Kinesin motor domain protein

Overview
NameKinesin motor domain protein
Smed IDSMED30001877
Length (bp)2755
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinesin motor domain protein (SMED30001877) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinesin motor domain protein (SMED30001877) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001877

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30001877SMESG000077785.1 Contig3135_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinesin motor domain protein vs. Ensembl Human
Match: KIFC1 (kinesin family member C1 [Source:HGNC Symbol;Acc:HGNC:6389])

HSP 1 Score: 167.162 bits (422), Expect = 2.147e-42
Identity = 120/361 (33.24%), Postives = 174/361 (48.20%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVTDG-----GNILEFIGSE--------------------SITLQIAPNER--FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQ-HGLMQRALTTILT-EERLRQRDCEYKITACVVEIYNDNCIDVLS--------GETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFE--DIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRF 2640
            RR  +N +QE  GNIRV+CR R V  G       +L F                        +++   AP  R  F FD+VF PG  Q E++EE   LV S +DGY VC   YG   SGKTFT+ GG  G  Q  GL+ RAL  + +  + L  +   Y   A  VEIYN+   D+L+        GE  I+       E      + VP++ E + +AL+ + +  R VARTA N  SSRSH +  +++ G+    G    + L L DLAG E  D   A     +   +E   IN SL+    V ++L  ++ + V YR +KLT+LL+  L  S K  + + +   + ++  + N+LRF
Sbjct:  297 RRRLHNQLQELKGNIRVFCRVRPVLPGEPTPPPGLLLFPSGPGGPSDPPTRLSLSRSDERRGTLSGAPAPPTRHDFSFDRVFPPGSGQDEVFEEIAMLVQSALDGYPVCIFAYGQTGSGKTFTMEGGPGGDPQLEGLIPRALRHLFSVAQELSGQGWTYSFVASYVEIYNETVRDLLATGTRKGQGGECEIRRAGPGSEELTVTNARYVPVSCEKEVDALLHLARQNRAVARTAQNERSSRSHSVFQLQISGEHSSRGLQCGAPLSLVDLAGSERLDPGLALGPGERERLRETQAINSSLSTLGLVIMALSNKE-SHVPYRNSKLTYLLQNSLGGSAKMLMFVNISPLEENVSESLNSLRF 656          
BLAST of Kinesin motor domain protein vs. Ensembl Human
Match: KIFC1 (kinesin family member C1 [Source:HGNC Symbol;Acc:HGNC:6389])

HSP 1 Score: 167.162 bits (422), Expect = 2.147e-42
Identity = 120/361 (33.24%), Postives = 174/361 (48.20%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVTDG-----GNILEFIGSE--------------------SITLQIAPNER--FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQ-HGLMQRALTTILT-EERLRQRDCEYKITACVVEIYNDNCIDVLS--------GETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFE--DIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRF 2640
            RR  +N +QE  GNIRV+CR R V  G       +L F                        +++   AP  R  F FD+VF PG  Q E++EE   LV S +DGY VC   YG   SGKTFT+ GG  G  Q  GL+ RAL  + +  + L  +   Y   A  VEIYN+   D+L+        GE  I+       E      + VP++ E + +AL+ + +  R VARTA N  SSRSH +  +++ G+    G    + L L DLAG E  D   A     +   +E   IN SL+    V ++L  ++ + V YR +KLT+LL+  L  S K  + + +   + ++  + N+LRF
Sbjct:  297 RRRLHNQLQELKGNIRVFCRVRPVLPGEPTPPPGLLLFPSGPGGPSDPPTRLSLSRSDERRGTLSGAPAPPTRHDFSFDRVFPPGSGQDEVFEEIAMLVQSALDGYPVCIFAYGQTGSGKTFTMEGGPGGDPQLEGLIPRALRHLFSVAQELSGQGWTYSFVASYVEIYNETVRDLLATGTRKGQGGECEIRRAGPGSEELTVTNARYVPVSCEKEVDALLHLARQNRAVARTAQNERSSRSHSVFQLQISGEHSSRGLQCGAPLSLVDLAGSERLDPGLALGPGERERLRETQAINSSLSTLGLVIMALSNKE-SHVPYRNSKLTYLLQNSLGGSAKMLMFVNISPLEENVSESLNSLRF 656          
BLAST of Kinesin motor domain protein vs. Ensembl Human
Match: KIFC1 (kinesin family member C1 [Source:HGNC Symbol;Acc:HGNC:6389])

HSP 1 Score: 167.162 bits (422), Expect = 2.147e-42
Identity = 120/361 (33.24%), Postives = 174/361 (48.20%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVTDG-----GNILEFIGSE--------------------SITLQIAPNER--FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQ-HGLMQRALTTILT-EERLRQRDCEYKITACVVEIYNDNCIDVLS--------GETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFE--DIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRF 2640
            RR  +N +QE  GNIRV+CR R V  G       +L F                        +++   AP  R  F FD+VF PG  Q E++EE   LV S +DGY VC   YG   SGKTFT+ GG  G  Q  GL+ RAL  + +  + L  +   Y   A  VEIYN+   D+L+        GE  I+       E      + VP++ E + +AL+ + +  R VARTA N  SSRSH +  +++ G+    G    + L L DLAG E  D   A     +   +E   IN SL+    V ++L  ++ + V YR +KLT+LL+  L  S K  + + +   + ++  + N+LRF
Sbjct:  297 RRRLHNQLQELKGNIRVFCRVRPVLPGEPTPPPGLLLFPSGPGGPSDPPTRLSLSRSDERRGTLSGAPAPPTRHDFSFDRVFPPGSGQDEVFEEIAMLVQSALDGYPVCIFAYGQTGSGKTFTMEGGPGGDPQLEGLIPRALRHLFSVAQELSGQGWTYSFVASYVEIYNETVRDLLATGTRKGQGGECEIRRAGPGSEELTVTNARYVPVSCEKEVDALLHLARQNRAVARTAQNERSSRSHSVFQLQISGEHSSRGLQCGAPLSLVDLAGSERLDPGLALGPGERERLRETQAINSSLSTLGLVIMALSNKE-SHVPYRNSKLTYLLQNSLGGSAKMLMFVNISPLEENVSESLNSLRF 656          
BLAST of Kinesin motor domain protein vs. Ensembl Human
Match: KIFC3 (kinesin family member C3 [Source:HGNC Symbol;Acc:HGNC:6326])

HSP 1 Score: 159.073 bits (401), Expect = 9.188e-40
Identity = 114/359 (31.75%), Postives = 176/359 (49.03%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVT--DG-----GNILEFIGSESITLQIAPNER---FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETN----IQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVNLNGQVS 2709
            R+  +N +    GNIRV  R R VT  DG      N + F   +   + +    +   FE DKVF P  SQ ++++E + LV S IDG+NVC   YG   +GKT+T+ G  E     G+ QRAL  + +E + +  D EY IT    EIYN+   D+L  E      I+L  D   +     L    + +  D   + +     R    T LN  SSRSH + ++ ++G     G      L L DLAG E + K+  + +++  +EA +IN+SL+A   V  +LR +  + V +R +KLT+LL+  L+   K  +++ V   +++   T  +L+F    R V LG   R+  L    S
Sbjct:  293 RKKCHNELVRLKGNIRVIARVRPVTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAENP---GINQRALQLLFSEVQEKASDWEYTITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGHTNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGSRL--REAQHINKSLSALGDVIAALRSRQGH-VPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLKFAERVRSVELGPGLRRAELGSWSS 645          
BLAST of Kinesin motor domain protein vs. Ensembl Human
Match: KIFC3 (kinesin family member C3 [Source:HGNC Symbol;Acc:HGNC:6326])

HSP 1 Score: 159.073 bits (401), Expect = 9.188e-40
Identity = 114/359 (31.75%), Postives = 176/359 (49.03%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVT--DG-----GNILEFIGSESITLQIAPNER---FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETN----IQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVNLNGQVS 2709
            R+  +N +    GNIRV  R R VT  DG      N + F   +   + +    +   FE DKVF P  SQ ++++E + LV S IDG+NVC   YG   +GKT+T+ G  E     G+ QRAL  + +E + +  D EY IT    EIYN+   D+L  E      I+L  D   +     L    + +  D   + +     R    T LN  SSRSH + ++ ++G     G      L L DLAG E + K+  + +++  +EA +IN+SL+A   V  +LR +  + V +R +KLT+LL+  L+   K  +++ V   +++   T  +L+F    R V LG   R+  L    S
Sbjct:  293 RKKCHNELVRLKGNIRVIARVRPVTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAENP---GINQRALQLLFSEVQEKASDWEYTITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGHTNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGSRL--REAQHINKSLSALGDVIAALRSRQGH-VPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLKFAERVRSVELGPGLRRAELGSWSS 645          
BLAST of Kinesin motor domain protein vs. Ensembl Celegans
Match: klp-17 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:Q23124])

HSP 1 Score: 150.984 bits (380), Expect = 1.298e-38
Identity = 107/327 (32.72%), Postives = 165/327 (50.46%), Query Frame = 1
Query: 1711 GNIRVYCRCRHVT-DGGNILEFIGSESITLQ--IAPNERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEER--LRQRDCEYKITACVVEIYNDNCIDVLSGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKA 2676
            G IRV  R R    DG +    I    + LQ     +  + F+ VF P  +Q  ++ E + L+M  + G NVC I YG   SGKTFT+ G +   S+ G++ RA+  +L + +  L      YK  A  +E+YN+   D+L G+  +++ + NG +T    LK + I N +D + ++ +   +R VA TA N  SSRSH I  I + G++   GE +   L L DLAG E     ETQ       E   IN+SL+   +  +  +    + V YR++KLT +L+ +L  +G    +     + R +  T+ TL F  E R  +LGKA
Sbjct:  144 GQIRVAIRVRDFERDGSSNFSIISQNEVQLQQTTGQSNTYSFEHVFFPPTAQSGVFGEIKELIMCALHGKNVCLIAYGPTGSGKTFTMRGEDSADSE-GVIPRAIRFMLEQSKRDLAMIGWNYKFQASFIEVYNEEVYDLLDGKQKLEVKI-NGSKTNVVGLKKIEIGNISDVDVILNLADSQRSVASTASNEHSSRSHAIFQIFVDGQN-ASGEMVQCCLNLVDLAGSERA--KETQARGKQFTELTNINQSLSTLKKC-IRAQMTKMSHVPYRDSKLTMVLREYL-GAGSSKTMFIAHANPRDVAETKRTLEFTSELRSTNLGKA 463          
BLAST of Kinesin motor domain protein vs. Ensembl Celegans
Match: klp-3 (Kinesin-like protein klp-3 [Source:UniProtKB/Swiss-Prot;Acc:P45962])

HSP 1 Score: 128.257 bits (321), Expect = 1.639e-30
Identity = 95/338 (28.11%), Postives = 161/338 (47.63%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRH--------------VTDGGNILEFIGSESITLQIAPNERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVL-SGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFG 2643
            R+  +N + E  GNIRV+ R R               + +  N +  + + + T + +       DKV     SQ +++ E  P++ S IDGYNVC   YG   SGKT+T+ G     +  G+ QRA+  +    + R  D +Y I   ++EIYN+   D+L +  TN+ +       ++   L+ V + +  +    +   +  + VA T  N  SSRSH+I  + +   + I        L L DLAG E +  ++T     L KEA  IN+SL+    V ++LR Q+   + +R  +LT +L+  L    K  +I+ +  D +SL  + +++ F 
Sbjct:  232 RKQLHNQLVELNGNIRVFYRIRPQLASETDNQKPVVVIDEMDNGVVHVSNTTGTRKTSAGA----DKVIPTDFSQDQIFNEVSPIITSCIDGYNVCIFAYGHTGSGKTYTMDG---PVTMPGINQRAIMQLFETAKERTGDIKYDIKVAMMEIYNEKIRDLLNTSNTNLAIRQTEEGRSSIPGLEEVSVNSAEEVTETLARGRKNKAVAATEANIESSRSHVIVRVLVSATNLITKATTVGRLNLVDLAGSERV--SQTNATGQLLKEAQAINKSLSELGNVVLALR-QNQKHIPFRNCQLTRILEDSLNGDSKTLVIVHLSPDAKSLNESISSVNFA 559          
BLAST of Kinesin motor domain protein vs. Ensembl Celegans
Match: klp-16 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:G5ECC0])

HSP 1 Score: 127.102 bits (318), Expect = 3.894e-30
Identity = 101/353 (28.61%), Postives = 169/353 (47.88%), Query Frame = 1
Query: 1678 RHAYNLMQEQMGNIRVYCRCR-----HVTDGGNILEFIGSESITLQIA--PNERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTE-ERLRQRDCEYKITACVVEIYNDNCIDVLSGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLT-NSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVNLNGQVS 2709
            R  +N + +  G IRV  R R      V    + +E+   ++I +     P    +F+ VF P  SQ E++      + S + GYNV  I YG   SGKT T+ GGN    + G++ RA   +  E ++L     ++  +   +E+YN+   D+LSG   +QL + N    +   L    I+N +D   L++V    RK A T  N +SSRSH + + +++      G +    L L DLAG E   ++    ++   KE   IN+SL+   ++ +S ++     VSYR++KLT +L   L   S K  +++ +         ++ ++ F  + R   +G A +Q  L G VS
Sbjct:  236 RKLHNDVVDLRGQIRVAVRVRPLIKSEVDTSSSAIEYPAVDAIKINEGSKPGNVVKFENVFTPVFSQKEVFANVEEFIRSSLHGYNVGLIAYGQTGSGKTHTMRGGN--GEEEGIIPRAAAFLFAESKKLESLGWKFDFSLSFLEVYNNVAYDLLSGRDVVQLRL-NDQTVSMIGLSEHTISNVSDVARLLRVADGGRKTAATKCNGSSSRSHAVYMWKIKAHQPSTGISTTCQLKLVDLAGSERAKESGVSGDQF--KEMTNINQSLSIL-QMCISQQRSQKGHVSYRDSKLTQVLMDCLGRGSSKTMVVVNLNPCNEQATESKRSIEFASKMRSTHIGSAVQQRTLLGDVS 582          
BLAST of Kinesin motor domain protein vs. Ensembl Celegans
Match: klp-16 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:G5ECC0])

HSP 1 Score: 127.102 bits (318), Expect = 3.894e-30
Identity = 101/353 (28.61%), Postives = 169/353 (47.88%), Query Frame = 1
Query: 1678 RHAYNLMQEQMGNIRVYCRCR-----HVTDGGNILEFIGSESITLQIA--PNERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTE-ERLRQRDCEYKITACVVEIYNDNCIDVLSGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLT-NSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVNLNGQVS 2709
            R  +N + +  G IRV  R R      V    + +E+   ++I +     P    +F+ VF P  SQ E++      + S + GYNV  I YG   SGKT T+ GGN    + G++ RA   +  E ++L     ++  +   +E+YN+   D+LSG   +QL + N    +   L    I+N +D   L++V    RK A T  N +SSRSH + + +++      G +    L L DLAG E   ++    ++   KE   IN+SL+   ++ +S ++     VSYR++KLT +L   L   S K  +++ +         ++ ++ F  + R   +G A +Q  L G VS
Sbjct:  236 RKLHNDVVDLRGQIRVAVRVRPLIKSEVDTSSSAIEYPAVDAIKINEGSKPGNVVKFENVFTPVFSQKEVFANVEEFIRSSLHGYNVGLIAYGQTGSGKTHTMRGGN--GEEEGIIPRAAAFLFAESKKLESLGWKFDFSLSFLEVYNNVAYDLLSGRDVVQLRL-NDQTVSMIGLSEHTISNVSDVARLLRVADGGRKTAATKCNGSSSRSHAVYMWKIKAHQPSTGISTTCQLKLVDLAGSERAKESGVSGDQF--KEMTNINQSLSIL-QMCISQQRSQKGHVSYRDSKLTQVLMDCLGRGSSKTMVVVNLNPCNEQATESKRSIEFASKMRSTHIGSAVQQRTLLGDVS 582          
BLAST of Kinesin motor domain protein vs. Ensembl Celegans
Match: klp-15 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:P91400])

HSP 1 Score: 122.479 bits (306), Expect = 1.170e-28
Identity = 100/353 (28.33%), Postives = 168/353 (47.59%), Query Frame = 1
Query: 1678 RHAYNLMQEQMGNIRVYCRCRHVTDG-----GNILEFIGSESITLQIA--PNERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEER-LRQRDCEYKITACVVEIYNDNCIDVLSGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLT-NSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVNLNGQVS 2709
            R  +N + +  G IRV  R R +         + +E+   ++I +     P    +F+KVF P  SQ E++      + S + GYNV  I YG   SGKT T+ GGN    + G++ RA   +  E R L     ++  +   +E+YN+   D+LS    +QL + N    +   L    I+N +D   L++V    RK A T  N +SSRSH + + ++       G +    L L DLAG E   ++    ++   KE   IN+SL+   ++ +S ++     VSYR++KLT +L   L   + K  +++ +         ++ ++ F  + R  ++G A +Q  L G VS
Sbjct:  236 RKLHNDVVDLRGQIRVAVRVRPLIKSEADASSSAIEYPAIDTIRINEGSKPGIVVKFEKVFTPVFSQKEVFANVEEFIRSSLHGYNVGLIAYGQTGSGKTHTMRGGN--GEEEGIIPRAAAFLFAESRKLESLGWKFDFSLSFLEVYNNVAYDLLSDRAVVQLRL-NDQTVSMIGLSEHTISNVSDVARLLRVADGGRKTAATKCNESSSRSHAVYMWKITAHQPSTGISTSCQLKLVDLAGSERAKESGVSGDQF--KEMTNINQSLSIL-QMCISQQRSQKGHVSYRDSKLTQVLMDCLGRGNSKTMVVVNLNPCNEQATESKRSIEFASKMRSTNIGSAVQQRTLLGDVS 582          
BLAST of Kinesin motor domain protein vs. Ensembl Fly
Match: ncd (gene:FBgn0002924 transcript:FBtr0344976)

HSP 1 Score: 152.91 bits (385), Expect = 4.786e-38
Identity = 114/363 (31.40%), Postives = 168/363 (46.28%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVTDGGN-----ILEFIGSESITLQIAPNER--------FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEER-LRQRDCEYKITACVVEIYNDNCIDVLSGETN---IQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVS-LRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVNLNGQVS 2709
            R+  +N + +  GNIRV+CR R   +           +    ++ LQ    +         F FD+VFHP  SQ +++E   PL+ S +DGYN+C   YG   SGKT+T+ G  E     G++ R +  +    R  R    EY+I A  +EIYN+   D+LS E     I++  +N  +     +    + +      LM   K+ R  A TA N  SSRSH +T + L G+     E     + L DLAG E    +   T      E   INRSL+    V ++ L+KQD   + YR +KLTHLL P L  + K  + I V   +     +  +LRF        + KA+R   LN  V+
Sbjct:  335 RKELHNTVMDLRGNIRVFCRIRPPLESEENRMCCTWTYHDESTVELQSIDAQAKSKMGQQIFSFDQVFHPLSSQSDIFEMVSPLIQSALDGYNICIFAYGQTGSGKTYTMDGVPESV---GVIPRTVDLLFDSIRGYRNLGWEYEIKATFLEIYNEVLYDLLSNEQKDMEIRMAKNNKNDIYVSNITEETVLDPNHLRHLMHTAKMNRATASTAGNERSSRSHAVTKLELIGRHAEKQEISVGSINLVDLAGSESPKTSTRMT------ETKNINRSLSELTNVILALLQKQD--HIPYRNSKLTHLLMPSLGGNSKTLMFINVSPFQDCFQESVKSLRFAASVNSCKMTKAKRNRYLNNSVA 686          
BLAST of Kinesin motor domain protein vs. Ensembl Fly
Match: ncd (gene:FBgn0002924 transcript:FBtr0085534)

HSP 1 Score: 152.91 bits (385), Expect = 4.786e-38
Identity = 114/363 (31.40%), Postives = 168/363 (46.28%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVTDGGN-----ILEFIGSESITLQIAPNER--------FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEER-LRQRDCEYKITACVVEIYNDNCIDVLSGETN---IQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVS-LRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVNLNGQVS 2709
            R+  +N + +  GNIRV+CR R   +           +    ++ LQ    +         F FD+VFHP  SQ +++E   PL+ S +DGYN+C   YG   SGKT+T+ G  E     G++ R +  +    R  R    EY+I A  +EIYN+   D+LS E     I++  +N  +     +    + +      LM   K+ R  A TA N  SSRSH +T + L G+     E     + L DLAG E    +   T      E   INRSL+    V ++ L+KQD   + YR +KLTHLL P L  + K  + I V   +     +  +LRF        + KA+R   LN  V+
Sbjct:  335 RKELHNTVMDLRGNIRVFCRIRPPLESEENRMCCTWTYHDESTVELQSIDAQAKSKMGQQIFSFDQVFHPLSSQSDIFEMVSPLIQSALDGYNICIFAYGQTGSGKTYTMDGVPESV---GVIPRTVDLLFDSIRGYRNLGWEYEIKATFLEIYNEVLYDLLSNEQKDMEIRMAKNNKNDIYVSNITEETVLDPNHLRHLMHTAKMNRATASTAGNERSSRSHAVTKLELIGRHAEKQEISVGSINLVDLAGSESPKTSTRMT------ETKNINRSLSELTNVILALLQKQD--HIPYRNSKLTHLLMPSLGGNSKTLMFINVSPFQDCFQESVKSLRFAASVNSCKMTKAKRNRYLNNSVA 686          
BLAST of Kinesin motor domain protein vs. Ensembl Fly
Match: Klp61F (gene:FBgn0004378 transcript:FBtr0072733)

HSP 1 Score: 142.51 bits (358), Expect = 3.253e-34
Identity = 104/345 (30.14%), Postives = 172/345 (49.86%), Query Frame = 1
Query: 1714 NIRVYCRCRHVTD------GGNILEFIGSESI----TLQIAPNERFEFDKVFHPGMSQIELYEEF-RPLVMSFIDGYNVCFITYGGEASGKTFTLIGGN--------EGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGE--TNIQLYVDNGMETAY--QKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSH----LITLIRLQGKSKIHGENICSF--LCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGV 2661
            NI+VY R R +           +++ +G   +    TL     ++F FD+ F P   Q ++Y     PL+   ++GYN     YG   +GKT T++G          E  S  G++ RAL+ +  E  LR  + EY +    +E+YN+   D+LS +  T I+++ D+  + +   Q L+ +P+ ++ D   L++  K +RK A T +N  SSRSH    ++  IR  G   I GE++     L L DLAG E++ KA  +   +  +E   IN+SL    RV  +L  + P+ V YRE+KLT LL+  L    K ++I T+    + +  T +TL +    + +
Sbjct:   19 NIQVYVRVRPLNSRERCIRSAEVVDVVGPREVVTRHTLDSKLTKKFTFDRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGTGKTHTMVGNETAELKSSWEDDSDIGIIPRALSHLFDE--LRMMEVEYTMRISYLELYNEELCDLLSTDDTTKIRIFDDSTKKGSVIIQGLEEIPVHSKDDVYKLLEKGKERRKTATTLMNAQSSRSHTVFSIVVHIRENG---IEGEDMLKIGKLNLVDLAGSENVSKAGNEKG-IRVRETVNINQSLLTLGRVITALVDRAPH-VPYRESKLTRLLQESLGGRTKTSIIATISPGHKDIEETLSTLEYAHRAKNI 356          
BLAST of Kinesin motor domain protein vs. Ensembl Fly
Match: Khc (gene:FBgn0001308 transcript:FBtr0087184)

HSP 1 Score: 113.62 bits (283), Expect = 3.013e-25
Identity = 96/332 (28.92%), Postives = 159/332 (47.89%), Query Frame = 1
Query: 1714 NIRVYCRCRHVTDGGNILEFIGSESIT----------LQIAPNERFEFDKVFHPGMSQIELY-EEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLS-GETNIQLYVDNG----METAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGV 2661
            +I+V CR R + D     E  GS+ +           + IA  + + FDKVF P  SQ ++Y E  + +V   + GYN     YG  +SGKT T+ G    S + G++ R +  I       + + E+ I     EIY D   D+L   + N+ ++ D      ++ A ++  S P     D   +++  K  R +A T +N  SSRSH + LI ++ ++  + + +   L L DLAG E + K  T     +  EA  IN+SL+A   V  +L   +   + YR++KLT +L+  L  + +  ++I       +   T++TL FGR  + V
Sbjct:   12 SIKVVCRFRPLNDSE---EKAGSKFVVKFPNNVEENCISIA-GKVYLFDKVFKPNASQEKVYNEAAKSIVTDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDSVKQGIIPRIVNDIFNHIYAMEVNLEFHIKVSYYEIYMDKIRDLLDVSKVNLSVHEDKNRVPYVKGATERFVSSP----EDVFEVIEEGKSNRHIAVTNMNEHSSRSHSVFLINVKQENLENQKKLSGKLYLVDLAGSEKVSK--TGAEGTVLDEAKNINKSLSALGNVISALADGNKTHIPYRDSKLTRILQESLGGNARTTIVICCSPASFNESETKSTLDFGRRAKTV 333          
BLAST of Kinesin motor domain protein vs. Ensembl Fly
Match: Klp64D (gene:FBgn0004380 transcript:FBtr0077157)

HSP 1 Score: 111.309 bits (277), Expect = 7.945e-25
Identity = 93/343 (27.11%), Postives = 154/343 (44.90%), Query Frame = 1
Query: 1696 MQEQMGNIRVYCRCRHVTD---GGNILEFIGSESITLQIA----------PNERFEFDKVFHPGMSQIELY-EEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETNIQLYVDNGMETA--YQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSF-----LCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGV 2661
            + +++ N+RV  R R +         L  I  + I   I           P + + FD VF  G +Q++LY +  RP+V   ++GYN   + YG   +GKT+T+ G  +     G++  A   I       + + ++ +    +EIYN+   D+L  +    L V    +     + L    + N  D E +M++    R V  T +N  SSRSH I  I ++ +S++ GE          L L DLAG E   +++TQ +    KEA  IN SL+    V  +L       + YR +KLT LL+  L  + K  +  T+     +   T +TLR+    + +
Sbjct:   14 LDDEIENVRVVVRTRPMDKNELSAGALSAISVDKINRAITVMKPNATANEPPKTYYFDNVFDGGSNQMDLYVDTARPIVDKVLEGYNGTILAYGQTGTGKTYTMSGNPDSPQTKGIIPNAFAHIFGHIAKAKENQKFLVRVSYMEIYNEEVRDLLGKDVGKSLEVKERPDIGVFVKDLSGYVVHNADDLENIMRLGNKNRAVGATKMNQESSRSHAIFSITVE-RSEL-GEGDVQHVRMGKLQLVDLAGSER--QSKTQASGQRLKEATKINLSLSVLGNVISALVDGKSTHIPYRNSKLTRLLQDSLGGNSKTVMCATISPADSNYMETISTLRYASRAKNI 352          
BLAST of Kinesin motor domain protein vs. Ensembl Zebrafish
Match: kifc1 (kinesin family member C1 [Source:ZFIN;Acc:ZDB-GENE-000208-21])

HSP 1 Score: 163.31 bits (412), Expect = 1.115e-41
Identity = 121/366 (33.06%), Postives = 179/366 (48.91%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVTDGGNILEFIGSESITLQIAPNER------------------------FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEER-LRQRDCEYKITACVVEIYNDNCIDVL-SGETN------IQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKA 2676
            RR  +N +QE  GNIRV+CR R +  G        S+ + +Q+ P++                         F FD+VF P  SQ E++EE   LV S +DGYNVC   YG   SGKTFT+ GG E     G++ RA+  I    + L ++  +Y  TA  VEIYN+   D+L  G+ N      I+   +N  E     L    + NE +   L+ +    R  ART +N  SSRSH +  + ++G++        S LCL DLAG E + K+++Q  +   KE   IN SLT    V  +L  +D + V YR +KLT+LL+  L  + K  +   +  ++ S   + N+LRF  +     +G A
Sbjct:  260 RRKLHNTIQELKGNIRVFCRVRPLLTGNQ------SDILHIQLPPHDNKALTLAKMEESHTGRTTDTQKSYNFSFDRVFGPRSSQSEVFEEISLLVQSALDGYNVCCFAYGQTGSGKTFTMEGG-EQEELWGVIPRAVQQIFKSAKALSEQGWQYSFTASFVEIYNETLRDLLYKGKPNKRPEHEIRKVSNN--EITVTNLTYQKVNNEDEVHNLIMLANQNRSTARTCMNDHSSRSHSVFQLDIEGENTARDSKCKSMLCLVDLAGSERVQKSQSQGERF--KEMTAINSSLTNLGIVIAALANKD-SFVPYRNSKLTYLLQNCLGGNSKTLMFANISPEEESFSESLNSLRFASKVNDCVIGTA 613          
BLAST of Kinesin motor domain protein vs. Ensembl Zebrafish
Match: kifc1 (kinesin family member C1 [Source:ZFIN;Acc:ZDB-GENE-000208-21])

HSP 1 Score: 163.31 bits (412), Expect = 1.115e-41
Identity = 121/366 (33.06%), Postives = 179/366 (48.91%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVTDGGNILEFIGSESITLQIAPNER------------------------FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEER-LRQRDCEYKITACVVEIYNDNCIDVL-SGETN------IQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKA 2676
            RR  +N +QE  GNIRV+CR R +  G        S+ + +Q+ P++                         F FD+VF P  SQ E++EE   LV S +DGYNVC   YG   SGKTFT+ GG E     G++ RA+  I    + L ++  +Y  TA  VEIYN+   D+L  G+ N      I+   +N  E     L    + NE +   L+ +    R  ART +N  SSRSH +  + ++G++        S LCL DLAG E + K+++Q  +   KE   IN SLT    V  +L  +D + V YR +KLT+LL+  L  + K  +   +  ++ S   + N+LRF  +     +G A
Sbjct:  260 RRKLHNTIQELKGNIRVFCRVRPLLTGNQ------SDILHIQLPPHDNKALTLAKMEESHTGRTTDTQKSYNFSFDRVFGPRSSQSEVFEEISLLVQSALDGYNVCCFAYGQTGSGKTFTMEGG-EQEELWGVIPRAVQQIFKSAKALSEQGWQYSFTASFVEIYNETLRDLLYKGKPNKRPEHEIRKVSNN--EITVTNLTYQKVNNEDEVHNLIMLANQNRSTARTCMNDHSSRSHSVFQLDIEGENTARDSKCKSMLCLVDLAGSERVQKSQSQGERF--KEMTAINSSLTNLGIVIAALANKD-SFVPYRNSKLTYLLQNCLGGNSKTLMFANISPEEESFSESLNSLRFASKVNDCVIGTA 613          
BLAST of Kinesin motor domain protein vs. Ensembl Zebrafish
Match: si:ch211-257p13.3 (si:ch211-257p13.3 [Source:ZFIN;Acc:ZDB-GENE-110914-108])

HSP 1 Score: 161.77 bits (408), Expect = 1.622e-40
Identity = 116/360 (32.22%), Postives = 177/360 (49.17%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHV---------------TDGGNILEFIGSESITLQIAPNERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLS--GET-NIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVNLNG 2700
            RR  +  + E  GNIRV CR + V               TD  N      S  I L     + FE DKVFHP  +Q E+++E  PL+ S IDGY+VC   YG   SGKT+T+ G  E     G+ QRAL  +  E   R+    Y ++   VEIYN+   D+LS  GE  +I++  D   +     L+ + + N    + ++ + +  R    T +N  SSRSH +  + + G     G      L L DLAG E + K+  +  ++  KEA  INRSL A   V  +L+    + + +R ++LT+LL+  L    K A+++ V + + ++G T  +L+F +    V LG A R++   G
Sbjct:  444 RRKYHEQLVELKGNIRVLCRVKPVLKEDQHEEGQAVVVTTDPNN-----ESALIVLSKGKVKNFELDKVFHPQATQEEVFQEIEPLITSCIDGYHVCIFAYGQTGSGKTYTMEGTVENP---GINQRALKHLFNEIEERKDMWTYTVSVSSVEIYNEVLRDLLSKDGEKLDIKINPDGTGQLHVPGLRVLEVKNFQHIKKILAIARKNRITFGTQMNQHSSRSHALLTVTVLGTDLASGAKTTGKLNLVDLAGSERVWKSGAEGERL--KEAQNINRSLLALGDVIQALKAHQTH-IPFRNSRLTYLLQDSLGKGNKTAMVVQVSSLESNVGETLCSLKFAQRVCKVELGPAARKIETGG 792          
BLAST of Kinesin motor domain protein vs. Ensembl Zebrafish
Match: si:ch211-257p13.3 (si:ch211-257p13.3 [Source:ZFIN;Acc:ZDB-GENE-110914-108])

HSP 1 Score: 162.155 bits (409), Expect = 2.263e-40
Identity = 116/360 (32.22%), Postives = 177/360 (49.17%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHV---------------TDGGNILEFIGSESITLQIAPNERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLS--GET-NIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVNLNG 2700
            RR  +  + E  GNIRV CR + V               TD  N      S  I L     + FE DKVFHP  +Q E+++E  PL+ S IDGY+VC   YG   SGKT+T+ G  E     G+ QRAL  +  E   R+    Y ++   VEIYN+   D+LS  GE  +I++  D   +     L+ + + N    + ++ + +  R    T +N  SSRSH +  + + G     G      L L DLAG E + K+  +  ++  KEA  INRSL A   V  +L+    + + +R ++LT+LL+  L    K A+++ V + + ++G T  +L+F +    V LG A R++   G
Sbjct:  576 RRKYHEQLVELKGNIRVLCRVKPVLKEDQHEEGQAVVVTTDPNN-----ESALIVLSKGKVKNFELDKVFHPQATQEEVFQEIEPLITSCIDGYHVCIFAYGQTGSGKTYTMEGTVENP---GINQRALKHLFNEIEERKDMWTYTVSVSSVEIYNEVLRDLLSKDGEKLDIKINPDGTGQLHVPGLRVLEVKNFQHIKKILAIARKNRITFGTQMNQHSSRSHALLTVTVLGTDLASGAKTTGKLNLVDLAGSERVWKSGAEGERL--KEAQNINRSLLALGDVIQALKAHQTH-IPFRNSRLTYLLQDSLGKGNKTAMVVQVSSLESNVGETLCSLKFAQRVCKVELGPAARKIETGG 924          
BLAST of Kinesin motor domain protein vs. Ensembl Zebrafish
Match: kifc3 (kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE-030131-3724])

HSP 1 Score: 158.688 bits (400), Expect = 9.006e-40
Identity = 114/356 (32.02%), Postives = 181/356 (50.84%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHV-------TDGGNILEFIGSESITLQIAPNER---FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETN----IQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLG----KARRQV 2688
            R+  +N +    GNIRV CR R V        D  N++ F   +   L ++   +   FE DKVF    +Q E+++E + LV S IDG+NVC   YG   SGKT+T+ G  E     G+ QRAL  + +E   ++ D +YKIT  +VEIYN+   ++L    N    I++  D   +     L    + +  D   +  +  + R  A T LN  SSRSH + +I + G +   G      L L DLAG E I K+  + +++  +EA  IN+SL+A   V  SLR +  + V +R ++LT+LL+  L+   K  +++ V   + ++  +  +L+F +  R V +G     +RRQ 
Sbjct:  311 RKKCHNELVRLKGNIRVLCRVRPVCAGEADAADTKNLVTFDPEDDAVLYLSNKGKLMTFELDKVFTTQATQEEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEGIPEDP---GINQRALRLLFSEVSEKKPDWDYKITVSMVEIYNETLRNLLGDNPNEKLDIKMCPDGSGQLYVPGLSEFTVESVEDINKVFDLGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRL--REAQCINKSLSALGDVINSLRSKHSH-VPFRNSRLTYLLQDSLSGDSKTLMMVQVSPLESNISESVCSLKFAQRVRTVEIGPSSSSSRRQA 660          
BLAST of Kinesin motor domain protein vs. Ensembl Xenopus
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:548839])

HSP 1 Score: 172.94 bits (437), Expect = 1.439e-45
Identity = 117/354 (33.05%), Postives = 188/354 (53.11%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVT--DG-----GNILEFIGSESITLQIAPNER---FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETN----IQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSF--LCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQV 2688
            R+  +N +    GNIRV  R R +T  DG      N++ F   +   L +A   +   FE DKVF P  +Q E++ E  PL+ S +DGY+VC + YG   SGKT+++ G     S  G+ QRAL  +L+E + R    E++++  +VEIYN+   D+L  + +    I++   +  E     L    + +  D   ++++   +R    T LN  SSRSH + ++  +G+    G  ICS   L L DLAG E + ++     ++  +EA  INRSL+A   VF +LR Q  + + YR +KLT+LL+  L+  GK  L++ V   ++++  +  +LRFG   R V LG   R++
Sbjct:  137 RKECHNQLVRLRGNIRVLTRVRPITTEDGVGPGAENVVNFDPDDDGVLYVAQKGKEMSFELDKVFKPSATQEEVFREVSPLITSCLDGYSVCILAYGQTGSGKTYSMEG---IPSDPGINQRALHLLLSEVKERSNSWEHELSVSMVEIYNETLRDLLGSDPSNSLEIKILPGSVGELYVPNLTQRQVQSMEDINKILELGHKQRATEHTNLNTHSSRSHALLILTAKGRETSTG--ICSTGKLYLVDLAGSERVSRSGAAGERL--REAQCINRSLSALGDVFSALRSQQGH-IPYRNSKLTYLLQEPLSRDGKALLLLQVSPAEKNINESLCSLRFGDRVRAVELGAPTRKI 482          
BLAST of Kinesin motor domain protein vs. Ensembl Xenopus
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:548839])

HSP 1 Score: 172.555 bits (436), Expect = 1.201e-43
Identity = 122/362 (33.70%), Postives = 190/362 (52.49%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVT--DG-----GNILEFIGSESITLQIAPNER---FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVL------SGETNI------QLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSF--LCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQV 2688
            R+  +N +    GNIRV  R R +T  DG      N++ F   +   L +A   +   FE DKVF P  +Q E++ E  PL+ S +DGY+VC + YG   SGKT+++ G     S  G+ QRAL  +L+E + R    E++++  +VEIYN+   D+L      S E  I      +LYV N  +   Q ++        D   ++++   +R    T LN  SSRSH + ++  +G+    G  ICS   L L DLAG E + ++     ++  +EA  INRSL+A   VF +LR Q  + + YR +KLT+LL+  L+  GK  L++ V   ++++  +  +LRFG   R V LG   R++
Sbjct:  472 RKECHNQLVRLRGNIRVLTRVRPITTEDGVGPGAENVVNFDPDDDGVLYVAQKGKEMSFELDKVFKPSATQEEVFREVSPLITSCLDGYSVCILAYGQTGSGKTYSMEG---IPSDPGINQRALHLLLSEVKERSNSWEHELSVSMVEIYNETLRDLLGSDPSNSLEIKILPGSVGELYVPNLTQRQVQSME--------DINKILELGHKQRATEHTNLNTHSSRSHALLILTAKGRETSTG--ICSTGKLYLVDLAGSERVSRSGAAGERL--REAQCINRSLSALGDVFSALRSQQGH-IPYRNSKLTYLLQEPLSRDGKALLLLQVSPAEKNINESLCSLRFGDRVRAVELGAPTRKI 817          
BLAST of Kinesin motor domain protein vs. Ensembl Xenopus
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:548839])

HSP 1 Score: 172.17 bits (435), Expect = 1.589e-43
Identity = 117/354 (33.05%), Postives = 188/354 (53.11%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVT--DG-----GNILEFIGSESITLQIAPNER---FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETN----IQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSF--LCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQV 2688
            R+  +N +    GNIRV  R R +T  DG      N++ F   +   L +A   +   FE DKVF P  +Q E++ E  PL+ S +DGY+VC + YG   SGKT+++ G     S  G+ QRAL  +L+E + R    E++++  +VEIYN+   D+L  + +    I++   +  E     L    + +  D   ++++   +R    T LN  SSRSH + ++  +G+    G  ICS   L L DLAG E + ++     ++  +EA  INRSL+A   VF +LR Q  + + YR +KLT+LL+  L+  GK  L++ V   ++++  +  +LRFG   R V LG   R++
Sbjct:  465 RKECHNQLVRLRGNIRVLTRVRPITTEDGVGPGAENVVNFDPDDDGVLYVAQKGKEMSFELDKVFKPSATQEEVFREVSPLITSCLDGYSVCILAYGQTGSGKTYSMEG---IPSDPGINQRALHLLLSEVKERSNSWEHELSVSMVEIYNETLRDLLGSDPSNSLEIKILPGSVGELYVPNLTQRQVQSMEDINKILELGHKQRATEHTNLNTHSSRSHALLILTAKGRETSTG--ICSTGKLYLVDLAGSERVSRSGAAGERL--REAQCINRSLSALGDVFSALRSQQGH-IPYRNSKLTYLLQEPLSRDGKALLLLQVSPAEKNINESLCSLRFGDRVRAVELGAPTRKI 810          
BLAST of Kinesin motor domain protein vs. Ensembl Xenopus
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:548839])

HSP 1 Score: 172.17 bits (435), Expect = 2.017e-43
Identity = 117/354 (33.05%), Postives = 188/354 (53.11%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVT--DG-----GNILEFIGSESITLQIAPNER---FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETN----IQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSF--LCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQV 2688
            R+  +N +    GNIRV  R R +T  DG      N++ F   +   L +A   +   FE DKVF P  +Q E++ E  PL+ S +DGY+VC + YG   SGKT+++ G     S  G+ QRAL  +L+E + R    E++++  +VEIYN+   D+L  + +    I++   +  E     L    + +  D   ++++   +R    T LN  SSRSH + ++  +G+    G  ICS   L L DLAG E + ++     ++  +EA  INRSL+A   VF +LR Q  + + YR +KLT+LL+  L+  GK  L++ V   ++++  +  +LRFG   R V LG   R++
Sbjct:  539 RKECHNQLVRLRGNIRVLTRVRPITTEDGVGPGAENVVNFDPDDDGVLYVAQKGKEMSFELDKVFKPSATQEEVFREVSPLITSCLDGYSVCILAYGQTGSGKTYSMEG---IPSDPGINQRALHLLLSEVKERSNSWEHELSVSMVEIYNETLRDLLGSDPSNSLEIKILPGSVGELYVPNLTQRQVQSMEDINKILELGHKQRATEHTNLNTHSSRSHALLILTAKGRETSTG--ICSTGKLYLVDLAGSERVSRSGAAGERL--REAQCINRSLSALGDVFSALRSQQGH-IPYRNSKLTYLLQEPLSRDGKALLLLQVSPAEKNINESLCSLRFGDRVRAVELGAPTRKI 884          
BLAST of Kinesin motor domain protein vs. Ensembl Xenopus
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:548839])

HSP 1 Score: 172.17 bits (435), Expect = 2.521e-43
Identity = 117/354 (33.05%), Postives = 188/354 (53.11%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVT--DG-----GNILEFIGSESITLQIAPNER---FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETN----IQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSF--LCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQV 2688
            R+  +N +    GNIRV  R R +T  DG      N++ F   +   L +A   +   FE DKVF P  +Q E++ E  PL+ S +DGY+VC + YG   SGKT+++ G     S  G+ QRAL  +L+E + R    E++++  +VEIYN+   D+L  + +    I++   +  E     L    + +  D   ++++   +R    T LN  SSRSH + ++  +G+    G  ICS   L L DLAG E + ++     ++  +EA  INRSL+A   VF +LR Q  + + YR +KLT+LL+  L+  GK  L++ V   ++++  +  +LRFG   R V LG   R++
Sbjct:  636 RKECHNQLVRLRGNIRVLTRVRPITTEDGVGPGAENVVNFDPDDDGVLYVAQKGKEMSFELDKVFKPSATQEEVFREVSPLITSCLDGYSVCILAYGQTGSGKTYSMEG---IPSDPGINQRALHLLLSEVKERSNSWEHELSVSMVEIYNETLRDLLGSDPSNSLEIKILPGSVGELYVPNLTQRQVQSMEDINKILELGHKQRATEHTNLNTHSSRSHALLILTAKGRETSTG--ICSTGKLYLVDLAGSERVSRSGAAGERL--REAQCINRSLSALGDVFSALRSQQGH-IPYRNSKLTYLLQEPLSRDGKALLLLQVSPAEKNINESLCSLRFGDRVRAVELGAPTRKI 981          
BLAST of Kinesin motor domain protein vs. Ensembl Mouse
Match: Kifc1 (kinesin family member C1 [Source:MGI Symbol;Acc:MGI:109596])

HSP 1 Score: 162.155 bits (409), Expect = 2.751e-41
Identity = 117/363 (32.23%), Postives = 176/363 (48.48%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVTDG------GNILEFIGS-------------------ESITLQIAPNER--FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQ-HGLMQRALTTILT-EERLRQRDCEYKITACVVEIYNDNCIDVLS--------GETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIK----AETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRF 2640
            RR  +N +QE  GNIRV+CR R V +G      G ++   G                     ++T   AP  R  F FD+VF PG  Q E++EE   LV S +DGY VC   YG   SGKTFT+ GG  G  Q  GL+ RA+  + +  + +  +   Y   A  VEIYN+   D+L+        GE  I+       E      + VP++ E + EAL+ +    R VA TA N  SSRSH +  +++ G+    G    + L L DLAG E +         + +++  +E   IN SL+    V ++L  ++ + V YR +KLT+LL+  L  S K  + + +   + ++  + N+LRF
Sbjct:  235 RRRLHNQLQELKGNIRVFCRVRPVLEGESTPSPGFLVFPPGPAGPSDPPTGLSLSRSDDRRSTLTGAPAPTVRHDFSFDRVFPPGSKQEEVFEEIAMLVQSALDGYPVCIFAYGQTGSGKTFTMEGGPRGDPQLEGLIPRAMRHLFSVAQEMSGQGWTYSFVASYVEIYNETVRDLLATGPRKGQGGECEIRRASPGSEELTVTNARYVPVSCEKEVEALLHLAHQNRAVAHTAQNKRSSRSHSVFQLQISGEHAARGLQCGAPLNLVDLAGSERLDPGLHLGPGERDRL--RETQAINSSLSTLGLVIMALSNKE-SHVPYRNSKLTYLLQNSLGGSAKMLMFVNISPLEENVSESLNSLRF 594          
BLAST of Kinesin motor domain protein vs. Ensembl Mouse
Match: Kifc1 (kinesin family member C1 [Source:MGI Symbol;Acc:MGI:109596])

HSP 1 Score: 162.155 bits (409), Expect = 5.307e-41
Identity = 117/363 (32.23%), Postives = 176/363 (48.48%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVTDG------GNILEFIGS-------------------ESITLQIAPNER--FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQ-HGLMQRALTTILT-EERLRQRDCEYKITACVVEIYNDNCIDVLS--------GETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIK----AETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRF 2640
            RR  +N +QE  GNIRV+CR R V +G      G ++   G                     ++T   AP  R  F FD+VF PG  Q E++EE   LV S +DGY VC   YG   SGKTFT+ GG  G  Q  GL+ RA+  + +  + +  +   Y   A  VEIYN+   D+L+        GE  I+       E      + VP++ E + EAL+ +    R VA TA N  SSRSH +  +++ G+    G    + L L DLAG E +         + +++  +E   IN SL+    V ++L  ++ + V YR +KLT+LL+  L  S K  + + +   + ++  + N+LRF
Sbjct:  298 RRRLHNQLQELKGNIRVFCRVRPVLEGESTPSPGFLVFPPGPAGPSDPPTGLSLSRSDDRRSTLTGAPAPTVRHDFSFDRVFPPGSKQEEVFEEIAMLVQSALDGYPVCIFAYGQTGSGKTFTMEGGPRGDPQLEGLIPRAMRHLFSVAQEMSGQGWTYSFVASYVEIYNETVRDLLATGPRKGQGGECEIRRASPGSEELTVTNARYVPVSCEKEVEALLHLAHQNRAVAHTAQNKRSSRSHSVFQLQISGEHAARGLQCGAPLNLVDLAGSERLDPGLHLGPGERDRL--RETQAINSSLSTLGLVIMALSNKE-SHVPYRNSKLTYLLQNSLGGSAKMLMFVNISPLEENVSESLNSLRF 657          
BLAST of Kinesin motor domain protein vs. Ensembl Mouse
Match: Kifc3 (kinesin family member C3 [Source:MGI Symbol;Acc:MGI:109202])

HSP 1 Score: 161.384 bits (407), Expect = 1.160e-40
Identity = 118/364 (32.42%), Postives = 180/364 (49.45%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVT--DG-----GNILEFIGSESITLQIAPNER---FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETNIQLYV---DNGMETAYQKLKSVPITNEADAEALMQVCKV------KRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVNLNGQVS 2709
            R+  +N +    GNIRV  R R VT  DG      N + F   +   + +    +   FE DKVF P  SQ ++++E + L+ S IDG+NVC   YG   +GKT+T+ G  E     G+ QRAL  + +E + +  D +Y IT    EIYN+   D+L  E   +L +    +G    Y     VP   E   +++  + KV       R    T LN  SSRSH + ++ ++G     G      L L DLAG E + K+  + N++  +EA +INRSL+A   V  +LR +  + V +R +KLT+LL+  L+   K  +++ V   +++   T  +LRF    R V LG   R+  L    S
Sbjct:  293 RKKCHNELVRLKGNIRVIARVRPVTKEDGEGPEATNAVTFDPDDDSIIHLLHKGKPVSFELDKVFSPWASQQDVFQEVQALITSCIDGFNVCIFAYGQTGAGKTYTMEGTPENP---GINQRALQLLFSEVQEKASDWQYNITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLY-----VPGLTEFQVQSVDDINKVFEFGYNNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGNRL--REAQHINRSLSALGDVIAALRSRQGH-VPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLRFAERVRSVELGPGSRRTELGSWSS 645          
BLAST of Kinesin motor domain protein vs. Ensembl Mouse
Match: Kifc3 (kinesin family member C3 [Source:MGI Symbol;Acc:MGI:109202])

HSP 1 Score: 161.384 bits (407), Expect = 1.277e-40
Identity = 118/364 (32.42%), Postives = 180/364 (49.45%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVT--DG-----GNILEFIGSESITLQIAPNER---FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETNIQLYV---DNGMETAYQKLKSVPITNEADAEALMQVCKV------KRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVNLNGQVS 2709
            R+  +N +    GNIRV  R R VT  DG      N + F   +   + +    +   FE DKVF P  SQ ++++E + L+ S IDG+NVC   YG   +GKT+T+ G  E     G+ QRAL  + +E + +  D +Y IT    EIYN+   D+L  E   +L +    +G    Y     VP   E   +++  + KV       R    T LN  SSRSH + ++ ++G     G      L L DLAG E + K+  + N++  +EA +INRSL+A   V  +LR +  + V +R +KLT+LL+  L+   K  +++ V   +++   T  +LRF    R V LG   R+  L    S
Sbjct:  315 RKKCHNELVRLKGNIRVIARVRPVTKEDGEGPEATNAVTFDPDDDSIIHLLHKGKPVSFELDKVFSPWASQQDVFQEVQALITSCIDGFNVCIFAYGQTGAGKTYTMEGTPENP---GINQRALQLLFSEVQEKASDWQYNITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLY-----VPGLTEFQVQSVDDINKVFEFGYNNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGNRL--REAQHINRSLSALGDVIAALRSRQGH-VPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLRFAERVRSVELGPGSRRTELGSWSS 667          
BLAST of Kinesin motor domain protein vs. Ensembl Mouse
Match: Kifc5b (kinesin family member C5B [Source:MGI Symbol;Acc:MGI:2137414])

HSP 1 Score: 160.999 bits (406), Expect = 1.365e-40
Identity = 117/363 (32.23%), Postives = 176/363 (48.48%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVTDG------GNILEFIGS-------------------ESITLQIAPNER--FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQ-HGLMQRALTTILT-EERLRQRDCEYKITACVVEIYNDNCIDVLS--------GETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIK----AETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRF 2640
            RR  +N +QE  GNIRV+CR R V +G      G ++   G                     ++T   AP  R  F FD+VF PG  Q E++EE   LV S +DGY VC   YG   SGKTFT+ GG  G  Q  GL+ RA+  + +  + +  +   Y   A  VEIYN+   D+L+        GE  I+       E      + VP++ E + EAL+ +    R VA TA N  SSRSH +  +++ G+    G    + L L DLAG E +         + +++  +E   IN SL+    V ++L  ++ + V YR +KLT+LL+  L  S K  + + +   + ++  + N+LRF
Sbjct:  296 RRRLHNQLQELKGNIRVFCRVRPVLEGESTPSPGFLVFPPGPAGPSDRPTGLSLSRSDDRRSTLTGAPAPTVRHDFSFDRVFPPGSKQEEVFEEIAMLVQSALDGYPVCIFAYGQTGSGKTFTMEGGPRGDPQLAGLIPRAMRHLFSVAQEMSGQGWTYSFVASYVEIYNETVRDLLATGPRKGQGGECEIRRASPGSEELTVTNARYVPVSCEKEVEALLHLAHQNRAVAHTAQNKRSSRSHSVFQLQISGEHAARGLQCGAPLNLVDLAGSERLDPGLPLGPGERDRL--RETQAINSSLSTLGLVIMALSNKE-SHVPYRNSKLTYLLQNSLGGSAKMLMFVNISPLEENVSESLNSLRF 655          
BLAST of Kinesin motor domain protein vs. UniProt/SwissProt
Match: sp|O81635|KN14G_ARATH (Kinesin-like protein KIN-14G OS=Arabidopsis thaliana OX=3702 GN=KIN14G PE=1 SV=2)

HSP 1 Score: 196.823 bits (499), Expect = 1.390e-50
Identity = 127/351 (36.18%), Postives = 190/351 (54.13%), Query Frame = 1
Query: 1678 RHAYNLMQEQMGNIRVYCRCR-----HVTDGGNILEFIGSESITLQI------APNERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQH-GLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLS--GETN---IQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKAR 2679
            R  YNL+Q+  GNIRVYCR R       + G + +E I   +IT+++      A  + F F+KVF P  +Q E++ + +PLV S +DGYNVC   YG   SGKTFT+ G  E + +  G+  RAL  +      R+    Y+I+  ++EIYN+   D+L+  G+T    I+    NG+      L  VP+++  D   LM +  + R V+ TA+N  SSRSH    + +QG+    G  +   + L DLAG E + K+E   +++  KEA +IN+SL+A   V  SL  Q  + V YR +KLT LL+  L  S K  + + +  +  +LG T +TL+F      V LG AR
Sbjct:  382 RKLYNLVQDLKGNIRVYCRVRPFLPGQESGGLSAVEDIDEGTITIRVPSKYGKAGQKPFMFNKVFGPSATQEEVFSDMQPLVRSVLDGYNVCIFAYGQTGSGKTFTMTGPKELTEESLGVNYRALADLFLLSNQRKDTTSYEISVQMLEIYNEQVRDLLAQDGQTKRLEIRNNSHNGINVPEASL--VPVSSTDDVIQLMDLGHMNRAVSSTAMNDRSSRSHSCVTVHVQGRDLTSGSILHGSMHLVDLAGSERVDKSEVTGDRL--KEAQHINKSLSALGDVISSL-SQKTSHVPYRNSKLTQLLQDSLGGSAKTLMFVHISPEPDTLGETISTLKFAERVGSVELGAAR 727          
BLAST of Kinesin motor domain protein vs. UniProt/SwissProt
Match: sp|F4HZF0|KN14H_ARATH (Kinesin-like protein KIN-14H OS=Arabidopsis thaliana OX=3702 GN=KIN14H PE=3 SV=2)

HSP 1 Score: 191.43 bits (485), Expect = 9.968e-49
Identity = 126/346 (36.42%), Postives = 187/346 (54.05%), Query Frame = 1
Query: 1678 RHAYNLMQEQMGNIRVYCRCRHVTDG-GNILEFIGS-ESITLQIAPNER--------FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQH-GLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETN-IQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKAR 2679
            R  YN +Q+  G+IRVYCR R    G  ++L  +   E  TL IA   +        F F+KVF P  SQ  ++ + +PL+ S +DGYNVC   YG   SGKTFT++G NE + +  G+  RAL+ +     +R+    Y I+  ++EIYN+   D+L+  TN I+    +G+      L  VP++  +D   LM + +  R V+ TA+N  SSRSH    + +QGK    G  +   + L DLAG E I K+E   +++  KEA +IN+SL+A   V  SL +++ N + YR +KLT LL+  L    K  + I +  +   LG T +TL+F      V LG AR
Sbjct:  422 RKLYNQVQDLKGSIRVYCRVRPFLPGQKSVLTTVDHLEDSTLSIATPSKYGKEGQKTFTFNKVFGPSASQEAVFADTQPLIRSVLDGYNVCIFAYGQTGSGKTFTMMGPNELTDETLGVNYRALSDLFHLSSVRKETFSYNISVQMLEIYNEQVRDLLA--TNEIRNSTQDGINVPEATL--VPVSTTSDVIHLMNIGQKNRAVSATAMNDRSSRSHSCLTVHVQGKDLTSGVTLRGSMHLVDLAGSERIDKSEVTGDRL--KEAQHINKSLSALGDVIASLSQKN-NHIPYRNSKLTQLLQDALGGQAKTLMFIHISPELEDLGETLSTLKFAERVATVDLGAAR 760          
BLAST of Kinesin motor domain protein vs. UniProt/SwissProt
Match: sp|F4IAR2|KN14O_ARATH (Kinesin-like protein KIN-14O OS=Arabidopsis thaliana OX=3702 GN=KIN14O PE=3 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 1.109e-48
Identity = 119/343 (34.69%), Postives = 181/343 (52.77%), Query Frame = 1
Query: 1687 YNLMQEQMGNIRVYCRCRHVTDG----GNILEFIGSESITLQIAPNE-------RFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQH-GLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKAR 2679
            +N +QE  GNIRVYCR R    G      ++E IG     + + P +       +F F+KV+ P  +Q E++ + +PL+ S +DGYNVC   YG   SGKT+T+ G +  S +  G+  RAL  +    + R+ +  Y++   +VEIYN+   D+LSG   +     NG+  A       P+T+ +D   LM +    R V+ TALN  SSRSH I  + ++GK    G  +   L L DLAG E + ++E   +++  KEA +IN+SL+A   V  SL  +  + V YR +KLT LL+  L    K  + + +  D  S   + +TL+F     GV LG A+
Sbjct:  623 FNELQELKGNIRVYCRVRPFLRGQGASKTVVEHIGDHGELVVLNPTKPGKDAHRKFRFNKVYSPASTQAEVFSDIKPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPDGASEEEWGVNYRALNDLFRISQSRKSNIAYEVGVQMVEIYNEQVRDLLSG--ILSTTQQNGL--AVPDASMYPVTSTSDVLELMSIGLQNRVVSSTALNERSSRSHSIVTVHVRGKDLKTGSALYGNLHLVDLAGSERVDRSEVTGDRL--KEAQHINKSLSALGDVIFSLASKSSH-VPYRNSKLTQLLQSSLGGRAKTLMFVQLNPDITSYSESMSTLKFAERVSGVELGAAK 958          
BLAST of Kinesin motor domain protein vs. UniProt/SwissProt
Match: sp|Q0WN69|KN14P_ARATH (Kinesin-like protein KIN-14P OS=Arabidopsis thaliana OX=3702 GN=KIN14P PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 4.840e-48
Identity = 119/354 (33.62%), Postives = 187/354 (52.82%), Query Frame = 1
Query: 1678 RHAYNLMQEQMGNIRVYCRCRHVTDG----GNILEFIGSES---ITLQIAPNE----RFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQH--GLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETN-------IQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKAR 2679
            R  +N +QE  GNIRV+CR R           ++E++G +    +T    P +    +F+F+KV+ P  SQ +++ + RPLV S +DGYNVC   YG   SGKT+T+ G + GSS+   G+  RAL  +    + R+ +  Y++   +VEIYN+  +D+LS + +       +     NG+  A       P+T+ +D   LM +    R V  TALN  SSRSH I  + ++GK    G  +   L L DLAG E + ++E   +++  +EA +IN+SL++   V  SL  +  + V YR +KLT LL+  L    K  + + +  D  S   + +TL+F     GV LG A+
Sbjct:  497 RKLFNELQELKGNIRVFCRVRPFLPAQGAANTVVEYVGEDGELVVTNPTRPGKDGLRQFKFNKVYSPTASQADVFSDIRPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPD-GSSEEDWGVNYRALNDLFKISQSRKGNISYEVGVQMVEIYNEQVLDLLSDDNSQKKTLGILSTTQQNGL--AVPDASMYPVTSTSDVITLMDIGLQNRAVGSTALNERSSRSHSIVTVHVRGKDLKTGSVLYGNLHLVDLAGSERVDRSEVTGDRL--REAQHINKSLSSLGDVIFSLASKSSH-VPYRNSKLTQLLQTSLGGRAKTLMFVQLNPDATSYSESMSTLKFAERVSGVELGAAK 844          
BLAST of Kinesin motor domain protein vs. UniProt/SwissProt
Match: sp|F4IJK6|KN14R_ARATH (Kinesin-like protein KIN-14R OS=Arabidopsis thaliana OX=3702 GN=KIN14R PE=3 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 1.842e-46
Identity = 118/357 (33.05%), Postives = 190/357 (53.22%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHV------TDGGNILEFIGSESITLQIA----PNERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQH-GLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLS-GETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKV------KRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVN 2691
            R+  YN +QE  GNIRV+CRCR +      T    I++F G++   L +       + F+FD+V+ P   Q++++ +  P+V+S +DGYNVC   YG   +GKTFT+    EG+ Q+ G+  R +  +    R R+    Y I+  V+E+YN+   D+L+    + +L +    + ++     VP   EA+ E + +V  V       R V    +N  SSRSH +  I ++ K+ ++G+   S L L DLAG E + K + Q  ++  KEA  INRSL+A   V  +L  +  + + YR +KLTHLL+  L    K  + + +   +  +  T ++L F    RGV LG AR+QV+
Sbjct:  404 RKELYNHIQETKGNIRVFCRCRPLNTEETSTKSATIVDFDGAKDGELGVITGNNSKKSFKFDRVYTPKDGQVDVFADASPMVVSVLDGYNVCIFAYGQTGTGKTFTM----EGTPQNRGVNYRTVEQLFEVARERRETISYNISVSVLEVYNEQIRDLLATSPGSKKLEIKQSSDGSHH----VPGLVEANVENINEVWNVLQAGSNARSVGSNNVNEHSSRSHCMLSIMVKAKNLMNGDCTKSKLWLVDLAGSERLAKTDVQGERL--KEAQNINRSLSALGDVIYALATKSSH-IPYRNSKLTHLLQDSLGGDSKTLMFVQISPSEHDVSETLSSLNFATRVRGVELGPARKQVD 749          
BLAST of Kinesin motor domain protein vs. TrEMBL
Match: A0A183T9I3 (Kinesin motor domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS13131 PE=3 SV=1)

HSP 1 Score: 408.683 bits (1049), Expect = 9.058e-125
Identity = 191/342 (55.85%), Postives = 260/342 (76.02%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVTDGGNILEFIGSESITLQIAPN-ERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEG-SSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVNL 2694
            R   +N+MQE +GNIRVYCRCR +   GN +E   S++I L    + E + FD+VF    +Q+E++ E  PL+ SF+DG+NVCF+ YGGEASGKT+TL+GG++G     G++QRAL  +L E  ++Q + +  +T  VVE+YND  ID+LSGET + + VD G++   + L++VPI +  D E+L+++CK +R+V +TALNPASSRSHLI L RLQ +S++H + I S L LCDLAGFEDIIKA+T +++ L+KEAG+INRSLTAFNRVF SLR QDP  VSYR++KLT+LLKPF TNSGKC LI+TVR D+ +L STQ TLRFGR++R VSLG+ARRQ+++
Sbjct:  532 RMSIFNMMQEYLGNIRVYCRCRAIPQAGNCVEVTSSDTIHLINGTSIEDYRFDRVFDITATQVEVFNELMPLIHSFMDGFNVCFLAYGGEASGKTYTLLGGSDGLPESRGIVQRALNCVLAESVVKQSEWDIGLTVAVVEVYNDVFIDLLSGETGVHVRVDLGVDKMMEGLRTVPIQSGGDIESLLEMCKSRRRVGKTALNPASSRSHLIMLARLQARSRLHEKRISSVLALCDLAGFEDIIKADTLSDQTLAKEAGFINRSLTAFNRVFSSLRTQDPMAVSYRDSKLTYLLKPFFTNSGKCILIVTVRTDRANLPSTQGTLRFGRDSRAVSLGRARRQISV 873          

HSP 2 Score: 80.8777 bits (198), Expect = 1.132e-11
Identity = 35/75 (46.67%), Postives = 54/75 (72.00%), Query Frame = 1
Query:  868 LPK--IKYLQIPLAVELLLPKIQTKIENILNDCPFLCDPLEVAAELRHFGYDQNACTKYFKITKSLRSVIEEIMP 1086
            LPK  ++ +++P+ +EL LP++Q +IE I++ C F+ DPLEVAAELR   YD +AC  YF  ++ LR +I+E +P
Sbjct:  314 LPKGSVETMRLPIGLELTLPRMQRQIEVIMSTCRFVYDPLEVAAELRTVNYDTDACIAYFLQSRELREIIQEFLP 388          
BLAST of Kinesin motor domain protein vs. TrEMBL
Match: H2KNY9 (Kinesin family member C2/C3 OS=Clonorchis sinensis OX=79923 GN=CLF_101012 PE=3 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 1.124e-120
Identity = 182/345 (52.75%), Postives = 253/345 (73.33%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVTDGGNILEFIGSESITLQI---APNERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGG-NEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVNLN 2697
            R++ +N+MQE  GN+RVYCRCR +    + LE    +++ L     A  E+++FD+VF    SQ E+Y+E  P V SF+DGYNVCF+TYG EASGKT+TL+GG ++  S  G+ QRAL T+L+E+  R+ + EY++   VVE+YND   D+L+ E  I L++++G +     +    I  ++D + L+ +C+ +R+V RTALN  SSRSHLI   +L  +S+IH  ++ S L LCDLAGFED+IKA+T  + +L+KEAGYINRSLTA NRVF+SLR QDP TVSYR++KLT+LLKPF ++SGKC LI+TVR D+ +L STQ+TLRFGRE+RGVSLG+ARRQ+NL+
Sbjct:  245 RKNMFNMMQEYFGNVRVYCRCRGIPKTKSCLEVHSLDTVVLMPGSDAAAEQYKFDRVFDINTSQTEVYKELSPFVSSFLDGYNVCFLTYGSEASGKTYTLLGGPDDKPSTEGIAQRALRTVLSEKTARRSEWEYQLLVSVVEVYNDTLTDILTNENGIHLHIESGPDHMMDDIHRQQIEKDSDIDDLLALCRTRRRVGRTALNLCSSRSHLIIFAQLNARSRIHDTSLSSILALCDLAGFEDVIKADTLGDPILAKEAGYINRSLTALNRVFMSLRSQDPTTVSYRDSKLTYLLKPFFSSSGKCILIVTVRTDRVNLASTQSTLRFGRESRGVSLGRARRQLNLD 589          

HSP 2 Score: 78.1814 bits (191), Expect = 4.844e-11
Identity = 30/70 (42.86%), Postives = 51/70 (72.86%), Query Frame = 1
Query:  874 KIKYLQIPLAVELLLPKIQTKIENILNDCPFLCDPLEVAAELRHFGYDQNACTKYFKITKSLRSVIEEIM 1083
            +++++++P+A+EL+LP++Q +IE ++  C  + DPLEVA+ELR   YD  AC  YF+ T+ LR +I E +
Sbjct:   53 RMEFIRLPIALELILPRMQKQIETVMISCQHVYDPLEVASELRQMNYDTEACIAYFQKTRPLRDIIHEFL 122          
BLAST of Kinesin motor domain protein vs. TrEMBL
Match: A0A5J4P111 (Kinesin family member C2/C3 OS=Paragonimus westermani OX=34504 GN=DEA37_0008584 PE=3 SV=1)

HSP 1 Score: 399.053 bits (1024), Expect = 1.258e-120
Identity = 198/379 (52.24%), Postives = 263/379 (69.39%), Query Frame = 1
Query: 1573 NNEKSFSDEQKSKMVTLSRQVXXXXXXXXXXXXXRRHAYNLMQEQMGNIRVYCRCRHVTDGGNILEFIGSESITLQ---IAPNERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIG-GNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVNLN 2697
            NN       Q SK+V  +R ++      +     R+  +N+MQE +GNIRVYCRCR +    + +E    +++       A  E+++FD+VF    SQ E+Y E  P+V SF+DGYNVCF+TYGGEASGKT+TL+G G   S  +G++ RAL   L E   RQ D  Y ++  V+EIYNDN  D+L  ET + ++VD+G+E     L ++PI  E D E L+ +C+ KR++  TALN  SSRSHLI L RL  +S++H    CS L LCDLAGFEDIIKA+T  +  L+KEAGYINRSLTA NRVF+SLR QDPNTVSYR++KLT+LLKPF T+SGKC LI+T+RNDK +L STQ++LRFGRE+RGV+LG+ARRQ+NL+
Sbjct:  545 NNRTDLPFSQLSKLVQENRSLKMTLRMEENR---RKTMFNMMQEYLGNIRVYCRCRAIPHARSCIEVPSLDTVLFANGTEAGIEQYKFDRVFDCHASQAEVYTELAPIVCSFLDGYNVCFLTYGGEASGKTYTLLGAGGFSSEANGIVYRALCNALAERDTRQHDWNYCLSVAVIEIYNDNVTDLLGNETGVNVHVDSGLERMMDALSTLPIEMETDIEDLLNLCRAKRRIGHTALNSQSSRSHLIILTRLNAQSRVHETKFCSILALCDLAGFEDIIKADTLGDPTLAKEAGYINRSLTALNRVFMSLRTQDPNTVSYRDSKLTYLLKPFFTSSGKCILIVTIRNDKGNLASTQSSLRFGRESRGVTLGRARRQLNLD 920          

HSP 2 Score: 89.3521 bits (220), Expect = 2.861e-14
Identity = 42/85 (49.41%), Postives = 58/85 (68.24%), Query Frame = 1
Query:  868 LPKIKYLQIPLAVELLLPKIQTKIENILNDCPFLCDPLEVAAELRHFGYDQNACTKYFKITKSLRSVIEEIMP---VSNTESYSY 1113
            LP I+   +P+A+EL+LPK+Q +I+NI+  C +LCDPLEVAAELR   YD  AC  YF  T+ LR VI E +P   ++ T++  Y
Sbjct:  379 LPTIR---LPIALELVLPKMQRQIKNIMCSCQYLCDPLEVAAELRQMNYDTEACIAYFHKTRPLREVIHEFLPKTHITKTDANQY 460          
BLAST of Kinesin motor domain protein vs. TrEMBL
Match: A0A1S8XAP8 (Kinesin motor domain protein OS=Opisthorchis viverrini OX=6198 GN=X801_00288 PE=3 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 1.299e-117
Identity = 182/345 (52.75%), Postives = 252/345 (73.04%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVTDGGNILEFIGSESITLQI---APNERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNE-GSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVNLN 2697
            R++ +N+MQE  GN+RVYCRCR +    + LE    +++ L     A  E+++FD+VF    SQ E+Y+E  P V SF+DGYNVCF+TYG EASGKT+TL+GG +   S  G+ QRAL T+L+E+  R+ + EY++   VVE+YND   D+L+ E  I L++++G +     +    I  ++D + L+ +C+ +R+V RTALN  SSRSHLI   +L  +S+IH  ++ S L LCDLAGFED+IKA+T  + +L+KEAGYINRSLTA NRVF+SLR QDP TVSYR++KLT+LLKPF ++SGKC LI+TVR D+ +L STQ+TLRFGRE+RGVSLG+ARRQ+NL+
Sbjct:  513 RKNMFNMMQEYFGNVRVYCRCRGIPKAKSCLEVHSLDTVVLMTGSDAAAEQYKFDRVFDTNASQTEVYKELSPFVSSFLDGYNVCFLTYGSEASGKTYTLLGGPDYKPSTEGIAQRALRTVLSEKTTRRSEWEYQLLVSVVEVYNDTLTDILTNENGIHLHIESGPDHMMDDIHRQLIEKDSDIDDLLALCRTRRRVGRTALNLCSSRSHLIIFAQLNARSRIHDTSLSSILALCDLAGFEDVIKADTLGDPILAKEAGYINRSLTALNRVFMSLRSQDPTTVSYRDSKLTYLLKPFFSSSGKCILIVTVRTDRVNLASTQSTLRFGRESRGVSLGRARRQLNLD 857          

HSP 2 Score: 77.0258 bits (188), Expect = 1.723e-10
Identity = 30/70 (42.86%), Postives = 49/70 (70.00%), Query Frame = 1
Query:  874 KIKYLQIPLAVELLLPKIQTKIENILNDCPFLCDPLEVAAELRHFGYDQNACTKYFKITKSLRSVIEEIM 1083
            + +++++P+A+EL+LP++Q +IE ++  C  + DPLEVA+ELR   YD  AC  YF  T+ LR +I E +
Sbjct:  321 RTEFIRLPIALELILPRMQKQIETVMISCQHVYDPLEVASELRQMNYDTEACIAYFHKTRPLRDIIHEFL 390          
BLAST of Kinesin motor domain protein vs. TrEMBL
Match: A0A074Z3N1 (Kinesin motor domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_10075 PE=3 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 2.697e-117
Identity = 182/345 (52.75%), Postives = 252/345 (73.04%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVTDGGNILEFIGSESITLQI---APNERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNE-GSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVNLN 2697
            R++ +N+MQE  GN+RVYCRCR +    + LE    +++ L     A  E+++FD+VF    SQ E+Y+E  P V SF+DGYNVCF+TYG EASGKT+TL+GG +   S  G+ QRAL T+L+E+  R+ + EY++   VVE+YND   D+L+ E  I L++++G +     +    I  ++D + L+ +C+ +R+V RTALN  SSRSHLI   +L  +S+IH  ++ S L LCDLAGFED+IKA+T  + +L+KEAGYINRSLTA NRVF+SLR QDP TVSYR++KLT+LLKPF ++SGKC LI+TVR D+ +L STQ+TLRFGRE+RGVSLG+ARRQ+NL+
Sbjct:  548 RKNMFNMMQEYFGNVRVYCRCRGIPKAKSCLEVHSLDTVVLMTGSDAAAEQYKFDRVFDTNASQTEVYKELSPFVSSFLDGYNVCFLTYGSEASGKTYTLLGGPDYKPSTEGIAQRALRTVLSEKTTRRSEWEYQLLVSVVEVYNDTLTDILTNENGIHLHIESGPDHMMDDIHRQLIEKDSDIDDLLALCRTRRRVGRTALNLCSSRSHLIIFAQLNARSRIHDTSLSSILALCDLAGFEDVIKADTLGDPILAKEAGYINRSLTALNRVFMSLRSQDPTTVSYRDSKLTYLLKPFFSSSGKCILIVTVRTDRVNLASTQSTLRFGRESRGVSLGRARRQLNLD 892          

HSP 2 Score: 77.0258 bits (188), Expect = 1.762e-10
Identity = 30/70 (42.86%), Postives = 49/70 (70.00%), Query Frame = 1
Query:  874 KIKYLQIPLAVELLLPKIQTKIENILNDCPFLCDPLEVAAELRHFGYDQNACTKYFKITKSLRSVIEEIM 1083
            + +++++P+A+EL+LP++Q +IE ++  C  + DPLEVA+ELR   YD  AC  YF  T+ LR +I E +
Sbjct:  356 RTEFIRLPIALELILPRMQKQIETVMISCQHVYDPLEVASELRQMNYDTEACIAYFHKTRPLRDIIHEFL 425          
BLAST of Kinesin motor domain protein vs. Ensembl Cavefish
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:103041085])

HSP 1 Score: 164.851 bits (416), Expect = 2.121e-41
Identity = 110/347 (31.70%), Postives = 183/347 (52.74%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHV------TDGGNILEFIGSESITLQIAPNER---FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVL----SGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKA 2676
            R+  +N +    GNIRV+CR R V      +D   ++ F   +   L ++   +   FE DKVF P ++Q E+++E + LV S IDG+NVC   YG   SGKT+T+ G  E     G+ QRAL  + +E   ++ D +Y IT  +VEIYN+   ++L    S + +I++  D   +     L    + +  D   + ++  + R  A T LN  SSRSH + +I + G +   G      L L DLAG E I K+  + +++  +EA  IN+SL+A   V  +LR +  + V +R ++LT+LL+  L+   K  +++ V   + ++  +  +L+F +  R V LG +
Sbjct:  426 RKKCHNELVRLKGNIRVFCRVRPVCQDEAESDSKTMVSFDSDDDAVLYLSNKGKLMTFELDKVFPPQITQDEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEGVPEDP---GINQRALRLLFSEVSEKKPDWDYNITVSMVEIYNETLRNLLGDNPSEKLDIKMCPDGSGQLYVPGLTEFSVESVEDINRVFELGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRL--REAQCINKSLSALGDVINALRSRHSH-VPFRNSRLTYLLQDSLSGDSKTLMVVQVSPLESNISESVCSLKFAQRVRTVELGPS 766          
BLAST of Kinesin motor domain protein vs. Ensembl Cavefish
Match: si:ch211-257p13.3 (kinesin-like protein KIFC3 [Source:NCBI gene;Acc:103045287])

HSP 1 Score: 164.081 bits (414), Expect = 3.822e-41
Identity = 114/358 (31.84%), Postives = 180/358 (50.28%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVTDGGNILEFIGSESITLQIAPN-------------ERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLS--GET-NIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVNLNG 2700
            RR  +  + E  GNIRV CR + V       E    +++ +   P+             + FE DKVFHP  +Q E+++E  PL+ S IDGY+VC   YG   SGKT+T+ G  E     G+ QRAL  +  E   R+    Y +T   VEIYN+   D+LS  GE  +I++  D   +     L+ + + +    + ++   +  R    T +N  SSRSH +  + +QG     G      L L DLAG E + K+  +  ++  KEA  INRSL A   V  +LR +  + + +R ++LT+LL+  L    K A+++ + + +R++G T  +L+F +    V LG A R++   G
Sbjct:  544 RRKYHEQLVELKGNIRVLCRVKPVLKED---EHEEGQTVAVTTDPHNESALTVLSKGKAKTFELDKVFHPQATQEEVFQEIEPLITSCIDGYHVCIFAYGQTGSGKTYTMEGPTENP---GINQRALKHLFNEIEERKDMWTYTVTVSSVEIYNEVLRDLLSKDGEKLDIKINPDGTGQLHVPGLRVIEVKSFQHIKKILATARRNRITFGTQMNQHSSRSHALLTVTVQGVDLATGSKSSGKLNLVDLAGSERVWKSGAEGERL--KEAQNINRSLLALGDVIQALRGRQTH-IPFRNSRLTYLLQDSLGKGNKTAMVVQISSLERNVGETLCSLKFAQRVCKVELGPAARKIESGG 892          
BLAST of Kinesin motor domain protein vs. Ensembl Cavefish
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:103041085])

HSP 1 Score: 164.081 bits (414), Expect = 3.945e-41
Identity = 110/347 (31.70%), Postives = 183/347 (52.74%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHV------TDGGNILEFIGSESITLQIAPNER---FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVL----SGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKA 2676
            R+  +N +    GNIRV+CR R V      +D   ++ F   +   L ++   +   FE DKVF P ++Q E+++E + LV S IDG+NVC   YG   SGKT+T+ G  E     G+ QRAL  + +E   ++ D +Y IT  +VEIYN+   ++L    S + +I++  D   +     L    + +  D   + ++  + R  A T LN  SSRSH + +I + G +   G      L L DLAG E I K+  + +++  +EA  IN+SL+A   V  +LR +  + V +R ++LT+LL+  L+   K  +++ V   + ++  +  +L+F +  R V LG +
Sbjct:  486 RKKCHNELVRLKGNIRVFCRVRPVCQDEAESDSKTMVSFDSDDDAVLYLSNKGKLMTFELDKVFPPQITQDEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEGVPEDP---GINQRALRLLFSEVSEKKPDWDYNITVSMVEIYNETLRNLLGDNPSEKLDIKMCPDGSGQLYVPGLTEFSVESVEDINRVFELGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRL--REAQCINKSLSALGDVINALRSRHSH-VPFRNSRLTYLLQDSLSGDSKTLMVVQVSPLESNISESVCSLKFAQRVRTVELGPS 826          
BLAST of Kinesin motor domain protein vs. Ensembl Cavefish
Match: si:ch211-257p13.3 (kinesin-like protein KIFC3 [Source:NCBI gene;Acc:103045287])

HSP 1 Score: 164.081 bits (414), Expect = 4.137e-41
Identity = 114/358 (31.84%), Postives = 180/358 (50.28%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVTDGGNILEFIGSESITLQIAPN-------------ERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLS--GET-NIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVNLNG 2700
            RR  +  + E  GNIRV CR + V       E    +++ +   P+             + FE DKVFHP  +Q E+++E  PL+ S IDGY+VC   YG   SGKT+T+ G  E     G+ QRAL  +  E   R+    Y +T   VEIYN+   D+LS  GE  +I++  D   +     L+ + + +    + ++   +  R    T +N  SSRSH +  + +QG     G      L L DLAG E + K+  +  ++  KEA  INRSL A   V  +LR +  + + +R ++LT+LL+  L    K A+++ + + +R++G T  +L+F +    V LG A R++   G
Sbjct:  566 RRKYHEQLVELKGNIRVLCRVKPVLKED---EHEEGQTVAVTTDPHNESALTVLSKGKAKTFELDKVFHPQATQEEVFQEIEPLITSCIDGYHVCIFAYGQTGSGKTYTMEGPTENP---GINQRALKHLFNEIEERKDMWTYTVTVSSVEIYNEVLRDLLSKDGEKLDIKINPDGTGQLHVPGLRVIEVKSFQHIKKILATARRNRITFGTQMNQHSSRSHALLTVTVQGVDLATGSKSSGKLNLVDLAGSERVWKSGAEGERL--KEAQNINRSLLALGDVIQALRGRQTH-IPFRNSRLTYLLQDSLGKGNKTAMVVQISSLERNVGETLCSLKFAQRVCKVELGPAARKIESGG 914          
BLAST of Kinesin motor domain protein vs. Ensembl Cavefish
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:103041085])

HSP 1 Score: 163.696 bits (413), Expect = 9.365e-41
Identity = 110/347 (31.70%), Postives = 183/347 (52.74%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHV------TDGGNILEFIGSESITLQIAPNER---FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVL----SGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKA 2676
            R+  +N +    GNIRV+CR R V      +D   ++ F   +   L ++   +   FE DKVF P ++Q E+++E + LV S IDG+NVC   YG   SGKT+T+ G  E     G+ QRAL  + +E   ++ D +Y IT  +VEIYN+   ++L    S + +I++  D   +     L    + +  D   + ++  + R  A T LN  SSRSH + +I + G +   G      L L DLAG E I K+  + +++  +EA  IN+SL+A   V  +LR +  + V +R ++LT+LL+  L+   K  +++ V   + ++  +  +L+F +  R V LG +
Sbjct:  659 RKKCHNELVRLKGNIRVFCRVRPVCQDEAESDSKTMVSFDSDDDAVLYLSNKGKLMTFELDKVFPPQITQDEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEGVPEDP---GINQRALRLLFSEVSEKKPDWDYNITVSMVEIYNETLRNLLGDNPSEKLDIKMCPDGSGQLYVPGLTEFSVESVEDINRVFELGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRL--REAQCINKSLSALGDVINALRSRHSH-VPFRNSRLTYLLQDSLSGDSKTLMVVQVSPLESNISESVCSLKFAQRVRTVELGPS 999          
BLAST of Kinesin motor domain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010492.1 (pep scaffold:Pmarinus_7.0:GL478879:14589:34633:-1 gene:ENSPMAG00000009502.1 transcript:ENSPMAT00000010492.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.956 bits (463), Expect = 6.010e-51
Identity = 122/342 (35.67%), Postives = 183/342 (53.51%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVTDGGNI--LEFIGSESITLQIAPNER---FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILT--EERLRQRDCEYKITACVVEIYNDNCIDVLSGETNIQLYV-DNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKA 2676
            RR  ++ + E  GNIRV+CR R     G +  LEF  S    L +    +   F FD+VF P  +Q +++ +  PL+ S +DGYNVC + YG   SGKT T++G    S+  G+  R++  +L   +ER    + +Y +   ++EIYN+   D+L    +  L V           L +  +T+E D   +M+     R VA T +N  SSRSHL+T + L+G   + G      L L DLAG E I + E    +++  EA  IN+SLT+  +VF++LR    + V YR +KLTHLL+P L  + K  + +TV  D  + G T +TL+FG   R V+LG A
Sbjct:   49 RRLLHDQLTELRGNIRVFCRGRPGAPDGGVPGLEFSPSAGEVLVMQSEGKTTSFAFDQVFPPNATQEQVFADTLPLITSCVDGYNVCILAYGQTGSGKTHTMMG---TSNAPGVNVRSVKELLNICKER---HNVKYTLKISMLEIYNETVRDLLGKPGSGPLEVRGQARSVTVPGLTTTIVTSEEDIVRVMETAHKHRTVASTKMNIHSSRSHLLTTLSLEGLDVVSGSASHGSLILGDLAGSERISRTEATGQRLV--EAAAINKSLTSLGQVFLALRNGSLH-VPYRNSKLTHLLQPALGGNAKACVFVTVSADDANRGETLSTLQFGSSIRQVALGAA 381          
BLAST of Kinesin motor domain protein vs. Ensembl Sea Lamprey
Match: kifc3 (kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE-030131-3724])

HSP 1 Score: 173.711 bits (439), Expect = 2.122e-47
Identity = 116/352 (32.95%), Postives = 177/352 (50.28%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVT--DG-----GNILEFIGSESITLQIAPNER---FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLS----GETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQV 2688
            R+  +N + E  GNIRV CR R     DG      ++++    +   + +A   R   F+ D+VF P  SQ E++ E + LV S +DGYN+C   YG   SGKT+T+      +   G+ QRAL  +  E   RQ +  Y ++  ++EIYN+   D+L     G  +I+L  D   E     L+  P+T+  D   L+ +    R    T +N  SSRSH + L+ +   + I G +    L L DLAG E + K+  + +++  +EA  INRSL A   V  +LR +  + V +R +KLT+LL+  L    K  ++I V    R    T  +L F +  R V LG A R+V
Sbjct:   69 RKKYHNQLVELRGNIRVLCRVRPAIEEDGEGTLAHSVVQVDTEDDGAVHVAQRGRQHSFQLDRVFPPHASQEEVFREVQDLVTSCVDGYNICIFAYGQTGSGKTYTMERAQGTAKAPGINQRALQHLFQEMEERQDEWRYTLSLSMLEIYNETLRDLLGSEGHGRLDIRLCPDGSGELCVPGLRQEPVTSLGDVHRLVSLGHSNRATHCTNMNEHSSRSHALILVTVSATNSITGTSTRGRLNLVDLAGSERLAKSRAEGDRL--REAQNINRSLAALGDVIQALRAKQAH-VPFRNSKLTYLLQDSLARESKTLMVIQVAPAARHAAETICSLHFAQRARAVELGPATRRV 417          
BLAST of Kinesin motor domain protein vs. Ensembl Sea Lamprey
Match: kif11 (kinesin family member 11 [Source:ZFIN;Acc:ZDB-GENE-020426-1])

HSP 1 Score: 123.635 bits (309), Expect = 4.969e-29
Identity = 100/348 (28.74%), Postives = 171/348 (49.14%), Query Frame = 1
Query: 1714 NIRVYCRCRHV------TDGGNILEFIGSE---SITLQIAPNER-----FEFDKVFHPGMSQIELYEEF-RPLVMSFIDGYNVCFITYGGEASGKTFTLIGGN--------EGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETNI----QLYVDNGMETAY--QKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGK-SKIHGENICSF--LCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGV 2661
            +I+V+ RCR +       +  +I+E   +    S+ L +   E+     + +D VF P   QIE+Y+    P++   I GYN     YG   +GKTFT+ G          E     G++ R L  I   E+L     E+ +   ++EIYN+   D+LS   +I    Q++ D   + A   + L+ V + N+ +   +++    KR+ A T +N  SSRSH +  I +  K + + GE +     L + DLAG E+I ++     +  ++EAG IN+SL    RV  +L ++ P+ + YRE+KLT LL+  L    K ++I T+     ++  T +TL +    + +
Sbjct:   21 HIQVFVRCRPLNGIERKANSYSIVECDQARKELSVKLNVPLGEKSSKKTYTYDMVFGPAAKQIEIYKSVVYPILDEVILGYNCTVFAYGQTGTGKTFTMEGERSPNDEFTWEEDPLAGVIPRTLHQIF--EKLTSLGVEFSVKVSLLEIYNEELFDLLSSSPDIGERLQMFDDPRSKGAVLIKGLEEVTVHNKDEVYHILEHGAAKRRTASTLMNAYSSRSHSVFSITIHMKETMMDGEELVKIGKLNMVDLAGSENIGRSGAVDKR--AREAGNINQSLLTLGRVITALVERTPH-IPYRESKLTRLLQDSLGGRTKTSIIATISPAAVNIEETLSTLEYAARAKNI 363          
BLAST of Kinesin motor domain protein vs. Ensembl Sea Lamprey
Match: kif15 (kinesin family member 15 [Source:ZFIN;Acc:ZDB-GENE-050622-16])

HSP 1 Score: 121.324 bits (303), Expect = 3.584e-28
Identity = 107/349 (30.66%), Postives = 176/349 (50.43%), Query Frame = 1
Query: 1717 IRVYCRCRHVTDG-----------GNILEFIGSESITLQIAPNER-FEFDKVFHPGMSQIELYEEF-RPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNE-----GSSQHGLMQRALT---TILTEERLRQRDCEYKITAC-VVEIYNDNCIDVLSGET-------NIQ--LYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGE-NI-CSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRK---QDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETR 2655
            IRV  R R  T+G           G  +  +  +++ +   P  R F FD V     +Q E++    + ++ S ++GYN     YG   SGKTFT++G  +       +  G++ R+L    ++++ E+    D +  +  C  +EIYN+   D+L   +       NIQ  ++V+  ME        + +++ A+A  ++ +    R+VA T++N  SSRSH +  + +Q K K +G  NI  S L L DLAG E   + +TQ++ +  KEAG INRSL++   V  +L +        V YR++KLT LL+  L  + K A+I+ V    R  G T +TL+F R T+
Sbjct:    3 IRVCVRVRPPTEGIAANEGESMEQGMCVTVVSPDTVRVLSRPEPRTFTFDYVASISATQEEIFSVVAKNIIESCMNGYNGTIFAYGQTGSGKTFTMLGAMDHVDIFNHNLRGVIPRSLEFIFSLISREKQMTGDAKEFLCKCSFLEIYNEQVFDLLDPASTSLFIRENIQKGVFVEGVME--------MSLSSAAEAYQVLSLGWRNRRVASTSMNRESSRSHAVFTLTIQSKEKRNGMVNIRSSQLNLVDLAGSER--QRDTQSDGMRLKEAGSINRSLSSLGNVINALAEIAHGKGRFVPYRDSKLTFLLRDSLGGNAKTAVIVNVHPGGRYFGETLSTLQFARRTK 341          
BLAST of Kinesin motor domain protein vs. Ensembl Sea Lamprey
Match: kif6 (kinesin family member 6 [Source:ZFIN;Acc:ZDB-GENE-061027-130])

HSP 1 Score: 117.087 bits (292), Expect = 3.443e-27
Identity = 93/311 (29.90%), Postives = 150/311 (48.23%), Query Frame = 1
Query: 1762 ILEFIGSESITLQIAPNER----FEFDKVFHPGMSQIELYEEF-RPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACV--VEIYNDNCIDVLSGE---------TNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGR 2646
            +LEF+    +      N+R    F+F K+F     Q E++E   RP+  S + GYN     YG   SGKTFT+ GG E  +  G++ R L  +  +    Q+D     TA +  +EIYN+N  D+L+             + L  D       + L     +++ +A  L+ +    R +A T +N AS+RSH I  + + G+         S L L DLAG E + K  T    +L  EA YIN SL    +V ++L +++ + V YR + +T +L+  L  +    +I T+  DKR++  + +T RF +
Sbjct:   33 LLEFVVPRDLAEGFVNNKRESYKFQFKKIFDQQAKQEEIFETIARPVADSVLSGYNGTIFAYGQTGSGKTFTITGGAERFADRGIIPRILGYLFEQ---FQKDTNRVYTAHISYLEIYNENGYDLLNPRHEASKLEDLPKVTLMEDTDQIVHLKNLSLHQASSQEEALNLLFLGDTNRMIAETPMNQASTRSHCIFTLHVCGREPGSTTLCRSKLHLVDLAGSERVSK--TGVGGILLTEAKYINLSLHYLEQVIIALSEKNRSHVPYRNSMMTSVLRDSLGGNCMTTMIATLAVDKRNIDESISTCRFAQ 338          
BLAST of Kinesin motor domain protein vs. Ensembl Yeast
Match: KAR3 (Minus-end-directed microtubule motor; functions in mitosis and meiosis, localizes to the spindle pole body and localization is dependent on functional Cik1p, required for nuclear fusion during mating; potential Cdc28p substrate [Source:SGD;Acc:S000006345])

HSP 1 Score: 144.05 bits (362), Expect = 6.665e-36
Identity = 110/360 (30.56%), Postives = 174/360 (48.33%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHV--------TDGGNILEF---IGSESITLQIAPN----ERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTE-ERLRQRDCEYKITACVVEIYNDNCIDVLSGETNIQLYVDNGME-----------TAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNT--VSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSL 2667
            RR  +N +QE  GNIRVYCR R          T   N+ EF    G +S+ +    N      F+FDK+F    + +++++E   LV S +DGYNVC   YG   SGKTFT++  N G    G++   ++ I     +L+ +  +YK+    +EIYN+N +D+L  + N +     G++           T    + S  + +E   E +++     R  A TA N  SSRSH I +I L G +   G +    L L DLAG E I  ++   +++  +E   IN+SL+    V  +L + D     + +R +KLT+LL+  LT   K  + + +      +  T N+LRF  +     L
Sbjct:  373 RRTLHNELQELRGNIRVYCRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNTAQVHEFKFDKIFDQQDTNVDVFKEVGQLVQSSLDGYNVCIFAYGQTGSGKTFTML--NPGD---GIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLLRSDNNNKEDTSIGLKHEIRHDQETKTTTITNVTSCKLESEEMVEIILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVSQVVGDRL--RETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKVNSTRL 725          
BLAST of Kinesin motor domain protein vs. Ensembl Yeast
Match: KIP2 (Kinesin-related motor protein involved in mitotic spindle positioning; stabilizes microtubules by targeting Bik1p to the plus end; functions as a microtubule polymerase and catastrophe inhibitor in vitro; Kip2p levels are controlled during the cell cycle [Source:SGD;Acc:S000006076])

HSP 1 Score: 115.161 bits (287), Expect = 9.417e-27
Identity = 105/352 (29.83%), Postives = 158/352 (44.89%), Query Frame = 1
Query: 1819 FEFDKVFHPGMSQIELYEE-FRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTE--ERLRQRDCEYKITACVVEIYNDNCIDVL------SGE---TNIQLYVD----NGM-------ETAYQKLKSVPITN---EADAEAL--MQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVS------------------------------YRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVNLNG 2700
            F+FD VF    + +E+YE   +P++   + G+N     YG   SGKTFT+  GNE   + GL+  +++ + T   E+    D ++ +    +EIYN+   D+L      SG    T  +LY+     NG+       + +   +K + +T    E+  E L  + V    RK+  T  N  SSRSH I LIRL   +  +G +  S L LCDLAG E   +A  Q  +   KE  +IN+SL A   V   L     N+V                               YR++KLT LL+P L+       I TV     +   T NTLRF    + V+L  +++ +  NG
Sbjct:  163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTM-SGNE--QELGLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLESGLEESGSRISTPSRLYMSKSNSNGLGVELKIRDDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTNVKNGTSRSSTLSLCDLAGSE---RATGQQER--RKEGSFINKSLLALGTVISKLSADKMNSVGSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNVALHVSKKSIISNG 506          
BLAST of Kinesin motor domain protein vs. Ensembl Yeast
Match: KIP1 (Kinesin-related motor protein; required for mitotic spindle assembly, chromosome segregation, and 2 micron plasmid partitioning; functionally redundant with Cin8p for chromosomal but not plasmid functions [Source:SGD;Acc:S000000159])

HSP 1 Score: 102.064 bits (253), Expect = 1.659e-22
Identity = 107/375 (28.53%), Postives = 170/375 (45.33%), Query Frame = 1
Query: 1711 GNIRVYCRCRH--------------VTDGGNILEFIGSESITLQIAPNER-FEFDKVFHPGMSQIELYEE-FRPLVMSFIDGYNVCFITYGGEASGKTFTLIG-----GNEGSSQH-------GLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCID-----------VLSGETNIQLYVDNGMETA--YQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIR---LQGKSKIHGENI----CSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVN 2691
             NI VY RCR                T G    E I S       + +++ ++FD+VF     Q  ++    +  +   + GYN     YG   +GKT+T+ G     G+  S+ +       G++ R L  +  E  L   + EY +    +E+YN+N  D           V   +  I+++ +N   ++   + ++ + I +  +   L+    +KRKVA T  N  SSRSH +  I    ++  SK HG+N        L L DLAG E+I ++  +  +  ++EAG IN+SL    RV  +L     N + YRE+KLT LL+  L    K  +I T+   K S+  T +TL +   TR  S+ K   QVN
Sbjct:   51 SNIHVYVRCRSRNKREIEEKSSVVISTLGPQGKEIILSNGSHQSYSSSKKTYQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKE--LSSLNKEYSVKISFLELYNENLKDLLSDSEDDDPAVNDPKRQIRIFDNNNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKR--AQEAGLINKSLLTLGRVINALVDH-SNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYA--TRAKSI-KNTPQVN 417          
BLAST of Kinesin motor domain protein vs. Ensembl Yeast
Match: KIP3 (Kinesin-related antiparallel sliding motor protein; involved in mitotic spindle positioning; sliding activity promotes bipolar spindle assembly and maintenance of genome stability; inhibits spindle elongation, destabilizing late anaphase spindle microtubules that polymerize beyond the midzone [Source:SGD;Acc:S000003184])

HSP 1 Score: 99.3673 bits (246), Expect = 9.593e-22
Identity = 85/307 (27.69%), Postives = 143/307 (46.58%), Query Frame = 1
Query: 1816 RFEFDKVFHPGMSQIELYEEF-RPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVC---KVKRKVARTALNPASSRSHLITLIRLQGKSKI---HGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNT---VSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVNLNGQV 2706
            +F FDK+F    SQ  +Y+E   PL+ S +DG+N     YG    GKT+T+ G     SQ G++  A+  +  +    + + +++I+   +EIYN+   D+L  ET  +  V       + K+ ++   +    E +M +     + R  + T  N  SSRSH +  I +   +K+     ++  + L + DLAG E    A T+   +   E   INRSL A      +L   D +    + YR++KLT LLK  L  + K  +I+ +         T NTL++    + +     R Q +L+  V
Sbjct:  152 KFVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT---PSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLLKPETPSKRLVIREDTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQHTFATLSIIDLAGSER--AAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTKIIRNQQSLSRHV 453          
BLAST of Kinesin motor domain protein vs. Ensembl Yeast
Match: CIN8 (Kinesin motor protein; involved in mitotic spindle assembly and chromosome segregation [Source:SGD;Acc:S000000787])

HSP 1 Score: 73.9442 bits (180), Expect = 7.101e-14
Identity = 49/164 (29.88%), Postives = 76/164 (46.34%), Query Frame = 1
Query: 1714 NIRVYCRCRHVTDGG---------NILEFIGSESITLQIAPN---------ERFEFDKVFHPGMSQIELYEEFR-PLVMSFIDGYNVCFITYGGEASGKTFTLIG-----GNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETN 2133
            NI V  RCR   +           N+ +  GS+ I++    +         +R+  DKVF PG SQ  +++E   PL   FI GYN   + YG  ++GKT+T+ G       E S   G++ R L  +     L+Q D  Y +    +E+YN+   D+L   +N
Sbjct:   36 NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQND--YVVKCSFIELYNEELKDLLDSNSN 197          

HSP 2 Score: 72.7886 bits (177), Expect = 1.503e-13
Identity = 58/165 (35.15%), Postives = 87/165 (52.73%), Query Frame = 1
Query: 2173 QKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENI--CSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGV 2661
            Q L+   ITN  +   L+Q     R+VA T +N  SSRSH I  I L  K   H + +   S + L DLAG E+I ++     +  +KEAG IN+SL    RV  +L  +  + + +RE+KLT LL+  L  + K ALI T+   K +   T +TL +  + + +
Sbjct:  319 QNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKK---HQDELFRISKMNLVDLAGSENINRSGALNQR--AKEAGSINQSLLTLGRVINALVDKSGH-IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 477          
BLAST of Kinesin motor domain protein vs. Ensembl Nematostella
Match: EDO45950 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRH2])

HSP 1 Score: 198.749 bits (504), Expect = 1.578e-55
Identity = 126/350 (36.00%), Postives = 191/350 (54.57%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVT--DGG-----NILEFIGSESITLQI---APNERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETNIQLYVDNGMETAY-QKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVN 2691
            R+   N + E  GNIRVYCR R V   DG      N++ F   +   L +      + FE D+VF P  +Q+E++EE +PLV+S +DGYNVC   YG   SGKTFT+ G     S  G+ QRAL  + TE   R  D +Y++T  V+EIYN+   D+LS + + +L +  G E  Y   L  V +TN  +   + Q+ K  R  A T +N  SSRSH +    + G ++  G      L L DLAG E + K+ ++  ++  KEA  IN+SL++   V  +L+ +  + V YR +KLT+LL+  L    K  +++ V   ++++G T  +L F +  R V LG+A R+ +
Sbjct:   76 RKKYLNELIELKGNIRVYCRVRPVIREDGAGKPAENVISFDDDDDAILNVFSRGALKPFEMDRVFQPQSTQVEVFEEVKPLVISCVDGYNVCIFAYGQTGSGKTFTMEG---PVSNPGINQRALQHLFTETADRGVDWDYQVTVSVMEIYNEMLRDLLSSDPSAKLDIKQGKEGLYVPGLSEVEVTNLDEVNEIFQLGKQNRATAFTDMNEHSSRSHALLCATVIGVNRTTGARTIGKLNLVDLAGSERVSKSGSEGARM--KEAQNINKSLSSLGDVIHNLKNKSAH-VPYRNSKLTYLLQESLGGDSKTLMVVQVAPVEKNVGETVCSLNFAQRVRAVELGQATRKTD 419          
BLAST of Kinesin motor domain protein vs. Ensembl Nematostella
Match: EDO31606 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXF7])

HSP 1 Score: 181.03 bits (458), Expect = 3.698e-47
Identity = 118/349 (33.81%), Postives = 183/349 (52.44%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVTDGGNILEFIGSESITLQIAPNER--FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILT--EERLRQRDCEYKITACVVEIYNDNCIDVL-------SGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQV 2688
            R+  YN +QE  GNIRV+CRCR        + F   + I   + P+ R  F FD+VF P  +Q +++E+  PL+ S +DGYNVC + YG   +GKTFT++G  +     G+  R++  +L    ER    + +Y ++  ++E+YN+   D+L         + +IQL    G +     L  + + +      +M      R V  T +N +SSRSHL+ ++ + G  KI      S L L DLAG E I K E    +++  EA  IN+SL+A  +VF +LR  +   V YR +KLT LL+  L   GK  + + V   + +L  T +TL+FG   + V LGKA + +
Sbjct:  476 RKLLYNKLQELRGNIRVFCRCRRDPTVEVAVTFPSDQEIQ-AVGPSGRKTFMFDRVFTPDSTQEQVFEDTLPLIASCVDGYNVCIMAYGQTGAGKTFTMMGPEDNP---GVNVRSILELLRVCNER---PNVDYTLSLAMLEVYNETLKDLLEEFGSCAGTQLSIQL---KGKQVVVPHLTEIQVNSAKAIRTIMAKGDANRSVGATKMNTSSSRSHLVLILHINGVDKISHAITHSTLTLVDLAGSERISKTEATGQRLV--EAAAINKSLSALGQVFTALRT-NAMHVPYRNSKLTQLLQGSLGGDGKACMFVNVSPAEWNLSETISTLQFGAGAKQVQLGKATQNI 811          
BLAST of Kinesin motor domain protein vs. Ensembl Nematostella
Match: EDO34961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMV5])

HSP 1 Score: 158.688 bits (400), Expect = 2.592e-42
Identity = 111/351 (31.62%), Postives = 181/351 (51.57%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCR--------------HVTDGGNILEFIGS---ESI--TLQIAPNERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTI-LTEERLRQRDCEYKITACVVEIYNDNCIDVL-SGETNI--QLYVDNGMETAYQK-----LKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFG 2643
            RR  +N +QE  GNIRV+CR R               + D G  +    S   E +  T +      F FDKVF     Q +++EE   LV S +DGYNVC   YG   SGKT+T+ G +      G++ R++  + L   +L+++  +YK+    +EIYN+   D+L SG+  I  ++ + NG  +   +     LK+  + +E+   +L++     R V  TA N  SSRSH + +++L G++ I  E+    L L DLAG E + ++    +++  KE   IN+SL+  + V ++L  ++ + V YR +KLT+LLK  L  + K  + + +   + SL  T  +LRF 
Sbjct:   25 RRTLHNTIQELKGNIRVFCRVRPPLPNEMNKDLVNVSLQDEGRGIAITPSNLPEDVMATKKGVSKYEFSFDKVFQHTSKQAQVFEEISQLVQSALDGYNVCIFAYGQTGSGKTYTMEGDHNNLEHRGMIPRSMEQVFLNTHKLQEKGWKYKMDVSFLEIYNETIRDLLGSGDETIKHEIKMVNGSNSTNSQVMVTNLKTFEVEDESQVYSLLKTASQNRAVGATACNERSSRSHSVFIMKLTGENSITEESCSGTLNLVDLAGSERLGQSCASGDRL--KETKNINKSLSTLSSVIIALANKEGH-VPYRNSKLTYLLKNSLGGNSKSLMFVNISPREESLQETLCSLRFA 372          
BLAST of Kinesin motor domain protein vs. Ensembl Nematostella
Match: EDO49352 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG40])

HSP 1 Score: 119.398 bits (298), Expect = 2.148e-29
Identity = 96/325 (29.54%), Postives = 157/325 (48.31%), Query Frame = 1
Query: 1714 NIRVYCRCRHVTD-----GGNILEFIGSESITLQIAPNERFEFDKVFHPGMSQIELYEEF-RPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLS-GETNIQLYVDNG----METAYQKLKSVPITNEADAEALMQVC---KVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGR 2646
            NI+V+CR R  +D     GG I+  +   +    I     F FD+VF P  +Q ++Y E  + +V   ++GYN     YG  +SGKT T+ G  + S   G++ R +  I         + E+ I     EIY D   D+L   +TN+ ++ D      ++   ++  S P       E +M++    K  R VA T +N  SSRSH I L+ ++ ++    + +   L L DLAG E + K  T     +  EA  IN+SL+A   V  +L +   + V YR++K+T +L+  L  + +  +II       +   T++TL FG+
Sbjct:   12 NIKVFCRFRPQSDAETKAGGQIV--VKFPTPDTAIHGGRTFTFDRVFKPTATQEKVYSEAAQAIVQDVLNGYNGTIFAYGQTSSGKTHTMEGLIDSSLHQGIIPRIVQDIFNHIYNMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLAVHEDKNRVPFVKGGTERFVSSP-------EEVMEIIDEGKANRHVAVTNMNEHSSRSHSIFLLHIKQENVETNKKLSGKLYLVDLAGSEKVSK--THAEGSVLDEAKNINKSLSALGNVISALAEGTKSHVPYRDSKMTRILQESLGGNARTTIIICCSPSSFNDQETRSTLMFGQ 325          
BLAST of Kinesin motor domain protein vs. Ensembl Nematostella
Match: EDO39610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9N5])

HSP 1 Score: 119.013 bits (297), Expect = 7.673e-29
Identity = 95/309 (30.74%), Postives = 148/309 (47.90%), Query Frame = 1
Query: 1819 FEFDKVFHPGMSQIELYEEF-RPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILT--EERLRQRDCEYKITACVVEIYNDNCIDVLSGET----NIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENIC---SFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVNLNGQVSLV 2715
            F FD V+    +  +LY E   P+V   ++GYN     YG  + GKTFT+ G  +  SQ G+  R    IL   + + R+R+ EY +    +EIYN+   D+L   T     I+ + D GM    + L S+ +    D   ++++    R V  T +N  SSRSH I +I LQ      GE  C     L L DLAG E   K+     +   +EA  IN SL+A   V  +L       + YR++KLT LL+  L  + K  ++  +     +   T +TLR+ +  + +   K R ++N + + SL+
Sbjct:   52 FTFDGVYGSQCNTEKLYSEIVHPIVDGVLEGYNGTVFAYGQTSCGKTFTMQGSAQPESQVGITPRCCRHILNSMQGKGRRRNREYLLHVSYLEIYNEEIRDLLVKNTRSNLEIKEHPDKGMYV--KGLSSITVDCYEDMAEILEIGSANRSVGSTCMNTDSSRSHSIFIIDLQVNVNKGGEGECVRNGKLNLVDLAGSERQSKSGATGERF--REATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRLLQDSLGGNSKTLMVACISPGSNNYEETLSTLRYAKRAKNI---KNRPRINEDPKDSLI 353          
BLAST of Kinesin motor domain protein vs. Ensembl Medaka
Match: kifc1 (kinesin family member C1 [Source:NCBI gene;Acc:101167717])

HSP 1 Score: 172.94 bits (437), Expect = 7.381e-45
Identity = 120/358 (33.52%), Postives = 180/358 (50.28%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVTDGG-------------NILEFIGSESITLQIAPNER---FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTE-ERLRQRDCEYKITACVVEIYNDNCIDVL-------SGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKA 2676
            RR  +N +QE  GNIRV+CR R +  GG             +I+     ES T ++A  ++   F FD+VF P  SQ E++EE   LV S +DGYNVC   YG   SGKT+T+  G E     G++ RA+  +    ++L  +  E+  TA  VEIYN+   D+L         E  I+    N  E     L    +  E   + L+ V K  R  A+T+ N  SSRSH +  + ++G +        S LCL DLAG E ++K+++Q ++   KE   IN SL+    V  SL  ++ + + YR +KLT+LL+  L  + K  + + +  +  S G T N+LRF  +     +G A
Sbjct:  271 RRRLHNTIQELKGNIRVFCRVRPLVSGGLSKHIQLPASDDKSIVLAKTEESHTGKVADTQKNYNFSFDRVFGPQASQQEIFEEISLLVQSALDGYNVCVFAYGQTGSGKTYTM-EGEEYDDTRGVIPRAVQQVFKAGQKLAAQGWEFTFTASFVEIYNETLRDLLYTGKASKRPEHEIRKMASN--EVTVTNLTYEKVYTEDQVQGLIAVAKRNRSTAQTSQNDRSSRSHSVFQLHIEGVNAGRDVTCKSTLCLVDLAGSERMMKSQSQGDRF--KEMTAINSSLSNLGIVITSLANKESH-IPYRNSKLTYLLQGCLGGNSKTLMFVNISPESDSFGETLNSLRFASKVNDCVIGTA 622          
BLAST of Kinesin motor domain protein vs. Ensembl Medaka
Match: si:ch211-257p13.3 (kinesin-like protein KIFC3 [Source:NCBI gene;Acc:101163027])

HSP 1 Score: 159.844 bits (403), Expect = 1.116e-39
Identity = 116/354 (32.77%), Postives = 174/354 (49.15%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVTDGGNILEFIGSESITLQIAPNER-------------FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLS--GET-NIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQV 2688
            RR  +  + E  GNIRV CR + V       E    +S+ + I PN               FE DKVF P  +Q E+++E  PLV S IDGY+VC   YG   SGKT T+ G  E     G+ QRAL  +  E   R+    Y ++   VEIYN+   D+LS  GE  +I++  D   +     L+ + + +    + ++   +  R    T +N  SSRSH +  I +QG     G      L L DLAG E + K+  +  ++  KEA  INRSL A   V  +LR +  + V +R ++LT+LL+  L    K  +++ V   + ++G T  +L+F +    V LG A R++
Sbjct:  566 RRKYHEQLVELKGNIRVLCRVKPVLKEDQHEE---GQSVVVAIDPNNESSLTVLTKGKGRVFELDKVFQPQATQEEIFQEIEPLVTSSIDGYHVCIFAYGQTGSGKTHTMEGTVENP---GINQRALKHLFHEIEERKDMWSYNVSVSSVEIYNEVLRDLLSKDGEKLDIKINPDGTGQLHVPGLRVIEVNSFQHIKKILATARRNRITFGTQMNQHSSRSHALLCITVQGTDLATGSKTTGKLNLVDLAGSERVWKSGAEGERL--KEAQNINRSLLALGDVIQALRARQTH-VPFRNSRLTYLLQDSLGKGSKTVMVVQVSALESNVGETLCSLKFAQRVCKVELGPAARKI 910          
BLAST of Kinesin motor domain protein vs. Ensembl Medaka
Match: si:dkey-96l17.6 (kinesin-like protein KIN-14E [Source:NCBI gene;Acc:105354761])

HSP 1 Score: 154.066 bits (388), Expect = 1.354e-38
Identity = 113/359 (31.48%), Postives = 180/359 (50.14%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCR-----HVTDGGN-ILEFIGSESITLQIAPNER-FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDV-LSGETNIQLYVDNGMETAYQKLKSV---------PITNEADAE----ALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQV 2688
            R+  YN++++  G IRV+CR R         GG   +E I   S++++     R F+FDKVF    SQ E++++   L+ S IDGYNVC   YG   SGKTFT++ G++     G+M R+   I    R      E+K++A ++E+YND   D+ +S     Q       +T   ++K             T EA +     AL Q     R +A T +N  SSRSHLI +I ++ ++  +G      L L DLAG E   K   + +++  KEA  IN+SL+A   V  +L    P+ V YR +KLT +++  L  + K  +I+ +   + +L  T  +L +    + ++   A+R V
Sbjct:  261 RKKYYNMVEDMKGKIRVFCRLRPMNRNEAGQGGTAFVEKIDDYSVSVETPRGLREFQFDKVFGAEASQDEVFQDTSRLIQSVIDGYNVCIFAYGQTGSGKTFTMV-GDKDQRNPGIMPRSFNAIFDITRENSSKFEFKVSAYMLELYNDRLQDLFISQAAEAQAQTQPSSQTRRVEIKRTRKGVVFAQGAETKEASSAQELYALFQQACANRHIAATKMNVESSRSHLIVVIMVESRNLTNGSISTGKLSLVDLAGSERAAKTGAKDHQL--KEANSINKSLSALGDVISALSADLPH-VPYRNSKLTQVMQDSLGGNAKTLMIVNISPSESNLDETLTSLIYATRVKAIT-NNAQRNV 614          
BLAST of Kinesin motor domain protein vs. Ensembl Medaka
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:101166854])

HSP 1 Score: 153.295 bits (386), Expect = 9.154e-38
Identity = 105/320 (32.81%), Postives = 167/320 (52.19%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVT-------DGGNILEFIGSESITLQIAPNER---FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVL----SGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITV 2592
            R+  +N +    GNIRV+CR R V+       D   +L F   +   L ++   +   FE DK+F P  +Q E+++E + LV S IDG+NVC   YG   SGKT+T+  G EG    G+ QRAL  +  E   +  D +Y+IT  +VEIYN+   D+L    + + +I++  D   +     L    + +  D   + ++    R  A T LN  SSRSH + +I + G +   G      L L DLAG E I K+  + +++  +EA  IN+SL+A   V  +LR +  + V +R ++LT+LL+  L+   K  +++ V
Sbjct:  444 RKKCHNELVRLKGNIRVFCRVRPVSQEEQDSADAKTLLSFDSEDDAVLYLSNKGKTMTFELDKIFPPQATQEEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTM-EGVEGDP--GINQRALRLLFDEVTEKAPDWDYRITVSLVEIYNETLRDLLRENPTDKLDIKMNPDGSGQLYVPGLTERTVQSPEDINRVFELGHANRATACTNLNEHSSRSHALLIITVSGFNGATGTRTQGRLNLVDLAGSERIGKSGAEGSRL--REAQCINKSLSALGDVISALRGKHAH-VPFRNSRLTYLLQDSLSGDSKTLMMVQV 757          
BLAST of Kinesin motor domain protein vs. Ensembl Medaka
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:101166854])

HSP 1 Score: 153.295 bits (386), Expect = 1.174e-37
Identity = 105/320 (32.81%), Postives = 167/320 (52.19%), Query Frame = 1
Query: 1675 RRHAYNLMQEQMGNIRVYCRCRHVT-------DGGNILEFIGSESITLQIAPNER---FEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVL----SGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITV 2592
            R+  +N +    GNIRV+CR R V+       D   +L F   +   L ++   +   FE DK+F P  +Q E+++E + LV S IDG+NVC   YG   SGKT+T+  G EG    G+ QRAL  +  E   +  D +Y+IT  +VEIYN+   D+L    + + +I++  D   +     L    + +  D   + ++    R  A T LN  SSRSH + +I + G +   G      L L DLAG E I K+  + +++  +EA  IN+SL+A   V  +LR +  + V +R ++LT+LL+  L+   K  +++ V
Sbjct:  550 RKKCHNELVRLKGNIRVFCRVRPVSQEEQDSADAKTLLSFDSEDDAVLYLSNKGKTMTFELDKIFPPQATQEEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTM-EGVEGDP--GINQRALRLLFDEVTEKAPDWDYRITVSLVEIYNETLRDLLRENPTDKLDIKMNPDGSGQLYVPGLTERTVQSPEDINRVFELGHANRATACTNLNEHSSRSHALLIITVSGFNGATGTRTQGRLNLVDLAGSERIGKSGAEGSRL--REAQCINKSLSALGDVISALRGKHAH-VPFRNSRLTYLLQDSLSGDSKTLMMVQV 863          
BLAST of Kinesin motor domain protein vs. Planmine SMEST
Match: SMESG000077785.1 (SMESG000077785.1)

HSP 1 Score: 1536.16 bits (3976), Expect = 0.000e+0
Identity = 790/790 (100.00%), Postives = 790/790 (100.00%), Query Frame = 1
Query:   49 MNDDWIEDDDAIIKNKPLNSLPPTNHCETRISSPNLISKEVEKYRIVQNQFHNKKLPISFISPKDWQKYLNFTKSVTNKLNCETSILNSRGKNGRILRLLNSFHKLYEEYSELFISSDQCVLNYGDNRKISQLNICNTLSNIHNESIPDSYDSVDESFLDVGVQTTITMDQIKLSIAHTCVHRESCTEKCEKLSLTSDLLVPWGVKNILNPAKRFSRKLRLFTHSNGKHKNTKVFDXXXXXXXXXXXXXXXXXHQQSIVCHSLLLDNYENKYHLPKIKYLQIPLAVELLLPKIQTKIENILNDCPFLCDPLEVAAELRHFGYDQNACTKYFKITKSLRSVIEEIMPVSNTESYSYQTATLQTPNRNDSIKSVKSQIISNDLINETPNAIKDYNSNVNHYMVENLQITTXXXXXXXXXXXXECPPFSQNNTPVNKPGTLVTIDNCAQTNIIHLCMENKNIETIFNKIKTYFTVVRQLHAEAKDEIEYLHKQLICVFTALKNHMALLVNQNNEKSFSDEQKSKMVTLSRQVXXXXXXXXXXXXXRRHAYNLMQEQMGNIRVYCRCRHVTDGGNILEFIGSESITLQIAPNERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNK 2418
            MNDDWIEDDDAIIKNKPLNSLPPTNHCETRISSPNLISKEVEKYRIVQNQFHNKKLPISFISPKDWQKYLNFTKSVTNKLNCETSILNSRGKNGRILRLLNSFHKLYEEYSELFISSDQCVLNYGDNRKISQLNICNTLSNIHNESIPDSYDSVDESFLDVGVQTTITMDQIKLSIAHTCVHRESCTEKCEKLSLTSDLLVPWGVKNILNPAKRFSRKLRLFTHSNGKHKNTKVFDKIEKLENNLVLEVIEEVHQQSIVCHSLLLDNYENKYHLPKIKYLQIPLAVELLLPKIQTKIENILNDCPFLCDPLEVAAELRHFGYDQNACTKYFKITKSLRSVIEEIMPVSNTESYSYQTATLQTPNRNDSIKSVKSQIISNDLINETPNAIKDYNSNVNHYMVENLQITTDIPNNIIPDSINECPPFSQNNTPVNKPGTLVTIDNCAQTNIIHLCMENKNIETIFNKIKTYFTVVRQLHAEAKDEIEYLHKQLICVFTALKNHMALLVNQNNEKSFSDEQKSKMVTLSRQVEELKLKLKKEEKKRRHAYNLMQEQMGNIRVYCRCRHVTDGGNILEFIGSESITLQIAPNERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNK
Sbjct:    1 MNDDWIEDDDAIIKNKPLNSLPPTNHCETRISSPNLISKEVEKYRIVQNQFHNKKLPISFISPKDWQKYLNFTKSVTNKLNCETSILNSRGKNGRILRLLNSFHKLYEEYSELFISSDQCVLNYGDNRKISQLNICNTLSNIHNESIPDSYDSVDESFLDVGVQTTITMDQIKLSIAHTCVHRESCTEKCEKLSLTSDLLVPWGVKNILNPAKRFSRKLRLFTHSNGKHKNTKVFDKIEKLENNLVLEVIEEVHQQSIVCHSLLLDNYENKYHLPKIKYLQIPLAVELLLPKIQTKIENILNDCPFLCDPLEVAAELRHFGYDQNACTKYFKITKSLRSVIEEIMPVSNTESYSYQTATLQTPNRNDSIKSVKSQIISNDLINETPNAIKDYNSNVNHYMVENLQITTDIPNNIIPDSINECPPFSQNNTPVNKPGTLVTIDNCAQTNIIHLCMENKNIETIFNKIKTYFTVVRQLHAEAKDEIEYLHKQLICVFTALKNHMALLVNQNNEKSFSDEQKSKMVTLSRQVEELKLKLKKEEKKRRHAYNLMQEQMGNIRVYCRCRHVTDGGNILEFIGSESITLQIAPNERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNK 790          
BLAST of Kinesin motor domain protein vs. Planmine SMEST
Match: SMESG000047227.1 (SMESG000047227.1)

HSP 1 Score: 648.277 bits (1671), Expect = 0.000e+0
Identity = 347/623 (55.70%), Postives = 455/623 (73.03%), Query Frame = 1
Query:  886 LQIPLAVELLLPKIQTKIENILNDCPFLCDPLEVAAELRHFGYDQNACTKYFKITKSLRSVIEEIMPVSNTESYSYQTATLQTPNRN------DSIKSVKS---QIISNDLINETPNAIKD-----YNSNVNHYMV--ENLQITTXXXXXXXXXXXXECPPFSQNNTPVNKPGTLVTIDNCAQTNIIHLCMENKNIETIFNKIKTYFTVVRQLHAEAKDEIEYLHKQLICVFTALKNHMALLVNQNNEKSFSDEQKSKMVTLSRQVXXXXXXXXXXXXXRRHAYNLMQEQMGNIRVYCRCRHVTDGGNILEFIGSESITLQIAPNERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEG-SSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVNLNGQ 2703
            + +P+ ++++LPK+Q KI  I ++C FL +PLE+ AELRHF Y++N+   +FK T+ LRS+++E   ++NT     +   L+   RN      D+  S  +   +  SN   N+  N+ KD      + ++N++ +  EN+  +  I              +S++    N        D+ +QT  I    +  N+      +      ++Q   E+K ++ +L +Q+  +  ALKN++ L+++ +++   SD+ +++++ L+RQV+ELKLKLK+EE KRR  YNLMQEQMGN+RVYCRCR +    N+LE  G+ESI L I P ERF+FDKVF   MSQ ++YEEFRPLVMSFIDG+NVCFITYG EASGKT+TLIGG+EG + ++G+MQRAL+T+L E+ LR RD +Y+ITAC+VEIYNDNCID+LSGE+ IQLYVD GME+ YQKLKSVPI NE D + L+Q+C+ KRK+A+TALNPASSRSHLITLIRLQGKSKIHGENI SF+CLCDLAGFEDIIKAETQ+NK LSKEAGYIN+SLTAFNRVFVSLR+QDPNTV YR+TKLTHLLKPFLTNSGKCAL+IT+R D+RSL STQNTLRFGRETRGVSLGKARRQVN N Q
Sbjct:  429 VDLPIIMDMMLPKMQVKIRQIFDECSFLNNPLEIMAELRHFNYNKNSTIDHFKNTRQLRSIMKEF--INNTIDSRCRLVALRCLYRNYHNNDKDTFFSCSNCGKEFNSNSHFNKF-NSAKDKGIFITHDDLNYFKLSDENVDFSNPIQMAAYETVNM----YSKSTCIENGVFENSNQDSGSQTQQIDSKTDPDNVRKFAESVIKNVDFLKQSIKESKIQMIHLRRQVSSLLKALKNNIDLIISLSSKHFMSDQHRNRIIQLARQVDELKLKLKEEETKRRIVYNLMQEQMGNVRVYCRCRDIPHNENVLEIQGNESIVLPILPQERFDFDKVFPSNMSQNDIYEEFRPLVMSFIDGFNVCFITYGSEASGKTYTLIGGSEGITEEYGIMQRALSTLLIEQSLRSRDWDYQITACLVEIYNDNCIDILSGESGIQLYVDCGMESVYQKLKSVPIKNENDTDILLQLCRSKRKIAKTALNPASSRSHLITLIRLQGKSKIHGENIRSFMCLCDLAGFEDIIKAETQSNKTLSKEAGYINKSLTAFNRVFVSLRRQDPNTVCYRDTKLTHLLKPFLTNSGKCALVITIRTDRRSLSSTQNTLRFGRETRGVSLGKARRQVNTNHQ 1044          
BLAST of Kinesin motor domain protein vs. Planmine SMEST
Match: SMESG000069914.1 (SMESG000069914.1)

HSP 1 Score: 638.647 bits (1646), Expect = 0.000e+0
Identity = 311/412 (75.49%), Postives = 366/412 (88.83%), Query Frame = 1
Query: 1462 VVRQLHAEAKDEIEYLHKQLICVFTALKNHMALLVNQNNEKSFSDEQKSKMVTLSRQVXXXXXXXXXXXXXRRHAYNLMQEQMGNIRVYCRCRHVTDGGNILEFIGSESITLQIAPNERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVNLN 2697
            V +++ +   ++++YL +QL  VF +L++HM +++NQ +E+  +++QK K++  SRQVEELKLKLK EE KRR  YN MQEQMGNIRV CRCRH++D  NIL++ G +++ L  + NERFEFDKVF PG+SQ +LYEEFRPLVMSFIDGYNVCFITYGGEASGKT+TLIG N  S+Q G+MQR+L TILTEERLRQRD EYKI+ACVVEIYNDNC D+LSGE+ +Q+YVD+GMETA+QKLKSVPITNEADA+ L+QVC VKRKVARTALNPASSRSHLI LIRLQG SKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSL++QDPNTV YR+TKLTHLLKPFLTNSGKCALI+TVRNDKRS+GST NTLRFG+ETRGV+LGKARRQV+++
Sbjct:  428 VAKEIQSNTLNDVKYLSRQLNKVFDSLRSHMLVVINQCSERLVTNDQKIKLLAFSRQVEELKLKLKMEENKRRQVYNRMQEQMGNIRVCCRCRHLSDEENILDYAGEDTLILTTSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHIS 839          

HSP 2 Score: 105.145 bits (261), Expect = 7.836e-23
Identity = 94/319 (29.47%), Postives = 148/319 (46.39%), Query Frame = 1
Query:  157 ISKEVEKYRIVQNQFHNKKLPISFISPKDWQKYLNFTKSVTNKLNCETSIL-----NSRGKNGRILRLLNSFHKLYEEYSELF-ISSDQCVLNYGDN----RKISQLNICNTLSNIHNESI----PDSYDSVDESFLDVGVQTTITMDQIKLSIAHTCVHRESCTEKCEKLSLTSDLLVPWGVKNILNPAKRFSRKLRL--FTHSNGKHKNTKVFDXXXXXXXXXXXXXXXXXHQQSIVCH-SLLLDNYENKYHLPKIKYLQIPLAVELLLPKIQTKIENILNDCPFLCDPLEVAAELRHFGYDQNACTKYFKITKSLR 1062
             + E++K       F++KK P+ FI+ +D + Y+ F   ++  +N E  +          KN + +RLL SF+KLY+EYSEL+ I S+      GDN    ++  +        N  N S+     ++ +  D   L      T   ++I +                       +  + +G+K +  P  +F + L+   F+ S     N +        E N+ +   E  + + +V   SL+  +   K+   KI     P+A+ELLLPKIQ  I+ IL  CPFLCDPLEV AELR+  YDQ  C +YFK +K LR
Sbjct:   42 FTDEIQKKVDSNFHFYSKKSPVHFIAAQDCKTYMQFMHDIS-LINYENDVFIENLWKENEKNDQTMRLLFSFYKLYQEYSELYEILSNYATYYSGDNVQKFQEFPEKTAILVKENGENVSLKAETSNAENQTDHQLLKCNFVLTPIENEITI--------------------FPDNRSLIYGLKTLFKPPFKFGKCLKTGKFSKSTENFLNFRSLLYDRVAEKNIEVFEFEHYNCKKVVHKISLIKSDTSKKFQTIKI-----PIALELLLPKIQNDIDTILGQCPFLCDPLEVIAELRNCNYDQIKCIQYFKKSKFLR 334          
BLAST of Kinesin motor domain protein vs. Planmine SMEST
Match: SMESG000019919.1 (SMESG000019919.1)

HSP 1 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 367/890 (41.24%), Postives = 519/890 (58.31%), Query Frame = 1
Query:   82 IIKNKPLNSLPPTNHCETRIS-----SPNLISKEVEKYRIVQNQFHNKKLPISFISPKDWQKYLNFTKSVTNKLNCETSILNSRGKNGRILRLLNSFHKLYEEYSELFISSDQCVLNYGDNRKISQLNICNTLSNIHNESIPDSYDSVDESFLDVGVQTTITMDQIKLSIAHTCVHRESCTEKCEKLSLTSDLLVPWGVKNILNPAKRFSRKLRLFTHSNGKHKNTKVFDXXXXXXXXXXXXXXXXXHQQSIVCHSLLLDNYENKYHLPKIKYLQIPLAVELLLPKIQTKIENILNDCPFLCDPLEVAAELRHFGYDQNACTKYFKITKSLRSVIEEIMPVSNTESYSYQTATLQTPNRNDSIKSVKSQIISNDLINETPNAIKDYNSNVNHYMVENLQITTXXXXXXXXXXXXECPPFSQNNTPVNKPGTLVTIDNCAQTNIIHLCMENKNIETI--FNKIKTYFTVVRQL----HAEAKDEIEYLHKQLICVFTALKNHMALLVNQNNEKSFSDEQKSKMVTLSRQVXXXXXXXXXXXXXRRHAYNLMQEQMGNIRVYCRCRHVTDGGNILEFIGSESITLQIAPNERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGG-------NEGSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVNLN 2697
            I+ N  +N+   +N C T+ S     +PN   K   K+    +++  +KLPI+F+S KDW  YL+FT    N         + +  N R+ RLL++F KLY+EYS +  +     +NY         N  N  + I+NE+  +   + DE   D  +   +   +      H          KC+ LS  +  L  W +K  L+  K  S        SN  H   K+            +E+      Q ++ H +    ++   H PKIK++Q+P+A+ELL+PKIQ KI+ I+  C FL DPLEVAAELR F Y+ + CT +F+ TK  R ++EE +P    +    +   LQ P+  +  KS   ++       ET N           Y++ N   +          S       S    P+NK  +L+  +    T++    ++ K I+ +    K+K   + ++QL     A+ K +I+    ++  V    K+ +            +DEQ+ +++ L +Q +ELK+KLK EEKKR+  YN+MQ+Q+GN+RVYCRCR      ++L+   ++++ +Q    E ++FDKVF P  SQ  +YEEF+PL+MSFIDG+NVCFITYGGEASGKT+TL+G         +     G+M+RAL  +L E+  R+RD EY++ ACVVEIYND  ID+L+G+T I L +D G+E     LKSVP+  +AD EAL++VCK+KR+V +TALNP SSRSHLIT+I L G+SKIHGE I SFL +CDLAGFEDI+KAET  N  LSKEAGYIN+SLTAFNRVF SLR+QDPNTVSYR+TKLT+LLKPFLTN GKC LI+TVR DK S+ STQ+TLRFGRE+RGV+LGKA+RQ NL+
Sbjct:   18 ILTNTCINNSKLSNTCSTKYSRELNRNPNYEPKPNYKFNYSSSRYI-RKLPINFVSSKDWSFYLHFTNKFNNP--------HKKKPNNRVYRLLSAFLKLYQEYSYVCDNILPSFMNYP--------NEANMFTKINNENNKNHVYNFDEYPQDADMSRLLYPPKCSNIHDHVVCPNVMIENKCQVLS-ENRTLKRWFLKK-LHRVKTNS--------SNSTHPYDKI-----CRHQYETIEIFSNEKLQRVISHRINFTGFDAMGH-PKIKWIQVPIALELLIPKIQHKIQRIMMTCNFLYDPLEVAAELRFFNYNVDMCTSHFQRTKKFRDILEEFLP----QKSQLKELELQ-PHLWEKFKSFLDKM-------ETENG---------GYLINN-DASFSTSKISNNKSNKNTGSNSYPEIPMNKGASLMN-EKERDTSV----LQAKLIKVVCAIEKLKLTKSEIQQLVMRNQAKYKKQIDEYSLKITRVVEYFKDFL-----------MTDEQRGRVIHLLKQNDELKIKLKDEEKKRKTIYNMMQDQLGNVRVYCRCRAFEKNHSVLDIKTNDTVMMQTGFFEEYKFDKVFEPFRSQAAIYEEFQPLIMSFIDGFNVCFITYGGEASGKTYTLLGATLSSPSCKDNDKHDGVMKRALKEVLAEQSARKRDWEYRLNACVVEIYNDTFIDLLTGDTGIHLPIDRGLEKVQASLKSVPVNCDADIEALIKVCKLKRRVGKTALNPQSSRSHLITMIHLTGRSKIHGETISSFLAMCDLAGFEDILKAETHNNLTLSKEAGYINKSLTAFNRVFTSLRRQDPNTVSYRDTKLTYLLKPFLTNQGKCVLIVTVRTDKSSISSTQSTLRFGRESRGVALGKAKRQANLD 836          
BLAST of Kinesin motor domain protein vs. Planmine SMEST
Match: SMESG000019241.1 (SMESG000019241.1)

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 320/624 (51.28%), Postives = 420/624 (67.31%), Query Frame = 1
Query:  886 LQIPLAVELLLPKIQTKIENILNDCPFLCDPLEVAAELRHFGYDQNACTKYFKITKSLRSVIEEIMPVSNTESYSYQTATLQTPNRN------DSIKSVKS---QIISNDLINETPNAIKD-----YNSNVNHYMV--ENLQITTXXXXXXXXXXXXECPPFSQNNTPVNKPGTLVTIDNCAQTNIIHLCMENKNIETIFNKIKTYFTVVRQLHAEAKDEIEYLHKQLICVFTALKNHMALLVNQNNEKSFSDEQKSKMVTLSRQVXXXXXXXXXXXXXRRHAYNLMQEQMGNIRVYCRCRHVTDGGNILEFIGSESITLQIAPNERFEFDKVFHPGMSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNE--GSSQHGLMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETNIQLYVDNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLITLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRNDKRSLGSTQNTLRFGRETRGVSLGKARRQVNLNGQ 2703
            + +P+ ++++LPK+Q KI  I ++C FL +PLE+ AELRHF Y++N+   +FK T+ LRS+++E   ++NT     +   L+   RN      D+  S  +   +  SN   N+  N++KD      + ++N++ +  EN+  +  I              +S++    N        D+ +QT  I    +  N+      +      ++Q   E+K ++ +L +Q+  +  ALKN++ L+++ +++   SD+ +++++ L+RQV+ELKLKLK+EE KRR  YNLMQEQMGN+RVYCRCR +    N+LE  G+ESI L I P ERF+FDKVF   MSQ ++YEEFRPLVMSFIDG+NVCFITYG EASGKT+TLIGG+E    S+ GL   +L                                   GE+ IQLYVD GME+ YQKLKSVPI NE D + L+Q+C+ KRK+A+TALNPASSRSHLITLIRLQGKSKIHGENI SF+CLCDLAGFEDIIKAETQ+NK LSKEAGYIN+SLTAFNRVFVSLR+QDPNTV YR+TKLTHLLKPFLTNSGKCAL+IT+R D+RSL STQNTLRFGRETRGVSLGKARRQVN N Q
Sbjct:  429 VDLPIIMDMMLPKMQVKIRQIFDECSFLNNPLEIMAELRHFNYNKNSTIDHFKNTRQLRSIMKEF--INNTIDSRCRLVALRCLYRNYHNNDKDTFFSCSNCGKEFNSNSHFNKF-NSVKDKGIFITHDDLNYFKLSDENVDFSNPIQMAAYETVNM----YSKSTCIENGIFENSNQDSGSQTQQIDSKTDPDNVRKFAESVIKNVDFLKQSIKESKIQMIHLRRQVSSLLKALKNNIDLIISLSSKHFMSDQHRNRIIQLARQVDELKLKLKEEETKRRIVYNLMQEQMGNVRVYCRCRDIPHNENVLEIQGNESIVLPILPQERFDFDKVFPSNMSQNDIYEEFRPLVMSFIDGFNVCFITYGSEASGKTYTLIGGSEVIAQSRLGLSNHSLP----------------------------------GESGIQLYVDCGMESVYQKLKSVPIKNENDTDILLQLCRSKRKIAKTALNPASSRSHLITLIRLQGKSKIHGENIRSFMCLCDLAGFEDIIKAETQSNKTLSKEAGYINKSLTAFNRVFVSLRRQDPNTVCYRDTKLTHLLKPFLTNSGKCALVITIRTDRRSLSSTQNTLRFGRETRGVSLGKARRQVNTNHQ 1011          
The following BLAST results are available for this feature:
BLAST of Kinesin motor domain protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIFC12.147e-4233.24kinesin family member C1 [Source:HGNC Symbol;Acc:H... [more]
KIFC12.147e-4233.24kinesin family member C1 [Source:HGNC Symbol;Acc:H... [more]
KIFC12.147e-4233.24kinesin family member C1 [Source:HGNC Symbol;Acc:H... [more]
KIFC39.188e-4031.75kinesin family member C3 [Source:HGNC Symbol;Acc:H... [more]
KIFC39.188e-4031.75kinesin family member C3 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Kinesin motor domain protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klp-171.298e-3832.72Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
klp-31.639e-3028.11Kinesin-like protein klp-3 [Source:UniProtKB/Swis... [more]
klp-163.894e-3028.61Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
klp-163.894e-3028.61Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
klp-151.170e-2828.33Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Kinesin motor domain protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncd4.786e-3831.40gene:FBgn0002924 transcript:FBtr0344976[more]
ncd4.786e-3831.40gene:FBgn0002924 transcript:FBtr0085534[more]
Klp61F3.253e-3430.14gene:FBgn0004378 transcript:FBtr0072733[more]
Khc3.013e-2528.92gene:FBgn0001308 transcript:FBtr0087184[more]
Klp64D7.945e-2527.11gene:FBgn0004380 transcript:FBtr0077157[more]
back to top
BLAST of Kinesin motor domain protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kifc11.115e-4133.06kinesin family member C1 [Source:ZFIN;Acc:ZDB-GENE... [more]
kifc11.115e-4133.06kinesin family member C1 [Source:ZFIN;Acc:ZDB-GENE... [more]
si:ch211-257p13.31.622e-4032.22si:ch211-257p13.3 [Source:ZFIN;Acc:ZDB-GENE-110914... [more]
si:ch211-257p13.32.263e-4032.22si:ch211-257p13.3 [Source:ZFIN;Acc:ZDB-GENE-110914... [more]
kifc39.006e-4032.02kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Kinesin motor domain protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kifc31.439e-4533.05kinesin family member C3 [Source:NCBI gene;Acc:548... [more]
kifc31.201e-4333.70kinesin family member C3 [Source:NCBI gene;Acc:548... [more]
kifc31.589e-4333.05kinesin family member C3 [Source:NCBI gene;Acc:548... [more]
kifc32.017e-4333.05kinesin family member C3 [Source:NCBI gene;Acc:548... [more]
kifc32.521e-4333.05kinesin family member C3 [Source:NCBI gene;Acc:548... [more]
back to top
BLAST of Kinesin motor domain protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kifc12.751e-4132.23kinesin family member C1 [Source:MGI Symbol;Acc:MG... [more]
Kifc15.307e-4132.23kinesin family member C1 [Source:MGI Symbol;Acc:MG... [more]
Kifc31.160e-4032.42kinesin family member C3 [Source:MGI Symbol;Acc:MG... [more]
Kifc31.277e-4032.42kinesin family member C3 [Source:MGI Symbol;Acc:MG... [more]
Kifc5b1.365e-4032.23kinesin family member C5B [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Kinesin motor domain protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O81635|KN14G_ARATH1.390e-5036.18Kinesin-like protein KIN-14G OS=Arabidopsis thalia... [more]
sp|F4HZF0|KN14H_ARATH9.968e-4936.42Kinesin-like protein KIN-14H OS=Arabidopsis thalia... [more]
sp|F4IAR2|KN14O_ARATH1.109e-4834.69Kinesin-like protein KIN-14O OS=Arabidopsis thalia... [more]
sp|Q0WN69|KN14P_ARATH4.840e-4833.62Kinesin-like protein KIN-14P OS=Arabidopsis thalia... [more]
sp|F4IJK6|KN14R_ARATH1.842e-4633.05Kinesin-like protein KIN-14R OS=Arabidopsis thalia... [more]
back to top
BLAST of Kinesin motor domain protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183T9I39.058e-12555.85Kinesin motor domain-containing protein OS=Schisto... [more]
H2KNY91.124e-12052.75Kinesin family member C2/C3 OS=Clonorchis sinensis... [more]
A0A5J4P1111.258e-12052.24Kinesin family member C2/C3 OS=Paragonimus westerm... [more]
A0A1S8XAP81.299e-11752.75Kinesin motor domain protein OS=Opisthorchis viver... [more]
A0A074Z3N12.697e-11752.75Kinesin motor domain-containing protein OS=Opistho... [more]
back to top
BLAST of Kinesin motor domain protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kifc32.121e-4131.70kinesin family member C3 [Source:NCBI gene;Acc:103... [more]
si:ch211-257p13.33.822e-4131.84kinesin-like protein KIFC3 [Source:NCBI gene;Acc:1... [more]
kifc33.945e-4131.70kinesin family member C3 [Source:NCBI gene;Acc:103... [more]
si:ch211-257p13.34.137e-4131.84kinesin-like protein KIFC3 [Source:NCBI gene;Acc:1... [more]
kifc39.365e-4131.70kinesin family member C3 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Kinesin motor domain protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010492.16.010e-5135.67pep scaffold:Pmarinus_7.0:GL478879:14589:34633:-1 ... [more]
kifc32.122e-4732.95kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE... [more]
kif114.969e-2928.74kinesin family member 11 [Source:ZFIN;Acc:ZDB-GENE... [more]
kif153.584e-2830.66kinesin family member 15 [Source:ZFIN;Acc:ZDB-GENE... [more]
kif63.443e-2729.90kinesin family member 6 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Kinesin motor domain protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KAR36.665e-3630.56Minus-end-directed microtubule motor; functions in... [more]
KIP29.417e-2729.83Kinesin-related motor protein involved in mitotic ... [more]
KIP11.659e-2228.53Kinesin-related motor protein; required for mitoti... [more]
KIP39.593e-2227.69Kinesin-related antiparallel sliding motor protein... [more]
CIN87.101e-1429.88Kinesin motor protein; involved in mitotic spindle... [more]
back to top
BLAST of Kinesin motor domain protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO459501.578e-5536.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316063.698e-4733.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349612.592e-4231.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493522.148e-2929.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO396107.673e-2930.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinesin motor domain protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kifc17.381e-4533.52kinesin family member C1 [Source:NCBI gene;Acc:101... [more]
si:ch211-257p13.31.116e-3932.77kinesin-like protein KIFC3 [Source:NCBI gene;Acc:1... [more]
si:dkey-96l17.61.354e-3831.48kinesin-like protein KIN-14E [Source:NCBI gene;Acc... [more]
kifc39.154e-3832.81kinesin family member C3 [Source:NCBI gene;Acc:101... [more]
kifc31.174e-3732.81kinesin family member C3 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Kinesin motor domain protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077785.10.000e+0100.00SMESG000077785.1[more]
SMESG000047227.10.000e+055.70SMESG000047227.1[more]
SMESG000069914.17.836e-2375.49SMESG000069914.1[more]
SMESG000019919.10.000e+041.24SMESG000019919.1[more]
SMESG000019241.10.000e+051.28SMESG000019241.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001877 ID=SMED30001877|Name=Kinesin motor domain protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2755bp
AATATATTTTTTATTTTTCCGATAAATTAGTTATTTTAATAAAATTTAAT
GAATGACGATTGGATCGAAGATGATGATGCTATTATTAAAAATAAACCTT
TAAACAGCCTTCCGCCTACAAATCATTGTGAAACTCGAATTTCTTCTCCA
AATTTAATTTCAAAAGAAGTTGAGAAGTATAGAATAGTTCAAAATCAGTT
CCATAATAAAAAGCTACCTATAAGTTTTATTTCACCAAAAGACTGGCAGA
AGTATTTAAATTTTACTAAATCAGTTACAAATAAGTTGAATTGTGAAACT
TCAATTTTAAATTCCAGAGGCAAAAATGGTCGAATTCTTCGTTTGTTAAA
TTCATTTCATAAATTATATGAAGAGTACTCAGAGCTTTTTATAAGTTCTG
ATCAATGTGTCTTAAATTATGGTGATAATAGAAAAATTTCCCAGCTAAAT
ATTTGCAATACTTTAAGTAATATTCATAATGAATCTATACCCGATTCTTA
TGATTCAGTTGACGAAAGCTTTTTAGATGTTGGCGTCCAAACAACTATAA
CTATGGACCAAATCAAGCTTTCGATTGCTCATACGTGTGTACATAGGGAG
TCTTGTACTGAAAAGTGTGAAAAGTTATCATTGACTTCTGATCTACTGGT
ACCATGGGGCGTGAAAAATATTTTAAATCCAGCTAAACGATTTAGTCGTA
AATTAAGGCTATTTACTCATAGTAATGGAAAGCATAAAAACACAAAAGTA
TTTGATAAAATAGAAAAATTGGAAAACAATCTTGTGCTAGAAGTGATTGA
AGAAGTTCATCAACAGTCTATTGTGTGTCATAGTCTTTTGTTAGATAATT
ATGAAAATAAATATCATCTTCCTAAAATCAAATACCTTCAGATACCTTTG
GCAGTTGAATTATTATTACCGAAAATCCAAACAAAAATAGAAAATATTCT
TAACGATTGTCCATTTCTTTGCGATCCATTAGAAGTCGCTGCTGAATTAC
GACATTTTGGATATGATCAAAATGCTTGCACAAAATATTTTAAAATTACT
AAATCTTTACGTTCAGTCATTGAAGAAATAATGCCTGTCAGCAATACTGA
GAGTTATAGTTACCAAACCGCAACTTTGCAAACACCCAATAGAAATGATT
CTATCAAGTCAGTAAAAAGTCAAATTATTTCCAACGATCTGATTAACGAG
ACCCCTAACGCAATTAAAGATTATAATTCAAATGTTAACCATTATATGGT
TGAAAATTTACAAATAACAACAGATATTCCCAATAACATAATACCAGATT
CAATAAACGAATGCCCACCGTTTTCTCAAAATAATACTCCTGTAAATAAA
CCTGGAACTTTGGTAACTATTGATAATTGTGCTCAGACGAATATCATTCA
TTTATGTATGGAAAATAAAAATATCGAGACAATTTTCAACAAAATAAAAA
CTTATTTCACAGTTGTTCGACAGCTTCATGCTGAAGCTAAAGATGAAATC
GAATATTTGCATAAGCAATTAATCTGCGTTTTTACTGCTCTTAAAAATCA
TATGGCATTATTAGTCAATCAAAATAATGAAAAATCTTTCTCAGATGAAC
AGAAAAGTAAAATGGTGACTCTATCCAGGCAAGTCGAAGAACTAAAATTG
AAATTGAAAAAAGAGGAAAAAAAGCGTAGACACGCATATAATTTAATGCA
AGAACAAATGGGAAATATTCGAGTTTATTGTCGTTGTCGACATGTGACTG
ATGGGGGAAATATTTTAGAATTTATTGGAAGTGAAAGCATTACGCTACAA
ATCGCCCCTAATGAAAGGTTTGAGTTTGATAAAGTTTTTCATCCTGGAAT
GTCTCAAATAGAATTATATGAAGAATTCAGACCATTGGTAATGTCTTTTA
TAGATGGATACAATGTATGCTTTATTACGTATGGCGGAGAGGCGAGTGGT
AAAACATTTACACTAATTGGTGGCAATGAGGGATCTAGTCAACATGGATT
AATGCAAAGAGCTTTAACGACCATTTTAACAGAAGAACGATTGCGCCAAA
GAGATTGCGAATATAAAATTACAGCATGTGTTGTAGAAATATATAATGAT
AACTGCATAGACGTTTTATCTGGAGAAACTAATATCCAACTATATGTTGA
TAATGGAATGGAAACAGCTTATCAGAAGTTAAAAAGTGTTCCAATTACAA
ATGAAGCAGACGCGGAAGCTTTAATGCAAGTTTGTAAAGTTAAACGTAAG
GTAGCAAGAACTGCCTTAAACCCAGCCTCTTCTCGATCTCATTTAATAAC
CCTAATTCGACTGCAAGGAAAAAGTAAAATCCACGGAGAAAATATCTGCA
GTTTTCTTTGTTTATGTGACTTGGCTGGATTTGAAGATATAATCAAAGCA
GAAACTCAAACAAATAAGGTACTTAGTAAAGAAGCTGGTTATATAAATCG
CTCATTGACGGCTTTTAATAGAGTTTTTGTCAGTCTTAGAAAACAGGATC
CGAATACCGTGTCATACCGAGAGACAAAATTGACTCATTTGCTTAAACCT
TTTCTAACAAACTCAGGAAAATGTGCTTTAATAATCACAGTTCGAAATGA
CAAACGAAGTTTAGGTTCTACTCAGAATACTTTAAGATTTGGAAGAGAAA
CAAGAGGAGTTTCTCTTGGGAAAGCTCGTCGACAAGTGAACCTAAATGGT
CAAGTTTCTCTAGTGTGAATTTAAAAAAATATATAATTTTATTCTATTAA
AAAAA
back to top

protein sequence of SMED30001877-orf-1

>SMED30001877-orf-1 ID=SMED30001877-orf-1|Name=SMED30001877-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=890bp
MNDDWIEDDDAIIKNKPLNSLPPTNHCETRISSPNLISKEVEKYRIVQNQ
FHNKKLPISFISPKDWQKYLNFTKSVTNKLNCETSILNSRGKNGRILRLL
NSFHKLYEEYSELFISSDQCVLNYGDNRKISQLNICNTLSNIHNESIPDS
YDSVDESFLDVGVQTTITMDQIKLSIAHTCVHRESCTEKCEKLSLTSDLL
VPWGVKNILNPAKRFSRKLRLFTHSNGKHKNTKVFDKIEKLENNLVLEVI
EEVHQQSIVCHSLLLDNYENKYHLPKIKYLQIPLAVELLLPKIQTKIENI
LNDCPFLCDPLEVAAELRHFGYDQNACTKYFKITKSLRSVIEEIMPVSNT
ESYSYQTATLQTPNRNDSIKSVKSQIISNDLINETPNAIKDYNSNVNHYM
VENLQITTDIPNNIIPDSINECPPFSQNNTPVNKPGTLVTIDNCAQTNII
HLCMENKNIETIFNKIKTYFTVVRQLHAEAKDEIEYLHKQLICVFTALKN
HMALLVNQNNEKSFSDEQKSKMVTLSRQVEELKLKLKKEEKKRRHAYNLM
QEQMGNIRVYCRCRHVTDGGNILEFIGSESITLQIAPNERFEFDKVFHPG
MSQIELYEEFRPLVMSFIDGYNVCFITYGGEASGKTFTLIGGNEGSSQHG
LMQRALTTILTEERLRQRDCEYKITACVVEIYNDNCIDVLSGETNIQLYV
DNGMETAYQKLKSVPITNEADAEALMQVCKVKRKVARTALNPASSRSHLI
TLIRLQGKSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYIN
RSLTAFNRVFVSLRKQDPNTVSYRETKLTHLLKPFLTNSGKCALIITVRN
DKRSLGSTQNTLRFGRETRGVSLGKARRQVNLNGQVSLV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008569ATP-dependent microtubule motor activity, minus-end-directed
GO:0008017microtubule binding
GO:0003777microtubule motor activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003774motor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR036961Kinesin_motor_dom_sf
IPR027640Kinesin-like_fam
IPR001752Kinesin_motor_dom
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 515..549
NoneNo IPR availablePANTHERPTHR24115:SF588KINESIN-LIKE PROTEIN KLP-3coord: 510..876
IPR001752Kinesin motor domainPRINTSPR00380KINESINHEAVYcoord: 620..641
score: 49.13
coord: 821..842
score: 38.67
coord: 769..787
score: 38.86
coord: 738..755
score: 48.75
IPR001752Kinesin motor domainSMARTSM00129kinesin_4coord: 554..879
e-value: 2.7E-48
score: 176.4
IPR001752Kinesin motor domainPFAMPF00225Kinesincoord: 584..869
e-value: 1.3E-65
score: 221.5
IPR001752Kinesin motor domainPROSITEPS50067KINESIN_MOTOR_2coord: 556..871
score: 56.755
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 498..872
e-value: 2.3E-81
score: 275.4
IPR027640Kinesin-like proteinPANTHERPTHR24115FAMILY NOT NAMEDcoord: 510..876
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 532..870