY E         F S+P+  WW ++TMTTVGYGDM P T+ G  +G  CAI GVL ++LP+ VI SNF+++Y+H QAR KLP K+RR
Sbjct:   16 SRIIINVGGFRHETSVSTLQNIPDTRLSWIAENSTVNEDNKREYFFDRHPTAFCQVLNFYRTGKLHCPTEMCGPMFEEELIFWGIDEKQMEPCCWGTYTQHREAEENLKAFVGPGFNDLK---DEPAENHMGSYGSINE------LNCWKRIQPQLWETLDEPHSSKMAKIFSYTSCLFIALSIATFCATTMPAIRKNNIMG-----------------SREGLDHIEMFCSIFFSFELFMRLISCPSKLHFCRGIMNWIDFVAIIPFYVNIFYPN----------PIVRMFLVIRIMRLFRFIKLSYGLQIMIQTLKASSHELVLLLLMVLIPMVMFSSIVYYVEVIIEGRGAQFTSVPESFWWCLITMTTVGYGDMTPQTWPGKIIGGACAICGVLIVALPISVIGSNFNLYYAHAQARLKLPVKQRR 409          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Nematostella
Match: EDO48066 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJZ5])

HSP 1 Score: 308.145 bits (788), Expect = 1.568e-98
Identity = 186/443 (41.99%), Postives = 269/443 (60.72%), Query Frame = 2
Query:  236 RGANMDSENRVILNIGGFRHETYKATLKKIPATRLSKLTE---ALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERF-------QHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRR 1534
            RG+  D   RVILN+GG+RHETY +TL+ +P +RL+ + E     A+YDP  NE FFDRHPGVF+ VLNYYRTGKLH P DVCGPL+EEEL FWG++  Q+EPCCW  YT+HR  + TL+    +  DT+    D  Y       + Q   +Q       + WA+ E PYSS  ++I+A++++  I++S+ +FC+++           +  +D    A  K        F  +E +  +WFT E + R++  PSK  F+K+ +  +D L+++  Y+     +       + L+ L    ++RI RLF+  R ++G+ ++ HT RAS +EL LLV  L + +VIF+ L++YAE+        + NSK  F SIP   WWAI+TMTTVGYGD+ P T  G  +G LCA  GVL ++LPV VI SNF++FYSH QA+ KLPKK+ +
Sbjct:    1 RGSGKD---RVILNVGGYRHETYLSTLRVVPDSRLAWIGENASKQADYDPETNEIFFDRHPGVFANVLNYYRTGKLHCPGDVCGPLFEEELAFWGIEELQMEPCCWSNYTQHRDAQATLKAFEGLQKDTE----DSEYEAGERLARRQKTKMQ-------QFWALLEQPYSSKYAQILAMVSLVIIILSVTTFCIES-----------MPFAD----AFKKE-------FQILEILYCVWFTFEFVARAIACPSKVEFIKNFMTWVDVLSIIPLYISFAKGD-------QTLDFLFVLRLVRIFRLFRFFRTMSGMQVIGHTLRASARELFLLVLILLIPMVIFSTLVFYAEKSVSKFLNQRINSKGEFPSIPDAFWWAIITMTTVGYGDVTPKTPHGRFIGTLCACIGVLIVALPVSVIGSNFTLFYSHAQAQLKLPKKKHK 400          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Nematostella
Match: EDO45172 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTZ3])

HSP 1 Score: 307.76 bits (787), Expect = 9.053e-98
Identity = 177/435 (40.69%), Postives = 263/435 (60.46%), Query Frame = 2
Query:  254 SENRVILNIGGFRHETYKATLKKIPATRLSKLTEALA---NYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILN----DIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRV 1537
            ++ R+ LN+GG +HETY +T++  P TRL  + E +    +Y     E FFDRHP +F QVLNYYRTGKLH P DVCGPL+EEEL +WG+D  ++EPCCW TYT+HR  E  L+  N      DID+D+  + +  +K         G   +W K Q +IWAI E+P SS ++K   +++V  IV+S+ + C  T   F             +      S    +  F+ +EYIC +WFTIE+ +R L  P+K  F KS    +D L+++ FY+ +I  +          ++ +   +IR++RLF+  R + GL +++HT +AS  EL LL+  L + +V+F++++YY E+        F SIP+  WW+++TMTTVGYGDM P T+ G  +G  CAI GVL ++LP+ VI SNFS++Y+H QAR KLPKK+ ++
Sbjct:    8 TQKRITLNVGGQKHETYLSTIRNYPDTRLYWVVENVTKAIDYHSEKIELFFDRHPKIFDQVLNYYRTGKLHCPNDVCGPLFEEELAYWGIDEKEMEPCCWTTYTQHREAEHNLKSFNVTDFSTDIDSDRQEETETTSK-------AKGLHPFWVKYQPRIWAILEEPRSSRTAKAFWILSVLLIVLSVATACAITLPQF------------ATEGGSVSSESSAYVAFTVIEYICGVWFTIELGLRLLFCPNKRTFFKSYSFWVDVLSVIPFYVRLIFPH--------EHDLADALQVIRLLRLFRFFRLLYGLQVIMHTLKASSYELFLLLLILLIPVVLFSSIIYYVEKNIDGKTTKFRSIPESFWWSLITMTTVGYGDMTPRTWEGKIIGGACAIFGVLMVALPISVIGSNFSLYYAHAQARLKLPKKKTKI 415          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Medaka
Match: kcnc1b (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:101165633])

HSP 1 Score: 400.593 bits (1028), Expect = 3.210e-131
Identity = 210/464 (45.26%), Postives = 297/464 (64.01%), Query Frame = 2
Query:  251 DSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALA----NYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILN------------DIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFR-IPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKN-------HFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKTP 1570
            D ++R+++N+GG RH+TY++TL+ +P TRLS L E  A    +YD  + E+FFDRHPGVF+ +LNYYRTGKLH P DVCGPLYEEEL FWG+D   VEPCCWMTY +HR  EE L                D + +  +   D++  +    +   +     W + Q ++WA+FEDPYSS  ++ +A+ ++FFI++SI +FCL+T   F  I N   +   DN +   +    +T    +Y+E +C +WFT E ++R    P+KF F+++ +NIIDF+A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER   N  +        F +IP G WWA+VTMTT+GYGDM P T  GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLPKK+ R +P  + +P +P
Sbjct:    5 DDKDRIVINVGGIRHQTYRSTLRTLPGTRLSWLAEPDAPNHFDYDAKIEEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHREAEEALDSFGGGGLLDLGSDDPDPEPEHTEDEVDEMTRRLAQGDSPDARSGSLWSRWQKRVWALFEDPYSSKYARWIALASLFFILVSITTFCLETHEAFNPIVNRTYVEHLDNITTENTYQETETAAYLTYIEGVCVVWFTFEFLMRITFCPNKFDFIRNALNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPNDPRASDHTQFKNIPIGFWWAVVTMTTLGYGDMYPKTTFGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKNRHIP-RAPQPGSP 467          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Medaka
Match: kcnc1b (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:101165633])

HSP 1 Score: 400.208 bits (1027), Expect = 5.799e-131
Identity = 210/464 (45.26%), Postives = 297/464 (64.01%), Query Frame = 2
Query:  251 DSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALA----NYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILN------------DIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFR-IPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKN-------HFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKTP 1570
            D ++R+++N+GG RH+TY++TL+ +P TRLS L E  A    +YD  + E+FFDRHPGVF+ +LNYYRTGKLH P DVCGPLYEEEL FWG+D   VEPCCWMTY +HR  EE L                D + +  +   D++  +    +   +     W + Q ++WA+FEDPYSS  ++ +A+ ++FFI++SI +FCL+T   F  I N   +   DN +   +    +T    +Y+E +C +WFT E ++R    P+KF F+++ +NIIDF+A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER   N  +        F +IP G WWA+VTMTT+GYGDM P T  GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLPKK+ R +P  + +P +P
Sbjct:    5 DDKDRIVINVGGIRHQTYRSTLRTLPGTRLSWLAEPDAPNHFDYDAKIEEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHREAEEALDSFGGGGLLDLGSDDPDPEPEHTEDEVDEMTRRLAQGDSPDARSGSLWSRWQKRVWALFEDPYSSKYARWIALASLFFILVSITTFCLETHEAFNPIVNRTYVEHLDNITTENTYQETETAAYLTYIEGVCVVWFTFEFLMRITFCPNKFDFIRNALNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPNDPRASDHTQFKNIPIGFWWAVVTMTTLGYGDMYPKTTFGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKNRHIP-RAPQPGSP 467          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Medaka
Match: ENSORLT00000045623.1 (potassium voltage-gated channel subfamily C member 1-like [Source:NCBI gene;Acc:101168545])

HSP 1 Score: 381.719 bits (979), Expect = 1.209e-123
Identity = 214/465 (46.02%), Postives = 293/465 (63.01%), Query Frame = 2
Query:  251 DSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALA----NYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDK-------VSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRI--PNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHN-------SKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKTPAGLTP 1585
            DSE ++++N GG RHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP  F+ +LNYYRTGKLH P+DVCGPL+EEEL FWG+D   VE CCWM Y +HR  EE L      + D  +        +  DL      E+  ++   Q W   Q  +WA+FEDPYSS  ++ VA  ++FFI++SI +FCL+T   F        N++V + +   I      T    +YVE +C +WFTIE++ R +  P K  F +S +NIIDF+A++ FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER   +       +   F +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLPKKR + +P  + +P +P    P
Sbjct:    7 DSE-KIVINCGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKSDEFFFDRHPATFAFILNYYRTGKLHCPSDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEPDAPEDDPALTGCADGDLKRLCMQEDGRRATRWQVW---QPWMWALFEDPYSSKYARYVAFASLFFILLSISTFCLETHEAFNTIYNKTENVTVGNFTHEEIVYEV-VTDGWLTYVEGVCVIWFTIEVMARVIFCPDKAEFFRSALNIIDFVAIVPFYLEVALSGLSSKTAKDILSFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPNDPTAAAHTTFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKRNKHIP-RAPQPGSPNYCKP 465          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Medaka
Match: kcnc2 (potassium voltage-gated channel subfamily C member 2 [Source:NCBI gene;Acc:101159160])

HSP 1 Score: 380.563 bits (976), Expect = 2.025e-123
Identity = 207/447 (46.31%), Postives = 273/447 (61.07%), Query Frame = 2
Query:  242 ANMDSENRVILNIGGFRHETYKATLKKIPATRLSKLTE---------------ALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRI----PNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKN-------HFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 1504
               D   R+ILN+GG RHETYK+TLK +P TRL+ L                     Y+    +YFFDRHPGVF+ VLNYYRTGKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY +HR  EE L +      + D+           +E+ H  G+   W K Q  IW +FEDPYSS +++ VA  ++FFI++SI +FCL+T   F       N+ N S  D     + +   +T    +YVE +C  WFTIE ++R    P K  F+K+ +NIIDF+A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER    + +        F +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    2 GKFDDNERIILNVGGTRHETYKSTLKTLPGTRLALLASDSDIDSVLDQLQQVPGFIEYNARTKQYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETDVEPCCWMTYRQHRDAEEALDVFELNVDNGDEDDDVGGGLG--IEDVHVDGNAGLWRKWQPVIWNLFEDPYSSRAARFVAFASLFFILVSITTFCLETHEAFNTIINKTNMRNNSCQD----LVPQYEIETDPALTYVEGVCVFWFTIEFLVRVTFCPVKLEFVKNVLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAKANDPTASQHTKFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMVVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 442          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Medaka
Match: ENSORLT00000039227.1 (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:101159863])

HSP 1 Score: 378.637 bits (971), Expect = 1.648e-122
Identity = 207/433 (47.81%), Postives = 279/433 (64.43%), Query Frame = 2
Query:  263 RVILNIGGFRHETYKATLKKIPATRLSKLTEALA----NYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKV------SKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRI--PNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHN-------SKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 1504
            ++++N GG RHETY++TLK +P TRLS LTE  A    +YDP L+E+FFDRHP VFS +LNYYRTGKLH P DVCGPL+EEEL FWG+D   VE CCWM Y +HR  EE L      + D          +  DL      E+  ++G   WW+  Q +IWA+FEDPYSS  ++ VA +++FFI+ISI +FC++T   F        N+++ + +   I      T    +YVE +C +WFTIE+++R    P K  F KS +NIIDF+A+L FYL++ LS +      + L  L     +RI+R+FKLTRH  GL +L HT RAS  E +LL+ FL + ++IFA ++YYAER   +       +  +F +IP G WWA+VTMTT+GYGDM P T+ GM VGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:   37 KIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKLDEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEPDAPDDDPALGGADGDLKRLCMQEDARRAG---WWKTWQPRIWALFEDPYSSKYARYVAFMSLFFILISISTFCMETHEAFNTIYNKTENVTIGNVTREEIVYEV-VTDSWLTYVEGVCVIWFTIEVLLRVTFCPDKLEFFKSALNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPDDPTASAHTNFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 465          
BLAST of Potassium voltage-gated channel protein vs. Planmine SMEST
Match: SMESG000071446.1 (SMESG000071446.1)

HSP 1 Score: 1176 bits (3041), Expect = 0.000e+0
Identity = 599/600 (99.83%), Postives = 599/600 (99.83%), Query Frame = 2
Query:  248 MDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKTPAGLTPLLSNPPFSLKNHPLNTIPSFTVGNRNELLPILNPTGDTISTLRSSPKKYKANSFFNMEGNKRRQNSTCSENHSFDNTELDRSHSIDIHLNPAIAIRPLLLKQRSPSQQSNKSYLSITGAINSVTAMEVSNIASPIQRFVCVSTEKLSSNNSSFD 2047
            MDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKIVAVITVFFIVISILSFCLKTASHFRIPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKELVLLVFFLCVFIVIFAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKTPAGLTPLLSNPPFSLKNHPLNTIPSFTVGNRNELLPILNPTGDTISTLRSSPKKYKANSFFNMEGNKRRQNSTCSENHSFDNTELDRSHSIDIHLNPAIAIRPLLLKQRSPSQQSNKSYLSITGAINSVTAMEVSNI SPIQRFVCVSTEKLSSNNSSFD
Sbjct:   50 MDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKIVAVITVFFIVISILSFCLKTASHFRIPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKELVLLVFFLCVFIVIFAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKTPAGLTPLLSNPPFSLKNHPLNTIPSFTVGNRNELLPILNPTGDTISTLRSSPKKYKANSFFNMEGNKRRQNSTCSENHSFDNTELDRSHSIDIHLNPAIAIRPLLLKQRSPSQQSNKSYLSITGAINSVTAMEVSNITSPIQRFVCVSTEKLSSNNSSFD 649          

HSP 2 Score: 62.003 bits (149), Expect = 1.094e-9
Identity = 33/41 (80.49%), Postives = 34/41 (82.93%), Query Frame = 3
Query:   39 LTIGYDFIRIEFDISIWTVLFKLNNLHALQIAIDLIFSIQV 161
            LTI     RIEFDISIWTVLFKL NLHALQIA DLIFSIQ+
Sbjct:   10 LTIVGSAERIEFDISIWTVLFKLKNLHALQIANDLIFSIQM 50          
BLAST of Potassium voltage-gated channel protein vs. Planmine SMEST
Match: SMESG000071446.1 (SMESG000071446.1)

HSP 1 Score: 1175.23 bits (3039), Expect = 0.000e+0
Identity = 599/600 (99.83%), Postives = 599/600 (99.83%), Query Frame = 2
Query:  248 MDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKTPAGLTPLLSNPPFSLKNHPLNTIPSFTVGNRNELLPILNPTGDTISTLRSSPKKYKANSFFNMEGNKRRQNSTCSENHSFDNTELDRSHSIDIHLNPAIAIRPLLLKQRSPSQQSNKSYLSITGAINSVTAMEVSNIASPIQRFVCVSTEKLSSNNSSFD 2047
            MDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKIVAVITVFFIVISILSFCLKTASHFRIPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKELVLLVFFLCVFIVIFAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKTPAGLTPLLSNPPFSLKNHPLNTIPSFTVGNRNELLPILNPTGDTISTLRSSPKKYKANSFFNMEGNKRRQNSTCSENHSFDNTELDRSHSIDIHLNPAIAIRPLLLKQRSPSQQSNKSYLSITGAINSVTAMEVSNI SPIQRFVCVSTEKLSSNNSSFD
Sbjct:   60 MDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKIVAVITVFFIVISILSFCLKTASHFRIPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKELVLLVFFLCVFIVIFAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKTPAGLTPLLSNPPFSLKNHPLNTIPSFTVGNRNELLPILNPTGDTISTLRSSPKKYKANSFFNMEGNKRRQNSTCSENHSFDNTELDRSHSIDIHLNPAIAIRPLLLKQRSPSQQSNKSYLSITGAINSVTAMEVSNITSPIQRFVCVSTEKLSSNNSSFD 659          

HSP 2 Score: 82.8037 bits (203), Expect = 4.026e-16
Identity = 40/43 (93.02%), Postives = 41/43 (95.35%), Query Frame = 3
Query:   33 RPLTIGYDFIRIEFDISIWTVLFKLNNLHALQIAIDLIFSIQV 161
            RPLTIGYDFIRIEFDISIWTVLFKL NLHALQIA DLIFSIQ+
Sbjct:   18 RPLTIGYDFIRIEFDISIWTVLFKLKNLHALQIANDLIFSIQM 60          
BLAST of Potassium voltage-gated channel protein vs. Planmine SMEST
Match: SMESG000071446.1 (SMESG000071446.1)

HSP 1 Score: 1173.3 bits (3034), Expect = 0.000e+0
Identity = 599/600 (99.83%), Postives = 599/600 (99.83%), Query Frame = 2
Query:  248 MDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKTPAGLTPLLSNPPFSLKNHPLNTIPSFTVGNRNELLPILNPTGDTISTLRSSPKKYKANSFFNMEGNKRRQNSTCSENHSFDNTELDRSHSIDIHLNPAIAIRPLLLKQRSPSQQSNKSYLSITGAINSVTAMEVSNIASPIQRFVCVSTEKLSSNNSSFD 2047
            MDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKIVAVITVFFIVISILSFCLKTASHFRIPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKELVLLVFFLCVFIVIFAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKTPAGLTPLLSNPPFSLKNHPLNTIPSFTVGNRNELLPILNPTGDTISTLRSSPKKYKANSFFNMEGNKRRQNSTCSENHSFDNTELDRSHSIDIHLNPAIAIRPLLLKQRSPSQQSNKSYLSITGAINSVTAMEVSNI SPIQRFVCVSTEKLSSNNSSFD
Sbjct:    1 MDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKIVAVITVFFIVISILSFCLKTASHFRIPNLHNISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKELVLLVFFLCVFIVIFAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKTPAGLTPLLSNPPFSLKNHPLNTIPSFTVGNRNELLPILNPTGDTISTLRSSPKKYKANSFFNMEGNKRRQNSTCSENHSFDNTELDRSHSIDIHLNPAIAIRPLLLKQRSPSQQSNKSYLSITGAINSVTAMEVSNITSPIQRFVCVSTEKLSSNNSSFD 600          
BLAST of Potassium voltage-gated channel protein vs. Planmine SMEST
Match: SMESG000058857.1 (SMESG000058857.1)

HSP 1 Score: 641.343 bits (1653), Expect = 0.000e+0
Identity = 329/447 (73.60%), Postives = 388/447 (86.80%), Query Frame = 2
Query:  254 SENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISV---------SDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNM-WESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPK 1564
            +++RVILNIGGFRHETYKATLKKIPATRLS+LTEALANYDP+LNE+FFDRHP VF+Q+LNYYRTGKLHYPTDVCGPL+EEELEFWGLD+NQVEPCCWMTYT++R+T+ETLQIL+DI++D D  S +D Y KFGLEEK+++  ++WW +++V+ W +FE+PYSSTS+K+VAVI++ FI+ SILSFCLKTA  FRIP + N S+         S+ ++W +  S  Q+H+ FSY+E ICN WF IEI +R + AP+K  F+KSP+NIID LAL+SF++D  LSN    S +  NLE+LEFFSIIRIMRLFKLTRHI+GLNIL+HTFRAS+KEL+LLVFFL VFIVIFAALMYYAERFQHN  N FNSIPQGLWWAIVTMTTVGYGDMVP TY+GM VGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVE+VRPK
Sbjct:    4 ADHRVILNIGGFRHETYKATLKKIPATRLSRLTEALANYDPILNEFFFDRHPAVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDANQVEPCCWMTYTQYRNTQETLQILDDIEVDPDG-SSEDRYIKFGLEEKYRNNTLKWWHRVKVQTWTMFEEPYSSTSAKMVAVISISFIIFSILSFCLKTAPRFRIPTISNKSLTVILNDAHRSNLTTWYLVNSFYQSHKYFSYIEAICNSWFIIEIFVRFVSAPTKLEFIKSPINIIDILALVSFFVDTFLSNTELLSEKFHNLEVLEFFSIIRIMRLFKLTRHISGLNILLHTFRASMKELILLVFFLIVFIVIFAALMYYAERFQHNKYNDFNSIPQGLWWAIVTMTTVGYGDMVPKTYMGMMVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPK 449          
BLAST of Potassium voltage-gated channel protein vs. Planmine SMEST
Match: SMESG000058857.1 (SMESG000058857.1)

HSP 1 Score: 640.573 bits (1651), Expect = 0.000e+0
Identity = 329/447 (73.60%), Postives = 388/447 (86.80%), Query Frame = 2
Query:  254 SENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKXXXXXXXXXXXXXXLSFCLKTASHFRIPNLHNISV---------SDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNM-WESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKEXXXXXXXXXXXXXXXAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPK 1564
            +++RVILNIGGFRHETYKATLKKIPATRLS+LTEALANYDP+LNE+FFDRHP VF+Q+LNYYRTGKLHYPTDVCGPL+EEELEFWGLD+NQVEPCCWMTYT++R+T+ETLQIL+DI++D D  S +D Y KFGLEEK+++  ++WW +++V+ W +FE+PYSSTS+K+VAVI++ FI+ SILSFCLKTA  FRIP + N S+         S+ ++W +  S  Q+H+ FSY+E ICN WF IEI +R + AP+K  F+KSP+NIID LAL+SF++D  LSN    S +  NLE+LEFFSIIRIMRLFKLTRHI+GLNIL+HTFRAS+KEL+LLVFFL VFIVIFAALMYYAERFQHN  N FNSIPQGLWWAIVTMTTVGYGDMVP TY+GM VGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVE+VRPK
Sbjct:   29 ADHRVILNIGGFRHETYKATLKKIPATRLSRLTEALANYDPILNEFFFDRHPAVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDANQVEPCCWMTYTQYRNTQETLQILDDIEVDPDG-SSEDRYIKFGLEEKYRNNTLKWWHRVKVQTWTMFEEPYSSTSAKMVAVISISFIIFSILSFCLKTAPRFRIPTISNKSLTVILNDAHRSNLTTWYLVNSFYQSHKYFSYIEAICNSWFIIEIFVRFVSAPTKLEFIKSPINIIDILALVSFFVDTFLSNTELLSEKFHNLEVLEFFSIIRIMRLFKLTRHISGLNILLHTFRASMKELILLVFFLIVFIVIFAALMYYAERFQHNKYNDFNSIPQGLWWAIVTMTTVGYGDMVPKTYMGMMVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPK 474          
The following BLAST results are available for this feature:
BLAST of Potassium voltage-gated channel protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNC11.046e-12745.95potassium voltage-gated channel subfamily C member... [more]
KCNC14.389e-12745.95potassium voltage-gated channel subfamily C member... [more]
KCNC22.780e-12046.97potassium voltage-gated channel subfamily C member... [more]
KCNC25.707e-12046.97potassium voltage-gated channel subfamily C member... [more]
KCNC29.586e-12046.97potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Potassium voltage-gated channel protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shw-34.095e-17959.06SHaW family of potassium channels [Source:UniProt... [more]
shw-34.491e-17958.76SHaW family of potassium channels [Source:UniProt... [more]
shw-34.830e-17959.06SHaW family of potassium channels [Source:UniProt... [more]
shw-11.352e-17752.53SHaW family of potassium channels [Source:UniProt... [more]
shw-19.191e-17557.14SHaW family of potassium channels [Source:UniProt... [more]
back to top
BLAST of Potassium voltage-gated channel protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Shaw0.000e+066.89gene:FBgn0003386 transcript:FBtr0089275[more]
Shaw0.000e+066.89gene:FBgn0003386 transcript:FBtr0332185[more]
Shaw0.000e+066.89gene:FBgn0003386 transcript:FBtr0289989[more]
Shaw0.000e+061.71gene:FBgn0003386 transcript:FBtr0332184[more]
Shaw0.000e+066.89gene:FBgn0003386 transcript:FBtr0089274[more]
back to top
BLAST of Potassium voltage-gated channel protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc1a1.307e-12746.74potassium voltage-gated channel, Shaw-related subf... [more]
kcnc21.776e-12747.11potassium voltage-gated channel, Shaw-related subf... [more]
kcnc1a2.172e-12746.74potassium voltage-gated channel, Shaw-related subf... [more]
kcnc1a3.632e-12746.74potassium voltage-gated channel, Shaw-related subf... [more]
kcnc23.942e-12747.11potassium voltage-gated channel, Shaw-related subf... [more]
back to top
BLAST of Potassium voltage-gated channel protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNC25.260e-13345.99potassium channel, voltage gated Shaw related subf... [more]
KCNC27.248e-13345.99potassium channel, voltage gated Shaw related subf... [more]
tamm415.291e-12747.64TAM41 mitochondrial translocator assembly and main... [more]
tamm416.364e-12747.64TAM41 mitochondrial translocator assembly and main... [more]
tamm419.832e-12747.64TAM41 mitochondrial translocator assembly and main... [more]
back to top
BLAST of Potassium voltage-gated channel protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnc19.393e-12845.95potassium voltage gated channel, Shaw-related subf... [more]
Kcnc12.678e-12745.95potassium voltage gated channel, Shaw-related subf... [more]
Kcnc23.016e-12147.23potassium voltage gated channel, Shaw-related subf... [more]
Kcnc23.984e-12147.23potassium voltage gated channel, Shaw-related subf... [more]
Kcnc31.037e-11744.85potassium voltage gated channel, Shaw-related subf... [more]
back to top
BLAST of Potassium voltage-gated channel protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P17972|KCNAW_DROME0.000e+066.89Potassium voltage-gated channel protein Shaw OS=Dr... [more]
sp|G5EFC3|KCNAG_CAEEL5.087e-17258.84Potassium voltage-gated channel protein egl-36 OS=... [more]
sp|P48547|KCNC1_HUMAN5.022e-12745.95Potassium voltage-gated channel subfamily C member... [more]
sp|P15388|KCNC1_MOUSE6.570e-12745.95Potassium voltage-gated channel subfamily C member... [more]
sp|P25122|KCNC1_RAT1.873e-12645.95Potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Potassium voltage-gated channel protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FE930.000e+071.27BTB domain-containing protein OS=Macrostomum ligna... [more]
R7TBS70.000e+069.66BTB domain-containing protein OS=Capitella teleta ... [more]
A0A4E0S2N20.000e+069.34Potassium voltage-gated channel protein Shaw OS=Fa... [more]
A0A267GF750.000e+071.33BTB domain-containing protein OS=Macrostomum ligna... [more]
A0A1C9TA760.000e+065.12Delayed rectifier potassium channel Shaw-like memb... [more]
back to top
BLAST of Potassium voltage-gated channel protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc1a1.606e-12546.62potassium voltage-gated channel subfamily C member... [more]
kcnc1a2.002e-12546.62potassium voltage-gated channel subfamily C member... [more]
kcnc1a8.280e-12546.62potassium voltage-gated channel subfamily C member... [more]
kcnc1b1.162e-12446.21potassium voltage-gated channel subfamily C member... [more]
kcnc1b2.951e-12446.21potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Potassium voltage-gated channel protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc1a1.671e-12848.29potassium voltage-gated channel, Shaw-related subf... [more]
ENSPMAT00000004235.11.990e-8237.88pep scaffold:Pmarinus_7.0:GL476413:398954:411573:-... [more]
kcna1b4.317e-6937.41potassium voltage-gated channel, shaker-related su... [more]
ENSPMAT00000007589.15.458e-6947.83pep scaffold:Pmarinus_7.0:GL482983:7539:12291:-1 g... [more]
kcna1b8.096e-6837.62potassium voltage-gated channel, shaker-related su... [more]
back to top
BLAST of Potassium voltage-gated channel protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Potassium voltage-gated channel protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO398049.585e-12346.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427242.784e-12048.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382372.213e-10340.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480661.568e-9841.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451729.053e-9840.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Potassium voltage-gated channel protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc1b3.210e-13145.26potassium voltage-gated channel subfamily C member... [more]
kcnc1b5.799e-13145.26potassium voltage-gated channel subfamily C member... [more]
ENSORLT00000045623.11.209e-12346.02potassium voltage-gated channel subfamily C member... [more]
kcnc22.025e-12346.31potassium voltage-gated channel subfamily C member... [more]
ENSORLT00000039227.11.648e-12247.81potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Potassium voltage-gated channel protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071446.11.094e-999.83SMESG000071446.1[more]
SMESG000071446.14.026e-1699.83SMESG000071446.1[more]
SMESG000071446.10.000e+099.83SMESG000071446.1[more]
SMESG000058857.10.000e+073.60SMESG000058857.1[more]
SMESG000058857.10.000e+073.60SMESG000058857.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001885 ID=SMED30001885|Name=Potassium voltage-gated channel protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2071bp
TGTGCATTGTGTGTGTGTCACATTGAATATACAGGCCGTTGACAATTGGA
TATGATTTTATAAGGATTGAATTTGATATATCGATTTGGACTGTATTGTT
TAAATTGAACAATTTACATGCTTTGCAAATCGCGATTGATTTGATTTTTT
CGATTCAGGTATTGTTTTAGAAAAGTCTAAATGTTTCGTCAAAACCAATT
AAACTGAGGGTCAACACCTGACTTTGCTCTTGTGGCGAGGGGCCAATATG
GATTCTGAAAATAGAGTAATTTTGAATATAGGAGGATTTAGACATGAAAC
CTATAAAGCGACACTGAAAAAAATTCCTGCAACAAGATTGTCGAAATTAA
CAGAAGCGTTAGCAAATTACGATCCGGTTTTAAATGAATACTTTTTTGAT
CGTCATCCTGGAGTGTTCAGTCAAGTTCTTAATTATTATAGAACTGGTAA
GTTGCATTATCCAACCGATGTCTGTGGACCTTTATACGAAGAAGAACTGG
AATTCTGGGGACTTGATTCCAATCAAGTAGAACCGTGCTGTTGGATGACT
TACACCCGTCATCGAAGTACCGAGGAAACCCTTCAAATTTTAAATGACAT
CGATATTGATACTGACAAAGTCTCAAAAGATGATCTTTATGCCAAATTTG
GTCTAGAAGAAAAACATCAATCTGGCGACATTCAATGGTGGGAAAAATTG
CAAGTTAAAATTTGGGCTATATTTGAAGATCCATATTCTTCGACTTCTTC
AAAGATCGTCGCAGTGATCACAGTGTTTTTCATCGTCATATCTATTCTGT
CATTTTGTTTGAAAACTGCCAGCCACTTCCGCATTCCAAATCTACACAAC
ATTTCTGTGTCGGACAATTCCAGTTGGGCCATCTCAAAGAGCAGTCCGCA
AACTCATCAGATTTTCAGTTACGTGGAATACATTTGCAATTTATGGTTCA
CAATCGAGATAATCATCAGATCTTTGGTGGCACCGTCGAAATTTATCTTT
TTAAAATCTCCAGTAAATATAATTGACTTTCTAGCGCTCTTGTCTTTTTA
TCTTGACATAATTCTTTCAAACATGTGGGAGTCGGGTCAAATGGAGAATT
TAGAAATGTTAGAATTTTTCAGCATCATTAGGATTATGCGTTTGTTTAAA
CTGACCCGGCATATTGCCGGATTGAATATATTGGTTCACACTTTTCGCGC
ATCCCTTAAAGAATTGGTGTTATTGGTGTTTTTTCTTTGCGTTTTTATTG
TAATATTTGCCGCTTTGATGTATTATGCCGAGAGATTCCAACATAATTCG
AAAAACCATTTCAATTCAATTCCACAAGGTCTATGGTGGGCTATTGTTAC
GATGACCACGGTTGGGTATGGAGACATGGTTCCCCATACTTATATAGGAA
TGACAGTTGGAGCATTATGTGCAATCACCGGGGTTTTGACTATTTCTCTG
CCAGTCCCTGTAATAGTTAGTAATTTTTCCATGTTCTATTCGCACACTCA
GGCTAGATCTAAGCTGCCTAAAAAACGGCGCCGGGTTTTACCAGTAGAAT
CTGTTAGACCAAAGACTCCAGCTGGATTGACTCCTTTGCTCAGTAATCCT
CCATTTTCTTTAAAGAATCATCCATTAAATACGATTCCATCGTTTACTGT
TGGAAATCGAAATGAATTGCTTCCCATACTTAATCCAACTGGAGACACAA
TATCGACATTAAGGAGCTCTCCAAAGAAATATAAAGCAAACTCATTTTTC
AATATGGAAGGAAATAAACGGAGACAGAATTCGACTTGTTCAGAAAATCA
CAGTTTCGACAACACAGAGCTAGACCGGTCACACTCTATAGATATACATT
TAAATCCCGCTATCGCCATCAGGCCGCTTCTATTAAAACAAAGATCACCG
TCACAACAATCAAACAAATCATATCTCTCGATAACCGGAGCTATCAATTC
CGTGACGGCAATGGAAGTGAGCAATATCGCATCGCCCATTCAACGGTTCG
TTTGTGTTTCAACAGAGAAATTATCCTCAAATAATTCATCTTTTGATCCT
TGACAATTTCTATAATAAAAT
back to top

protein sequence of SMED30001885-orf-1

>SMED30001885-orf-1 ID=SMED30001885-orf-1|Name=SMED30001885-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=602bp
MDSENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFF
DRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWM
TYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEK
LQVKIWAIFEDPYSSTSSKIVAVITVFFIVISILSFCLKTASHFRIPNLH
NISVSDNSSWAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFI
FLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLF
KLTRHIAGLNILVHTFRASLKELVLLVFFLCVFIVIFAALMYYAERFQHN
SKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTIS
LPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPKTPAGLTPLLSN
PPFSLKNHPLNTIPSFTVGNRNELLPILNPTGDTISTLRSSPKKYKANSF
FNMEGNKRRQNSTCSENHSFDNTELDRSHSIDIHLNPAIAIRPLLLKQRS
PSQQSNKSYLSITGAINSVTAMEVSNIASPIQRFVCVSTEKLSSNNSSFD
P*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR015572Shaw_inv
IPR003974K_chnl_volt-dep_Kv3
IPR028325VG_K_chnl
IPR003968K_chnl_volt-dep_Kv
IPR000210BTB/POZ_dom
IPR027359Volt_channel_dom_sf
IPR005821Ion_trans_dom
IPR003131T1-type_BTB
IPR011333SKP1/BTB/POZ_sf
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0055085transmembrane transport
GO:0006811ion transport
GO:0051260protein homooligomerization
GO:0006810transport
GO:0030431sleep
GO:0034765regulation of ion transmembrane transport
GO:0071805potassium ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0005515protein binding
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005267potassium channel activity
GO:0022843voltage-gated cation channel activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00169KCHANNELcoord: 384..410
score: 66.36
coord: 293..319
score: 51.43
coord: 47..66
score: 61.49
coord: 162..190
score: 42.48
coord: 251..271
score: 40.3
coord: 322..345
score: 49.53
coord: 225..248
score: 42.53
coord: 355..377
score: 73.29
NoneNo IPR availableGENE3DG3DSA:3.30.710.10coord: 1..115
e-value: 9.4E-52
score: 176.0
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 307..418
e-value: 8.1E-32
score: 111.2
NoneNo IPR availableCDDcd18416BTB_Shaw-likecoord: 4..115
e-value: 8.80514E-84
score: 255.272
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 168..411
NoneNo IPR availableTMHMMTMhelixcoord: 360..378
NoneNo IPR availableTMHMMTMhelixcoord: 323..345
NoneNo IPR availableTMHMMTMhelixcoord: 385..407
NoneNo IPR availableTMHMMTMhelixcoord: 170..188
IPR003974Potassium channel, voltage dependent, Kv3PRINTSPR01498SHAWCHANNELcoord: 81..102
score: 80.81
coord: 48..61
score: 79.37
coord: 63..78
score: 91.32
coord: 159..171
score: 55.13
coord: 420..434
score: 59.63
IPR003968Potassium channel, voltage dependent, KvPRINTSPR01491KVCHANNELcoord: 298..306
score: 62.41
coord: 47..57
score: 74.09
coord: 395..406
score: 78.06
coord: 322..336
score: 48.56
IPR000210BTB/POZ domainSMARTSM00225BTB_4coord: 5..105
e-value: 4.1E-12
score: 56.3
IPR003131Potassium channel tetramerisation-type BTB domainPFAMPF02214BTB_2coord: 7..97
e-value: 6.6E-28
score: 96.9
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 140..305
e-value: 1.2E-47
score: 163.5
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 170..417
e-value: 2.1E-42
score: 145.0
IPR028325Voltage-gated potassium channelPANTHERPTHR11537VOLTAGE-GATED POTASSIUM CHANNELcoord: 2..446
IPR015572Potassium channel, voltage dependent, Shaw, invertebratePANTHERPTHR11537:SF257POTASSIUM VOLTAGE-GATED CHANNEL PROTEIN SHAWcoord: 2..446
IPR011333SKP1/BTB/POZ domain superfamilySUPERFAMILYSSF54695POZ domaincoord: 5..105