mitochondrial sodium/calcium exchanger protein

Overview
Namemitochondrial sodium/calcium exchanger protein
Smed IDSMED30001861
Length (bp)2277
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of mitochondrial sodium/calcium exchanger protein (SMED30001861) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for mitochondrial sodium/calcium exchanger protein (SMED30001861) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001861

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30001861SMESG000022808.1 SmedASXL_012388SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30001861SMESG000022808.1 dd_Smed_v4_20334_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001861SMESG000022808.1 dd_Smed_v4_20334_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
collecting ductSMED30001861SMESG000022808.1 dd_Smed_v4_20334_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
Smed sexual biotypeSMED30001861SMESG000022809.1 SMESG000022808.1 Contig38122newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001861SMESG000022809.1 SMESG000022808.1 Contig38122uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Human
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 171.014 bits (432), Expect = 6.243e-45
Identity = 106/306 (34.64%), Postives = 176/306 (57.52%), Query Frame = 3
Query: 1323 ISDVQNQRTESNLSRILQSNRNDDSSFLTF-PGTFKHFLLTIL-PVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPI-GTDGFIVTYXXXXXXXXXXXSVAITSKSNS-PPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTV---VLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILII 2219
            +SD +  R  SN +     +  D+   L F   T    L+  L P+D   W R S + K L + + P+ F+L LT+ VV+ D   + W + LNCLH V+SPL+ +  +      +    G +  +++++I   A  SV   + S+S PP     FAF+GF+TS  WI     E+VN+L +LGVVF +  T+LGL++LA+ NS+GD  S+ TLA++ YPR+A++AC GG +FN+LVG+GL   ++ ++    + L+ D +   VL   + L    +L+ +P+  F+++++YG  LL  Y+ F ++ +
Sbjct:  214 LSDSEEDRVSSNTN---SYDYGDEYRPLFFYQETTAQILVRALNPLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNCLHLVISPLVVVLTLQSGTYGVYEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTEVKLEPDGLLVWVLAGALGLSLVFSLVSVPLQCFQLSRVYGFCLLLFYLNFLVVAL 516          

HSP 2 Score: 74.3294 bits (181), Expect = 3.698e-13
Identity = 42/107 (39.25%), Postives = 62/107 (57.94%), Query Frame = 3
Query:  132 KNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVP--TIXXXXXXXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSA 446
            + + G N S+ C +++    C  D G+L+Y E  +C F   ++P    L + W L L L +  TA  FF P L  ++  L++S N+AGVT LA GNGA D+FS+L A
Sbjct:   54 RKVCGLNVSDRCDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSALVA 160          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Human
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 170.244 bits (430), Expect = 2.739e-44
Identity = 106/306 (34.64%), Postives = 176/306 (57.52%), Query Frame = 3
Query: 1323 ISDVQNQRTESNLSRILQSNRNDDSSFLTF-PGTFKHFLLTIL-PVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPI-GTDGFIVTYXXXXXXXXXXXSVAITSKSNS-PPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTV---VLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILII 2219
            +SD +  R  SN +     +  D+   L F   T    L+  L P+D   W R S + K L + + P+ F+L LT+ VV+ D   + W + LNCLH V+SPL+ +  +      +    G +  +++++I   A  SV   + S+S PP     FAF+GF+TS  WI     E+VN+L +LGVVF +  T+LGL++LA+ NS+GD  S+ TLA++ YPR+A++AC GG +FN+LVG+GL   ++ ++    + L+ D +   VL   + L    +L+ +P+  F+++++YG  LL  Y+ F ++ +
Sbjct:  270 LSDSEEDRVSSNTN---SYDYGDEYRPLFFYQETTAQILVRALNPLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNCLHLVISPLVVVLTLQSGTYGVYEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTEVKLEPDGLLVWVLAGALGLSLVFSLVSVPLQCFQLSRVYGFCLLLFYLNFLVVAL 572          

HSP 2 Score: 114.775 bits (286), Expect = 7.280e-26
Identity = 83/249 (33.33%), Postives = 136/249 (54.62%), Query Frame = 3
Query:  132 KNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVP--TIXXXXXXXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTNTVIFNNDR-RLDSSKCKANKNCSHDPL 869
            + + G N S+ C +++    C  D G+L+Y E  +C F   ++P    L + W L L L +  TA  FF P L  ++  L++S N+AGVT LA GNGA D+FS+L A   S+    GLALG++ GAG+LV T+ AG I I+ PF    RP  +DI+FY++A+    ++L R ++    ++ +L +Y+ YV    +   +Y      Q+Q R      + VT  ++ +++  R+ S+    +    + PL
Sbjct:   54 RKVCGLNVSDRCDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSALVAF--SDPHTAGLALGALFGAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWALGYLGLYVFYVVTVILCTWIY------QRQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYRPL 294          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Human
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 170.244 bits (430), Expect = 2.739e-44
Identity = 106/306 (34.64%), Postives = 176/306 (57.52%), Query Frame = 3
Query: 1323 ISDVQNQRTESNLSRILQSNRNDDSSFLTF-PGTFKHFLLTIL-PVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPI-GTDGFIVTYXXXXXXXXXXXSVAITSKSNS-PPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTV---VLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILII 2219
            +SD +  R  SN +     +  D+   L F   T    L+  L P+D   W R S + K L + + P+ F+L LT+ VV+ D   + W + LNCLH V+SPL+ +  +      +    G +  +++++I   A  SV   + S+S PP     FAF+GF+TS  WI     E+VN+L +LGVVF +  T+LGL++LA+ NS+GD  S+ TLA++ YPR+A++AC GG +FN+LVG+GL   ++ ++    + L+ D +   VL   + L    +L+ +P+  F+++++YG  LL  Y+ F ++ +
Sbjct:  270 LSDSEEDRVSSNTN---SYDYGDEYRPLFFYQETTAQILVRALNPLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNCLHLVISPLVVVLTLQSGTYGVYEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTEVKLEPDGLLVWVLAGALGLSLVFSLVSVPLQCFQLSRVYGFCLLLFYLNFLVVAL 572          

HSP 2 Score: 114.775 bits (286), Expect = 7.280e-26
Identity = 83/249 (33.33%), Postives = 136/249 (54.62%), Query Frame = 3
Query:  132 KNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVP--TIXXXXXXXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTNTVIFNNDR-RLDSSKCKANKNCSHDPL 869
            + + G N S+ C +++    C  D G+L+Y E  +C F   ++P    L + W L L L +  TA  FF P L  ++  L++S N+AGVT LA GNGA D+FS+L A   S+    GLALG++ GAG+LV T+ AG I I+ PF    RP  +DI+FY++A+    ++L R ++    ++ +L +Y+ YV    +   +Y      Q+Q R      + VT  ++ +++  R+ S+    +    + PL
Sbjct:   54 RKVCGLNVSDRCDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSALVAF--SDPHTAGLALGALFGAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWALGYLGLYVFYVVTVILCTWIY------QRQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYRPL 294          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Human
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 151.754 bits (382), Expect = 2.872e-39
Identity = 92/239 (38.49%), Postives = 141/239 (59.00%), Query Frame = 3
Query: 1323 ISDVQNQRTESNLSRILQSNRNDDSSFLTF-PGTFKHFLLTIL-PVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPI-GTDGFIVTYXXXXXXXXXXXSVAITSKSNS-PPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGL 2027
            +SD +  R  SN +     +  D+   L F   T    L+  L P+D   W R S + K L + + P+ F+L LT+ VV+ D   + W + LNCLH V+SPL+ +  +      +    G +  +++++I   A  SV   + S+S PP     FAF+GF+TS  WI     E+VN+L +LGVVF +  T+LGL++LA+ NS+GD  S+ TLA++ YPR+A++AC GG +FN+LVG+GL
Sbjct:  140 LSDSEEDRVSSNTN---SYDYGDEYRPLFFYQETTAQILVRALNPLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNCLHLVISPLVVVLTLQSGTYGVYEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGL 375          

HSP 2 Score: 81.6481 bits (200), Expect = 9.510e-16
Identity = 59/170 (34.71%), Postives = 97/170 (57.06%), Query Frame = 3
Query:  363 LRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTNTVIFNNDR-RLDSSKCKANKNCSHDPL 869
            L++S N+AGVT LA GNGA D+FS+L A   S+    GLALG++ GAG+LV T+ AG I I+ PF    RP  +DI+FY++A+    ++L R ++    ++ +L +Y+ YV    +   +Y      Q+Q R      + VT  ++ +++  R+ S+    +    + PL
Sbjct:    3 LKLSHNVAGVTFLAFGNGAPDIFSALVAF--SDPHTAGLALGALFGAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWALGYLGLYVFYVVTVILCTWIY------QRQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYRPL 164          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Human
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 102.449 bits (254), Expect = 6.216e-24
Identity = 70/179 (39.11%), Postives = 106/179 (59.22%), Query Frame = 3
Query:  132 KNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVP--TIXXXXXXXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEF-WS 659
            + + G N S+ C +++    C  D G+L+Y E  +C F   ++P    L + W L L L +  TA  FF P L  ++  L++S N+AGVT LA GNGA D+FS+L A   S+    GLALG++ GAG+LV T+ AG I I+ PF    RP  +DI+FY++A+    ++L R ++   W+
Sbjct:   54 RKVCGLNVSDRCDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSALVAF--SDPHTAGLALGALFGAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWA 230          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Celegans
Match: ncx-7 (Putative sodium/calcium exchanger 7 [Source:UniProtKB/Swiss-Prot;Acc:P34322])

HSP 1 Score: 158.303 bits (399), Expect = 2.520e-40
Identity = 95/266 (35.71%), Postives = 152/266 (57.14%), Query Frame = 3
Query: 1455 DLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMN-PIGTDGFIVTYXXXXXXXXXXXSVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPIL---INLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLI 2240
            + +DW  +++F K++A +      +  LTI + E       W K L  LH    P   +  I   +  P      +  Y + +  +LA + +  T  S  P  Y+  +++ GFI SI WIY I +E+VNV+  LGVV  +   +LGL+ILA++NS+GDL++++++ K+ YPR+A AA IGGPLFNLL+G GLPF+I   Q   +   IN     ++L   ISL+ T  LI +P+ KFR+ + +  +L++IYI F + +I   T ++
Sbjct:  411 EAEDWEEMNIFSKVMAYINVVPNLLFKLTIPLNE-----MSWSKPLTLLHAFTCPAFLLFSIQFFLETPFSGSPGLWVYGLAVSIVLAILIMVFTELSVQPKYYKEIYSYSGFIMSIAWIYLISSEVVNVVTMLGVVSRVSHEVLGLTILAWSNSIGDLIADVSVVKQGYPRMAMAAAIGGPLFNLLMGFGLPFTIAKLQGKYISMTINPTYRLLILFLAISLLAT--LIGIPVQKFRLQRPHAAVLISIYIAFIVFVILSETGVL 669          

HSP 2 Score: 99.7525 bits (247), Expect = 2.132e-21
Identity = 71/201 (35.32%), Postives = 120/201 (59.70%), Query Frame = 3
Query:  165 CQYVK-NVSACLFDSGFLNYFEWQYCGFD--SRIVPTIXXXXXXXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTI-ILLRRKIEFWSSIVFLSIYIVYVFVTAISRALY-LKLKKCQKQ 752
            C YV  N +AC    G+L + ++  C     SR++  I+ +++ LVL + V++ AD FF+P +  +   LR+S+++AGVT +A GNGA DVF S++++LSS  P   LALG + G G+ V T+    I++  PF++     I+D++FYL+AL +     +   ++  W  + FL +Y++YV     ++A++  K K  QKQ
Sbjct:   56 CDYVNCNDNACE-GGGYLLWTQYVECASSTFSRVILIIVGVIYMLVLFIMVSSAADDFFSPSISSIVAHLRISESVAGVTFMAFGNGAPDVFGSIASVLSSPTPKADLALGELFGGGLFVTTMVVSTIILTSPFDVEVFSTIRDLLFYLVALSFLAFCFVFYNRVTLWMPLTFLGLYLLYVITVIGAQAVHNRKRKALQKQ 255          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Celegans
Match: ncx-6 (Putative sodium/calcium exchanger 6 [Source:UniProtKB/Swiss-Prot;Acc:P34315])

HSP 1 Score: 155.992 bits (393), Expect = 8.090e-40
Identity = 93/257 (36.19%), Postives = 154/257 (59.92%), Query Frame = 3
Query: 1458 LDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHV-NMNPIGTDGFIVTYXXXXXXXXXXXSVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQK---PILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILI 2216
            +D+W  +++F+K++A++ +   F+  LTI   E+      W K +  L C++ P+  +  I V +++P      +  Y +++  LL    +  T     PP Y+   ++ GF+ SI WIY I +E+VNV+  LGVV  +   +LGL+ILA++NS+GDL++++++AK+ YPR+A AA IGG LFNLL+G GLPF+I   Q     ++IN     ++L   ISL+ T  LI +   K+ + +I+   L+ IYI FF+ I
Sbjct:  330 MDEWDEMNIFQKVIAVLNTIPNFLFKLTIPHSEQP-----WSKPITLLQCLICPVFLLFCIQVCSISPFPNSPGLWMYGLILSVLLTAAVLFFTELHKEPPFYKSLISYAGFLMSIAWIYLISSEVVNVVTMLGVVSRVSHEVLGLTILAWSNSIGDLIADVSVAKQGYPRMAMAAAIGGQLFNLLIGFGLPFTIAKIQGKSISMIINPTYRLLMLFLAISLIFT--LIAMFAQKYFLRRIHSYSLVFIYISFFVFI 579          

HSP 2 Score: 98.2117 bits (243), Expect = 4.679e-21
Identity = 73/229 (31.88%), Postives = 125/229 (54.59%), Query Frame = 3
Query:  114 MESCNPKN------ITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDS--RIVPTIXXXXXXXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILL-RRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENI 773
            +E C P +        G N +  C+YVK         G++ +  +  C      RI+  I  +++ LVL + V++ AD FF+P +  +   LR+S+++AGVT +A GNGA DVF +++++LSS  P   LALG + GAG+ V T+   + +   PF+      I+DI FYL+AL +     +    +E W  I FL +Y++YV    +S+ L+ + KK +++   ++ +
Sbjct:   42 IEKCIPDDGEQCTIQAGWNSTQVCEYVKCNDDNCEGGGYVLWTRYVECASSPAVRIILIITGVIYMLVLFIMVSSAADDFFSPSISSIVAHLRISESVAGVTFMAFGNGAPDVFGAIASVLSSPTPKADLALGELFGAGLFVTTMVLAVTIFTRPFKAEVFSSIRDIAFYLVALAFLAFCFVYYDHVEIWMPITFLGVYLIYVCTVILSQILHNRHKKDEEKVDEVKTV 270          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Celegans
Match: ncx-9 (Mitochondrial sodium/calcium exchanger protein [Source:UniProtKB/Swiss-Prot;Acc:O16242])

HSP 1 Score: 147.132 bits (370), Expect = 1.549e-36
Identity = 91/256 (35.55%), Postives = 148/256 (57.81%), Query Frame = 3
Query: 1461 DDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHV-NMNPIGTDGFIVTYXXXXXXXXXXXSVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQK---PILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILI 2216
            D++  +++F KI+ +++   +F   LT+   E       WCK L  LHC  S    +  I +  + P      +  Y +    +LA +++     S     Y+  ++++GF+ SI WIY   NEIV+V+  +GVV  +   +LGL+I+A++N +GD+V++I + K+ YP++A AA IGGPLFNLL+G GLPF+I  AQ     +LIN     ++L   ISLVTT   + L I +F V + + ++L+ I++VF I I
Sbjct:  442 DEFSEMNIFIKIVTVIKVVPVFFFKLTVPSNE-----MSWCKPLFILHCFASIQFALFSIQIITLKPFDGSPGLWLYGLGFSAILAMVAMYFLPLSKEQKYYKEIYSYLGFLMSIAWIYATSNEIVSVVTMIGVVTGLSMELLGLTIMAWSNCIGDIVADIAVVKQGYPKMAMAAAIGGPLFNLLIGFGLPFTIAAAQGKEMELLINPVYRLLMLFLGISLVTT--FVALFIQRFTVRRPHAVLLIFIFVVFLIFI 690          

HSP 2 Score: 97.8265 bits (242), Expect = 8.669e-21
Identity = 74/194 (38.14%), Postives = 114/194 (58.76%), Query Frame = 3
Query:  156 SNECQYVK-NVSACLFDSGFLNYFEWQYCGFD--SRIVPTIXXXXXXXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLR-RKIEFWSSIVFLSIYIVYVFVTAISRALY 725
              +C+Y+K N  +C    G+L +  +  C ++   R++  IL IL+ ++L + +++ AD FF P +  +   LRMS+++AGVT LA GNGA DVFSS+S++L++  P   LALG + G  I V T+   II+    F++   P ++D+IFY+  L +     L+  KIE W    FL IY VYV VT I   +Y
Sbjct:   66 EEKCEYIKCNQDSCE-GGGYLTWSHYVKCQYNIGVRVILIILGILYLIILFVIMSSIADDFFCPAISGIVSHLRMSESIAGVTFLAFGNGAPDVFSSISSVLTTPKPKADLALGDLFGTSIFVTTVVLAIIIFTKSFKVAIIPTLRDLIFYMTTLAFIVFCFLKFDKIEVWMPATFLGIYGVYV-VTVIILGIY 257          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Celegans
Match: ncx-8 (Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:O16241])

HSP 1 Score: 127.487 bits (319), Expect = 4.140e-30
Identity = 83/252 (32.94%), Postives = 140/252 (55.56%), Query Frame = 3
Query: 1458 LDDWP------RLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHV-NMNPIGTDGFIVTYXXXXXXXXXXXSVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKP---ILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIIL 2183
            L  WP       +++F KI+ I++    F + +TI   E       WCK L  LHC  S    +  I + N+ P      +  Y +     +A +++     +     ++  ++++GF+ SI WIY   NEI++V+  +GVV  + Q +LGL+++++++ +GD+V++I + K+ YP++A AA IGGPLFNLL+G GLPF+I +AQ     ++IN     ++L   ISLVTT   + L I +F V   + + L
Sbjct:  437 LKPWPSREEFSEMNIFVKIIMIIRIIPSFFMKMTIPSNE-----MSWCKPLFLLHCFASIQFALFSIQIINLKPFDGSPGLWLYGLAFSATIALLALCFLPLNKELKYHKEVYSYLGFLMSIAWIYATANEIISVMTMVGVVTGLSQELLGLTVMSWSDCIGDIVADIAVIKQGYPKMAMAAAIGGPLFNLLIGFGLPFTIASAQGKQIDLIINPVYRILLLFLGISLVTT--FVALFIERFTVRWPHAVAL 681          

HSP 2 Score: 110.923 bits (276), Expect = 6.413e-25
Identity = 77/213 (36.15%), Postives = 126/213 (59.15%), Query Frame = 3
Query:  144 GTNYSNECQYVK-NVSACLFDSGFLNYFEWQYCGFD--SRIVPTIXXXXXXXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLR-RKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIEN 770
            G     +C Y+K N  +C    G+L +  +  C ++  +R+V  I+ I++ + L + ++T AD FF P +  +   L+MS+++AGVT LA GNGA DVF S+S++LS+  P   LALG + G  I V T+   II+    F++   P ++D+IFY+I L + T   L+  KIE W    FL IY VY+ +T I+ ++Y   +K  K+++ +E+
Sbjct:   63 GWTSEEKCAYIKCNQDSCE-GGGYLTWSHYVKCQYNIGARVVLIIVGIIYLIFLFVVMSTIADDFFCPSISGIVTHLKMSESIAGVTFLAFGNGAPDVFGSISSVLSTPKPKAALALGDLFGTSIFVTTVVLAIIIFTKSFKVAIIPTLRDLIFYMITLAFITFCFLKFDKIEVWMPATFLGIYAVYL-LTVIAFSIYRTRRKNLKKKKQLES 273          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Celegans
Match: ncx-10 (Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:Q965R5])

HSP 1 Score: 119.013 bits (297), Expect = 9.117e-28
Identity = 82/274 (29.93%), Postives = 148/274 (54.01%), Query Frame = 3
Query: 1461 DDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNM-NPIGTDGFIVTYXXXXXXXXXXXSVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLF-----------------NLLVGIGLPFSI---KTAQKPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILII 2219
            D++  ++ F + + +V     F L LTI   E       W K +  +HC  S  + +  + ++  +P      +  Y +LI  +L+ +++  T        Y+  ++++GF+ SI WIY I +EI+NV+  +GV   + Q ILGL+I+A++N +GD+VS++ + K+ +P++A AA IGGPLF                 +LL+G GLPF+I   +  Q  ++I      ++L   ISL T+  LI + + +F+V   + + LLT+++ F I ++
Sbjct:  275 DEFYEMNYFSRFITVVAVIPTFFLKLTIPSNE-----MPWSKPILIIHCFCSIQLALFAVQISAKSPFHGSPGLWLYGLLISIILSLLALRFTPLDREQKYYREVYSYLGFLMSIAWIYTISSEIINVITMIGVATGVSQEILGLTIMAWSNCIGDIVSDVAVVKQGFPKMAMAAAIGGPLFSKLYSRPCQIKITTYISDLLIGFGLPFTIACLQGKQIDLIITPVYRLLMLFLAISLFTS--LIAIFVQRFKVRWPHAVALLTVFVAFLIFVL 541          

HSP 2 Score: 86.2705 bits (212), Expect = 2.973e-17
Identity = 58/152 (38.16%), Postives = 92/152 (60.53%), Query Frame = 3
Query:  318 ADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLR-RKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIEN 770
            AD FF+P +  + + L++S+++AGVT LA GNGA DVF S+++++++  P   LA+G I+G GI V T+    I++   F I     I+DI+F++IA ++  I  L    +E W  + FL +Y  YV V+ I   L  K +K  + E+ IEN
Sbjct:    5 ADDFFSPSIAGIVRHLKISESIAGVTFLAFGNGAPDVFGSIASVITTPKPKADLAIGDIIGGGIFVTTVVLSAIILTKSFRIAILATIRDIVFFIIADIFLAIWFLTFNHVEIWMPLTFLGLYAAYV-VSVILMRLNSKRRKRARHEK-IEN 154          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Fly
Match: CG14744 (gene:FBgn0033324 transcript:FBtr0307024)

HSP 1 Score: 115.931 bits (289), Expect = 1.460e-26
Identity = 83/332 (25.00%), Postives = 159/332 (47.89%), Query Frame = 3
Query: 1281 EFKNIAVEKLKKKSISDVQNQRTESNLSRI-LQSNRNDDSSFLTFPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIG-----TDGFIVTYXXXXXXXXXXXSVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLK-----SDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLIN 2243
             F N+         I + +++  +  L+R  L  + N  +  L     F  F  ++ PVD + W       +I  I + P++F+L L I VV+ +    GW K+LNC   V +P + IT +H  ++ +      T  F ++     + +   I + + S+++ PP Y   F  + F +S+  ++  V E+  +   +G+VF++ ++ + ++  A +N+  D+++N  LA + Y R+A+AA IGGP+F +LV + L F      + +  N        D   L   I++VTTM   V     F   +  G+ L  +Y+ F +  +    ++++
Sbjct:  285 HFSNMTSSGYFVTPIPERRSEHVDYELNRTALHDSENPKNLQL-----FTEFFQSLNPVDAEAWQLGGWSNRIYLIARCPLVFVLQLFIPVVDYEKIKHGWSKLLNCTQIVTNPFVVITLVHSGVSSVYKTWHITLDFSISMWSPCLTVPLAIVIFLHSRTDVPPSYHHLFIILTFFSSMVTLWLAVTELEVLSEIVGIVFNLSESFMAVTFEAVSNATPDIIANYQLALQGYGRMAFAAIIGGPVFAILVSMSLAFIFNHRVREVGANSWVYGDLGDNCYLFLVITIVTTMWWSV--TFDFHARRSAGVFLWLVYLQFLLYAVCVEWDVVH 609          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Fly
Match: CG5348 (gene:FBgn0034156 transcript:FBtr0305318)

HSP 1 Score: 112.849 bits (281), Expect = 1.441e-25
Identity = 71/277 (25.63%), Postives = 139/277 (50.18%), Query Frame = 3
Query: 1230 KIRFYSADTNMAARRIEEFKNIAVEKLKKKSISDVQNQRTESNLSRILQSNRNDDSSFLTFPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPL----IWITFIHVNMNPI-----------GTDGFIVTYXXXXXXXXXXXSVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLV 2015
            K+ +YS DT +    +E+  +I++ +++  ++  ++N R   N  R    N   D +     G F+ F L + P+    W +  +  ++L ++++P + I TL I +V+ ++   GW K+LN ++ V++P     I+++F+H   N +           G   F++T       +   + +   ++++ PP Y   F  M    S+F I+    EI  VL  +G + SI    +G ++ AF  ++G L +N  +A   YP++A+A+ IGG  F ++V
Sbjct:  268 KLEYYSQDTRVEI--LEKSSSISITRIRYTTMRMIRNPRVSVN--RRYTRNMKLDYTQSKNQGIFRDFFLALRPIKCQAWKQAELLNRVLLLIRAPAVVICTLYIPLVDYEMEKHGWNKLLNAINVVVNPALSISIFLSFMHRKGNFLWYISLQNTLIYGASSFVLT-------VPFAVFILFHARTDVPPSYHWVFTIMNLTGSMFLIFLCATEIDTVLEVIGNILSIDDNYMGATVKAFTGNLGTLFANTAVAIHGYPKMAFASAIGGSFFTIVV 533          

HSP 2 Score: 55.0694 bits (131), Expect = 2.058e-7
Identity = 32/97 (32.99%), Postives = 58/97 (59.79%), Query Frame = 3
Query:  315 TADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAI-----LSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDI 590
            T + +++P L  V++ L M+++LAGVTL+A GN +AD F++L+++     + +NN          L + + V TI+ G+I  I PF++     ++DI
Sbjct:  100 TINVYYSPALKAVSRFLHMNEHLAGVTLMAFGNTSADFFANLASVERHVPVFANN----------LSSALFVITISGGLIFYISPFKMNSYETVRDI 186          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Fly
Match: CG12376 (gene:FBgn0033323 transcript:FBtr0088706)

HSP 1 Score: 108.612 bits (270), Expect = 3.661e-24
Identity = 75/285 (26.32%), Postives = 132/285 (46.32%), Query Frame = 3
Query: 1416 GTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIGTDGFIVTYXXXXXXXXXXXSVA--------ITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVG----------IGLPFSIKTAQKPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILI 2216
            G FK   + + P++ + W + ++ K+   + + P + I  + I +V+ ++   GW K+LNC+  +L+P + I  I   ++  G   + V      I  +  + +         I S+++ PP Y   F  M    S+F I+    EI  VL  +G +  +    +G ++ A   S+G L++N+ +A   YPR+AYA+ IGGP F +++            GLP S         +N      + VF+  L +T     L     R   I+ I+   IY++F ILI
Sbjct:  316 GLFKDLFIALRPINCEKWRKGNIIKRAFMLTKIPAVIICCIYIPLVDYELDKHGWNKLLNCIQVMLNPAMSIMAIKALLSSRGNSLWYVAMGEEAIYAMYSLPITVPIAVFMFIQSRTDVPPFYHSVFTVMNLTGSMFMIFICATEIDKVLEVIGHILKVEDDFMGATVKACTGSLGPLIANVAMALHGYPRMAYASAIGGPFFTVVMSASTVMHVKNLFGLPVSEANQTGNYGLNAFIFLNLGVFSTLLWST----TLGFFARRSVGIFSIVFYCIYLLFAILI 596          

HSP 2 Score: 58.151 bits (139), Expect = 2.642e-8
Identity = 40/131 (30.53%), Postives = 75/131 (57.25%), Query Frame = 3
Query:  321 DSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLI-ALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAI 710
            + +++P L  V++ L M++++AGVTLLA GN +AD+FS+L+++    N NV     + L A + V+ ++ G+I    PF++     ++DI+F +  ++L    +     +   S IV   +YI Y+ V  +
Sbjct:   94 NKYYSPALKAVSRFLCMNEHVAGVTLLAFGNSSADLFSNLASV----NANV-PVFANSLAAALFVSMVSGGLICYTSPFKMNAYESVRDILFLIFGSMLLQYFLASSAHVPETSFIVMFLVYIFYILVNVV 219          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Fly
Match: CG12376 (gene:FBgn0033323 transcript:FBtr0339335)

HSP 1 Score: 106.686 bits (265), Expect = 7.342e-24
Identity = 75/285 (26.32%), Postives = 132/285 (46.32%), Query Frame = 3
Query: 1416 GTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIGTDGFIVTYXXXXXXXXXXXSVA--------ITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVG----------IGLPFSIKTAQKPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILI 2216
            G FK   + + P++ + W + ++ K+   + + P + I  + I +V+ ++   GW K+LNC+  +L+P + I  I   ++  G   + V      I  +  + +         I S+++ PP Y   F  M    S+F I+    EI  VL  +G +  +    +G ++ A   S+G L++N+ +A   YPR+AYA+ IGGP F +++            GLP S         +N      + VF+  L +T     L     R   I+ I+   IY++F ILI
Sbjct:  207 GLFKDLFIALRPINCEKWRKGNIIKRAFMLTKIPAVIICCIYIPLVDYELDKHGWNKLLNCIQVMLNPAMSIMAIKALLSSRGNSLWYVAMGEEAIYAMYSLPITVPIAVFMFIQSRTDVPPFYHSVFTVMNLTGSMFMIFICATEIDKVLEVIGHILKVEDDFMGATVKACTGSLGPLIANVAMALHGYPRMAYASAIGGPFFTVVMSASTVMHVKNLFGLPVSEANQTGNYGLNAFIFLNLGVFSTLLWST----TLGFFARRSVGIFSIVFYCIYLLFAILI 487          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Fly
Match: CG14743 (gene:FBgn0033326 transcript:FBtr0307023)

HSP 1 Score: 98.5969 bits (244), Expect = 5.637e-21
Identity = 73/303 (24.09%), Postives = 145/303 (47.85%), Query Frame = 3
Query: 1329 DVQNQRTESNLSRILQSNRNDDSSFLTFPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSP-----LIWITFIHVNMNPIGTDGFIVTYXXXXXXXXXXXSVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIK----TAQKPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFI 2210
            DV+  R      RIL S  N  + FL     F  FL  I P+D + W       +IL I+++P+  +L L + +V+  +   GW K+LNCL  VL+P     L+    +H          F +    L++ +   I V + S+++ PP Y   +  +   T I + +    E+  ++  +GVVF +  + + ++  + + +  DL++   LAK  Y ++A+ A IGG +++L V +G+   ++    +  + +L      T+ +   I++ TT+   +     F   +  G+ + +++++F +
Sbjct:  299 DVETNR------RILHSKANPKNLFL-----FSEFLQAINPIDSEGWYLSGTCARILQILKAPVTLMLHLVVPLVDYQLVKHGWSKMLNCLQIVLTPFVIFALVETMLVHKYAEWYYVPQFRMAIWSLLVTMPLAIVVFLHSRTDIPPFYHSSYCALTISTVIIFFWICAWEMDALISIIGVVFDLAPSYMSITFNSVSAATADLIAYAHLAKHGYGKMAFGAIIGGSVYSLAVNVGIELVLQKKLNSRGQVVLYGDDGVTIYIFLVITITTTLWWCL--TFNFVARRSAGLFMWSLFVLFLV 588          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Zebrafish
Match: slc8b1 (solute carrier family 8 member B1 [Source:ZFIN;Acc:ZDB-GENE-130530-900])

HSP 1 Score: 124.02 bits (310), Expect = 4.661e-31
Identity = 80/205 (39.02%), Postives = 119/205 (58.05%), Query Frame = 3
Query:  156 SNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVP---TIXXXXXXXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERP 761
            S  C+YVKN   C  D GF+ Y    +C F   ++P   TI +I    + L+     +D FF P L  +   LR++ N+AGVT LALGNGA DVFS+++A   S+    GLA+G++ GAGI V T+ AG + ++ PF +  RP ++D+IFY+ A+ W   +L +  I    S+ +L +YI YVF   +S  +Y + +K Q  E P
Sbjct:   64 SQRCEYVKNTPDCASDEGFIKYPFVTFCLFTPSLLPLAITIYVIWLLFLFLVLGLIASD-FFCPNLSAIASTLRLTHNVAGVTFLALGNGAPDVFSAMAAF--SHPQTAGLAIGALFGAGIFVTTVVAGSVALVKPFTVASRPFLRDVIFYMAAVFWTFTVLYKGHISLGESVGYLGMYIAYVFTVILSSYIYNR-QKHQLTESP 264          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Zebrafish
Match: slc24a4a (solute carrier family 24 member 4a [Source:ZFIN;Acc:ZDB-GENE-050417-291])

HSP 1 Score: 63.1586 bits (152), Expect = 9.444e-10
Identity = 42/153 (27.45%), Postives = 82/153 (53.59%), Query Frame = 3
Query: 1782 MGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNK--------IYGIILLTIYIVFFILI 2216
            + F  S  WI      +V ++  +G    IP  I+G++ LA   SV D ++++ +A++    +A +  IG  +F++LVG+G+P+ I+T        +K ++  LV+++ L+  +  + L +L   VN+        IY ++L  I++ F I+I
Sbjct:  434 LSFFLSTVWIAAFSYILVWMVTIVGYTLGIPDVIMGITFLAAGTSVPDCIASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWGIQTMAVNYGSVVKINSRGLVYSVVLL--LGSVALTVLGIHVNRWRLDLRLGIYVLVLYAIFLTFSIMI 584          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Zebrafish
Match: slc24a3 (solute carrier family 24 member 3 [Source:ZFIN;Acc:ZDB-GENE-090312-67])

HSP 1 Score: 62.7734 bits (151), Expect = 1.004e-9
Identity = 44/169 (26.04%), Postives = 95/169 (56.21%), Query Frame = 3
Query: 1734 TSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTVVLVFTIS-LVTTMNLIVLPIL--KFRVNKIYGIILLTIYIVF--FILIISF 2225
            T  +++ P ++ ++  + FI+S  WI      +V ++  +G    IP  I+G++ LA   SV D ++++ +A++    +A +  IG  +F++L+G+GLP++++T        +  ++  L+F++  L+ ++ L VL +    ++++K  G   L +Y VF  F ++I F
Sbjct:  429 TVPNSANPRWERWY-MVSFISSTIWIAFFSYIMVWMVTVIGYTMGIPDVIMGITFLAAGTSVPDCLASLIVARQGMGDMAISNSIGSNVFDILIGLGLPWALQTLAINYGSTIHLNSKGLIFSVGLLLASVFLTVLGVHLNNWKLDKRLGFACLLMYAVFLCFSILIEF 596          

HSP 2 Score: 50.447 bits (119), Expect = 7.429e-6
Identity = 33/163 (20.25%), Postives = 79/163 (48.47%), Query Frame = 3
Query:  303 SVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTN 791
            ++A   D +F P L  + + L +S+++AG T +A G+ A ++F+S+  +  +   +VG+          ++  I    I       +    +++D  +Y IA+    + +   K+ +W S++ + +Y+VY+ +   +  +   +++ +K    + N   S T+
Sbjct:   88 ALALVCDDYFVPSLEKICERLHLSEDVAGATFMAAGSSAPELFTSVIGVFITKG-DVGVGTIVGSAVFNILCIIGVCGIFTAQAVRLSCWTLMRDSTYYTIAVATLIVFIYDEKVTWWESLILIVLYLVYILIMKFNSRVVHFIERRKKNPANLGNGTASNTD 249          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Zebrafish
Match: slc24a5 (solute carrier family 24 member 5 [Source:ZFIN;Acc:ZDB-GENE-031210-1])

HSP 1 Score: 60.8474 bits (146), Expect = 4.412e-9
Identity = 44/171 (25.73%), Postives = 86/171 (50.29%), Query Frame = 3
Query: 1752 PPIYQPF---FAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKT----AQKPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLIN 2243
            P   +PF   F  + F+ S  WI      +V ++  +G    IP T++G+++LA   S+ D V+++ +A+     +A +  +G  +F++L  +GLP+ I+T       P+ +N  S  V +  T+ L      + + I  ++++   G++ L  YI+F  L I +   +I 
Sbjct:  336 PDCRRPFWKNFYMLTFLMSAVWISAFTYVLVWMVTIVGETLGIPDTVMGMTLLAAGTSIPDTVASVMVAREGKSDMAMSNIVGSNVFDMLC-LGLPWFIQTVFVDVGSPVDVN-SSGLVFMSCTLLLSIIFLFLAVHINGWKLDWKLGLVCLACYILFATLSILYELGIIG 504          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Zebrafish
Match: slc24a1 (solute carrier family 24 member 1 [Source:ZFIN;Acc:ZDB-GENE-060503-191])

HSP 1 Score: 60.8474 bits (146), Expect = 4.910e-9
Identity = 47/160 (29.38%), Postives = 78/160 (48.75%), Query Frame = 3
Query:  303 SVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRR--------PIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYV----FVTAISRALYLKLKKCQ 746
            S+A   D FF P L V+T  L +S ++AG T +A G  A ++F+SL  +  S++ NV        G G +V +    I+ +I    +  R        P+ +D+ FY++ L+   I  L   I +W S++ +  Y +YV    F   + RA   +L K +
Sbjct:  183 SLAIVCDEFFVPTLGVITDKLAISDDVAGATFMAAGGSAPELFTSLIGVFISHS-NV--------GIGTIVGSAVFNILFVIGMCALFSREMLHLTWWPLFRDVSFYILDLIMLIIFFLDNTIMWWESMMLVGGYALYVTFMKFNVQLERAFKSQLSKHK 333          

HSP 2 Score: 56.9954 bits (136), Expect = 6.939e-8
Identity = 41/165 (24.85%), Postives = 84/165 (50.91%), Query Frame = 3
Query: 1755 PIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLP---FSIKTAQKPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLI 2240
            P  + FF    F+ SI WI      +V     +G    I + I+GL+ILA   S+ DL++++ +A++    +A ++ +G  +F++ +G+ +P   FS   +  P+ ++  +     +  + L+    +I +   K+R+NK+ G  +  +Y VF +L +     +I
Sbjct:  556 PASKKFFVIT-FLGSIVWIAIFSYLMVWWAHQVGETIGISEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITMGLPVPWLMFSFFHSFAPVPVS-SNGLFCAIVLLFLMLLFVIISIAACKWRMNKVLGFTMFILYFVFLVLSVMLEDRII 718          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Xenopus
Match: slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:NCBI gene;Acc:549836])

HSP 1 Score: 159.458 bits (402), Expect = 8.519e-41
Identity = 90/259 (34.75%), Postives = 148/259 (57.14%), Query Frame = 3
Query: 1449 PVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIG---TDGFIVTYXXXXXXXXXXXSVA-ITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTV---VLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVF 2204
            PVD   W + S   +   +++ P+  +L LT+ VV+ D   + W + LNCLH + +PL+ +    +N    G    +G I  + +L+I      +V  +T+ +  PP Y   F+F+GF+ S  WI     EIVN+L T GV+F +  T+LGL++LA+ NS+GD VS+ITLA++ YPR+A++AC GG +FN+L+G+GL   ++       + L+   +   +L   + +    +LI +P   F + + YG+ L  IY VF
Sbjct:  300 PVDSRKWKQKSWKWRTFKLIKVPVEILLLLTVPVVDPDKEEQNWQRPLNCLHLITTPLLCV--FTINAGSYGLYIINGVIPVWAVLLIIGTFLAAVVFLTTTNGEPPKYHCLFSFLGFVASALWISAAATEIVNLLRTFGVIFRLSNTVLGLTLLAWGNSIGDFVSDITLARQGYPRMAFSACFGGIIFNVLIGVGLGCLLQMGPSRTSLQLEHQGLLVWILAGGLGISLVFSLISVPAQSFHLRRGYGVALFFIYAVF 556          

HSP 2 Score: 96.6709 bits (239), Expect = 3.398e-20
Identity = 75/207 (36.23%), Postives = 123/207 (59.42%), Query Frame = 3
Query:  132 KNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTIXXXXXXXXXXXSV--ATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQ 746
            + +   + S  C + +    C    G++NY +  +C F   + P  + +    +L L +  A TA+ FF P L  +++ILR+S N+AGVT LA GNGA DVFS+++A   S++   GLA+G++ GAG+ V T+ AG I I+ PF    RP ++DI+FY+ A+     IL +  +    ++V+L +Y+VYVFV  IS  +Y ++++ Q
Sbjct:   44 QEVGKLDASLRCNFTRTTPDCSVGDGYINYLDGAFCSFLPSLFPLAIFLYTLWLLYLFIILAVTAEKFFCPNLSAISRILRLSHNVAGVTFLAFGNGAPDVFSAVAAF--SDSRTAGLAIGALFGAGVFVTTVVAGGITIVKPFTAASRPFLRDIVFYISAIFLTFFILYQGFVTLAEALVYLLLYLVYVFVVVISTWIYRRMRQQQ 248          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Xenopus
Match: slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:NCBI gene;Acc:549836])

HSP 1 Score: 159.458 bits (402), Expect = 1.138e-40
Identity = 90/259 (34.75%), Postives = 148/259 (57.14%), Query Frame = 3
Query: 1449 PVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIG---TDGFIVTYXXXXXXXXXXXSVA-ITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTV---VLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVF 2204
            PVD   W + S   +   +++ P+  +L LT+ VV+ D   + W + LNCLH + +PL+ +    +N    G    +G I  + +L+I      +V  +T+ +  PP Y   F+F+GF+ S  WI     EIVN+L T GV+F +  T+LGL++LA+ NS+GD VS+ITLA++ YPR+A++AC GG +FN+L+G+GL   ++       + L+   +   +L   + +    +LI +P   F + + YG+ L  IY VF
Sbjct:  311 PVDSRKWKQKSWKWRTFKLIKVPVEILLLLTVPVVDPDKEEQNWQRPLNCLHLITTPLLCV--FTINAGSYGLYIINGVIPVWAVLLIIGTFLAAVVFLTTTNGEPPKYHCLFSFLGFVASALWISAAATEIVNLLRTFGVIFRLSNTVLGLTLLAWGNSIGDFVSDITLARQGYPRMAFSACFGGIIFNVLIGVGLGCLLQMGPSRTSLQLEHQGLLVWILAGGLGISLVFSLISVPAQSFHLRRGYGVALFFIYAVF 567          

HSP 2 Score: 67.781 bits (164), Expect = 4.654e-11
Identity = 70/230 (30.43%), Postives = 122/230 (53.04%), Query Frame = 3
Query:  105 RKVMESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTIXXXXXXXXXXXSV--ATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQ----ERPIENIE 776
            + + + C  + +   + S  C + +    C    G++NY +  +C F   + P  + +    +L L +  A TA+         ++    ++  L GVT LA GNGA DVFS+++A   S++   GLA+G++ GAG+ V T+ AG I I+ PF    RP ++DI+FY+ A+     IL +  +    ++V+L +Y+VYVFV  IS  +Y ++++ Q      E P E+ +
Sbjct:   57 KHISQQC--QEVGKLDASLRCNFTRTTPDCSVGDGYINYLDGAFCSFLPSLFPLAIFLYTLWLLYLFIILAVTAEK-----NQTISMQCSLTFFLHGVTFLAFGNGAPDVFSAVAAF--SDSRTAGLAIGALFGAGVFVTTVVAGGITIVKPFTAASRPFLRDIVFYISAIFLTFFILYQGFVTLAEALVYLLLYLVYVFVVVISTWIYRRMRQQQLAVPITEEPGEDFK 277          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Xenopus
Match: slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:NCBI gene;Acc:549836])

HSP 1 Score: 157.918 bits (398), Expect = 2.335e-40
Identity = 90/259 (34.75%), Postives = 148/259 (57.14%), Query Frame = 3
Query: 1449 PVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIG---TDGFIVTYXXXXXXXXXXXSVA-ITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTV---VLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVF 2204
            PVD   W + S   +   +++ P+  +L LT+ VV+ D   + W + LNCLH + +PL+ +    +N    G    +G I  + +L+I      +V  +T+ +  PP Y   F+F+GF+ S  WI     EIVN+L T GV+F +  T+LGL++LA+ NS+GD VS+ITLA++ YPR+A++AC GG +FN+L+G+GL   ++       + L+   +   +L   + +    +LI +P   F + + YG+ L  IY VF
Sbjct:  287 PVDSRKWKQKSWKWRTFKLIKVPVEILLLLTVPVVDPDKEEQNWQRPLNCLHLITTPLLCV--FTINAGSYGLYIINGVIPVWAVLLIIGTFLAAVVFLTTTNGEPPKYHCLFSFLGFVASALWISAAATEIVNLLRTFGVIFRLSNTVLGLTLLAWGNSIGDFVSDITLARQGYPRMAFSACFGGIIFNVLIGVGLGCLLQMGPSRTSLQLEHQGLLVWILAGGLGISLVFSLISVPAQSFHLRRGYGVALFFIYAVF 543          

HSP 2 Score: 65.4698 bits (158), Expect = 1.918e-10
Identity = 58/205 (28.29%), Postives = 104/205 (50.73%), Query Frame = 3
Query:  105 RKVMESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTIXXXXXXXXXXXSV--ATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSI----VFLSIYIVYVFV 701
            + + + C  + +   + S  C + +    C    G++NY +  +C F   + P  + +    +L L +  A TA+         ++    ++  L GVT LA GNGA DVFS+++A   S++   GLA+G++ GAG+ V T+ AG I I+ PF    RP ++DI+FY+ A+     IL +  +    ++     +   Y++Y F+
Sbjct:   57 KHISQQC--QEVGKLDASLRCNFTRTTPDCSVGDGYINYLDGAFCSFLPSLFPLAIFLYTLWLLYLFIILAVTAEK-----NQTISMQCSLTFFLHGVTFLAFGNGAPDVFSAVAAF--SDSRTAGLAIGALFGAGVFVTTVVAGGITIVKPFTAASRPFLRDIVFYISAIFLTFFILYQGFVTLAEALGKYKAYFLAYLLYCFL 252          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Xenopus
Match: slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:NCBI gene;Acc:549836])

HSP 1 Score: 157.918 bits (398), Expect = 3.037e-40
Identity = 90/259 (34.75%), Postives = 148/259 (57.14%), Query Frame = 3
Query: 1449 PVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIG---TDGFIVTYXXXXXXXXXXXSVA-ITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTV---VLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVF 2204
            PVD   W + S   +   +++ P+  +L LT+ VV+ D   + W + LNCLH + +PL+ +    +N    G    +G I  + +L+I      +V  +T+ +  PP Y   F+F+GF+ S  WI     EIVN+L T GV+F +  T+LGL++LA+ NS+GD VS+ITLA++ YPR+A++AC GG +FN+L+G+GL   ++       + L+   +   +L   + +    +LI +P   F + + YG+ L  IY VF
Sbjct:  303 PVDSRKWKQKSWKWRTFKLIKVPVEILLLLTVPVVDPDKEEQNWQRPLNCLHLITTPLLCV--FTINAGSYGLYIINGVIPVWAVLLIIGTFLAAVVFLTTTNGEPPKYHCLFSFLGFVASALWISAAATEIVNLLRTFGVIFRLSNTVLGLTLLAWGNSIGDFVSDITLARQGYPRMAFSACFGGIIFNVLIGVGLGCLLQMGPSRTSLQLEHQGLLVWILAGGLGISLVFSLISVPAQSFHLRRGYGVALFFIYAVF 559          

HSP 2 Score: 80.8777 bits (198), Expect = 3.532e-15
Identity = 72/215 (33.49%), Postives = 120/215 (55.81%), Query Frame = 3
Query:  132 KNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTIXXXXXXXXXXXSV--ATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIEN 770
            + +   + S  C + +    C    G++NY +  +C F   + P  + +    +L L +  A TA+ FF P L  ++    ++  L GVT LA GNGA DVFS+++A   S++   GLA+G++ GAG+ V T+ AG I I+ PF    RP ++DI+FY+ A+     IL +  +    ++V+L +Y+VYVFV  IS  +Y ++++ Q+   PI  
Sbjct:   47 QEVGKLDASLRCNFTRTTPDCSVGDGYINYLDGAFCSFLPSLFPLAIFLYTLWLLYLFIILAVTAEKFFCPNLSTISMQCSLTFFLHGVTFLAFGNGAPDVFSAVAAF--SDSRTAGLAIGALFGAGVFVTTVVAGGITIVKPFTAASRPFLRDIVFYISAIFLTFFILYQGFVTLAEALVYLLLYLVYVFVVVISTWIYRRMRQ-QQLAVPITE 258          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Xenopus
Match: slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:NCBI gene;Acc:549836])

HSP 1 Score: 95.9005 bits (237), Expect = 1.498e-21
Identity = 63/163 (38.65%), Postives = 97/163 (59.51%), Query Frame = 3
Query:  156 SNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTIXXXXXXXXXXXSV--ATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLR 638
            S  C + +    C    G++NY +  +C F   + P  + +    +L L +  A TA+ FF P L  +++ILR+S N+AGVT LA GNGA DVFS+++A   S++   GLA+G++ GAG+ V T+ AG I I+ PF    RP ++DI+FY+ A+     IL +
Sbjct:   51 SLRCNFTRTTPDCSVGDGYINYLDGAFCSFLPSLFPLAIFLYTLWLLYLFIILAVTAEKFFCPNLSAISRILRLSHNVAGVTFLAFGNGAPDVFSAVAAF--SDSRTAGLAIGALFGAGVFVTTVVAGGITIVKPFTAASRPFLRDIVFYISAIFLTFFILYQ 211          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Mouse
Match: Slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:MGI Symbol;Acc:MGI:2180781])

HSP 1 Score: 169.088 bits (427), Expect = 1.663e-44
Identity = 95/263 (36.12%), Postives = 160/263 (60.84%), Query Frame = 3
Query: 1449 PVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPI-GTDGFIVTYXXXXXXXXXXXSVAITSKSN-SPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPIL-INLKSDTV---VLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILII 2219
            P+D   W   S+  ++L +V+ P+ F+L LT+ VV+ D   + W + LNCL  V+SPL+ +  +   +  I    G +  + +++I   A  SV   + SN  PP     FAF+GF+TS  WI     E+VN+L +LGV+F +  T+LGL++LA+ NS+GD  S+ TLA++ YPR+A++AC GG +FN+LVG+GL   ++  +  ++ + L+ D +   VL   + L    +L+ +P+  F+++K YG+ LL  YI F ++++
Sbjct:  255 PLDYRKWRTQSISWRVLKVVKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGIYEIGGLLPVWAVVVIVGTALASVTFFATSNREPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQIIRNHVVEVKLEPDGLLVWVLASALGLSLIFSLVSVPLQCFQLSKAYGLCLLLFYICFLVVVL 517          

HSP 2 Score: 73.9442 bits (180), Expect = 3.453e-13
Identity = 44/119 (36.97%), Postives = 67/119 (56.30%), Query Frame = 3
Query:   96 SVPRKVMESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTIXXXXX--XXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSA 446
            SV +  M  C  + + G N S+ C +V+    C  ++G+L+Y E  +C F   ++P  + +     L L L +  TA  FF P L  ++  L++S N+AGVT LA GNGA D+FS+L A
Sbjct:   44 SVNQTAMADC--RAVCGLNTSDRCDFVRRNPDCRSEAGYLDYLEGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNLSAISTNLKLSHNVAGVTFLAFGNGAPDIFSALVA 160          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Mouse
Match: Slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:MGI Symbol;Acc:MGI:2180781])

HSP 1 Score: 168.318 bits (425), Expect = 5.755e-44
Identity = 95/263 (36.12%), Postives = 160/263 (60.84%), Query Frame = 3
Query: 1449 PVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPI-GTDGFIVTYXXXXXXXXXXXSVAITSKSN-SPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPIL-INLKSDTV---VLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILII 2219
            P+D   W   S+  ++L +V+ P+ F+L LT+ VV+ D   + W + LNCL  V+SPL+ +  +   +  I    G +  + +++I   A  SV   + SN  PP     FAF+GF+TS  WI     E+VN+L +LGV+F +  T+LGL++LA+ NS+GD  S+ TLA++ YPR+A++AC GG +FN+LVG+GL   ++  +  ++ + L+ D +   VL   + L    +L+ +P+  F+++K YG+ LL  YI F ++++
Sbjct:  294 PLDYRKWRTQSISWRVLKVVKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGIYEIGGLLPVWAVVVIVGTALASVTFFATSNREPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQIIRNHVVEVKLEPDGLLVWVLASALGLSLIFSLVSVPLQCFQLSKAYGLCLLLFYICFLVVVL 556          

HSP 2 Score: 83.1889 bits (204), Expect = 4.836e-16
Identity = 67/215 (31.16%), Postives = 110/215 (51.16%), Query Frame = 3
Query:   96 SVPRKVMESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTIXXXXXXXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKK 740
            SV +  M  C  + + G N S+ C +V+    C  ++G+L+Y E  +C F   ++P              +A T   F+   L ++  +   ++   GVT LA GNGA D+FS+L A   S+    GLA+G++ GAG+LV T+ AG I I+ PF    RP ++DI FY++A+      L   +I    ++ +L +Y+ YV    I   +Y + + 
Sbjct:   44 SVNQTAMADC--RAVCGLNTSDRCDFVRRNPDCRSEAGYLDYLEGIFCYFPPNLLP--------------LAITLYVFWLLYLFLILGV-TAAKFPHGVTFLAFGNGAPDIFSALVAF--SDPRTAGLAIGALFGAGVLVTTVVAGGITILHPFMAASRPFLRDIAFYMVAVFLTFTALYLGRITLTWALGYLGLYVFYVVTVIICTWVYQRQRS 239          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Mouse
Match: Slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:MGI Symbol;Acc:MGI:2180781])

HSP 1 Score: 168.318 bits (425), Expect = 7.034e-44
Identity = 95/263 (36.12%), Postives = 160/263 (60.84%), Query Frame = 3
Query: 1449 PVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPI-GTDGFIVTYXXXXXXXXXXXSVAITSKSN-SPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPIL-INLKSDTV---VLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILII 2219
            P+D   W   S+  ++L +V+ P+ F+L LT+ VV+ D   + W + LNCL  V+SPL+ +  +   +  I    G +  + +++I   A  SV   + SN  PP     FAF+GF+TS  WI     E+VN+L +LGV+F +  T+LGL++LA+ NS+GD  S+ TLA++ YPR+A++AC GG +FN+LVG+GL   ++  +  ++ + L+ D +   VL   + L    +L+ +P+  F+++K YG+ LL  YI F ++++
Sbjct:  311 PLDYRKWRTQSISWRVLKVVKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGIYEIGGLLPVWAVVVIVGTALASVTFFATSNREPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQIIRNHVVEVKLEPDGLLVWVLASALGLSLIFSLVSVPLQCFQLSKAYGLCLLLFYICFLVVVL 573          

HSP 2 Score: 103.99 bits (258), Expect = 1.315e-22
Identity = 76/217 (35.02%), Postives = 120/217 (55.30%), Query Frame = 3
Query:   96 SVPRKVMESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTIXXXXX--XXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKK 740
            SV +  M  C  + + G N S+ C +V+    C  ++G+L+Y E  +C F   ++P  + +     L L L +  TA  FF P L  ++  L++S N+AGVT LA GNGA D+FS+L A   S+    GLA+G++ GAG+LV T+ AG I I+ PF    RP ++DI FY++A+      L   +I    ++ +L +Y+ YV    I   +Y + + 
Sbjct:   44 SVNQTAMADC--RAVCGLNTSDRCDFVRRNPDCRSEAGYLDYLEGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNLSAISTNLKLSHNVAGVTFLAFGNGAPDIFSALVAF--SDPRTAGLAIGALFGAGVLVTTVVAGGITILHPFMAASRPFLRDIAFYMVAVFLTFTALYLGRITLTWALGYLGLYVFYVVTVIICTWVYQRQRS 256          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Mouse
Match: Slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:MGI Symbol;Acc:MGI:2180781])

HSP 1 Score: 105.916 bits (263), Expect = 2.731e-23
Identity = 67/193 (34.72%), Postives = 105/193 (54.40%), Query Frame = 3
Query: 1449 PVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPI-GTDGFIVTYXXXXXXXXXXXSVAITSKSN-SPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGI 2021
            P+D   W   S+  ++L +V+ P+ F+L LT+ VV+ D   + W + LNCL  V+SPL+ +  +   +  I    G +  + +++I   A  SV   + SN  PP     FAF+GF+TS  WI     E+VN+L +LGV+F +  T+LGL++LA+ NS+G     IT        +    C  GP  +LL G+
Sbjct:  311 PLDYRKWRTQSISWRVLKVVKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGIYEIGGLLPVWAVVVIVGTALASVTFFATSNREPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGNSIGAGARRIT-------GVGAGQCP-GPQLDLLPGL 495          

HSP 2 Score: 104.375 bits (259), Expect = 9.398e-23
Identity = 76/217 (35.02%), Postives = 120/217 (55.30%), Query Frame = 3
Query:   96 SVPRKVMESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTIXXXXX--XXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKK 740
            SV +  M  C  + + G N S+ C +V+    C  ++G+L+Y E  +C F   ++P  + +     L L L +  TA  FF P L  ++  L++S N+AGVT LA GNGA D+FS+L A   S+    GLA+G++ GAG+LV T+ AG I I+ PF    RP ++DI FY++A+      L   +I    ++ +L +Y+ YV    I   +Y + + 
Sbjct:   44 SVNQTAMADC--RAVCGLNTSDRCDFVRRNPDCRSEAGYLDYLEGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNLSAISTNLKLSHNVAGVTFLAFGNGAPDIFSALVAF--SDPRTAGLAIGALFGAGVLVTTVVAGGITILHPFMAASRPFLRDIAFYMVAVFLTFTALYLGRITLTWALGYLGLYVFYVVTVIICTWVYQRQRS 256          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Mouse
Match: Slc24a4 (solute carrier family 24 (sodium/potassium/calcium exchanger), member 4 [Source:MGI Symbol;Acc:MGI:2447362])

HSP 1 Score: 71.2478 bits (173), Expect = 3.090e-12
Identity = 51/172 (29.65%), Postives = 99/172 (57.56%), Query Frame = 3
Query: 1725 VAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTVVLVFTIS-LVTTMNLIVLPIL--KFRVNKIYGIILLTIYIVF--FILIISF 2225
            + +T  + S P ++ FF  + FIT+  WI      +V ++  +G    IP  I+G++ LA   SV D ++++ +A++    +A +  IG  +F++LVG+G+P+ ++T        +K ++  LV+++  L+ ++ L VL I   K+R+++  GI +L +Y VF  F ++I F
Sbjct:  437 LCVTIPNCSKPRWEKFF-MVTFITATLWIAVFSYLMVWLVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNTIGSNVFDILVGLGIPWGLQTMVINYGSTVKINSRGLVYSVVLLLGSVALTVLGIHLNKWRLDRKLGIYVLVLYAVFLCFSIMIEF 607          
BLAST of mitochondrial sodium/calcium exchanger protein vs. UniProt/SwissProt
Match: sp|Q6J4K2|NCLX_HUMAN (Mitochondrial sodium/calcium exchanger protein OS=Homo sapiens OX=9606 GN=SLC8B1 PE=1 SV=2)

HSP 1 Score: 170.244 bits (430), Expect = 1.315e-43
Identity = 106/306 (34.64%), Postives = 176/306 (57.52%), Query Frame = 3
Query: 1323 ISDVQNQRTESNLSRILQSNRNDDSSFLTF-PGTFKHFLLTIL-PVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPI-GTDGFIVTYXXXXXXXXXXXSVAITSKSNS-PPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTV---VLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILII 2219
            +SD +  R  SN +     +  D+   L F   T    L+  L P+D   W R S + K L + + P+ F+L LT+ VV+ D   + W + LNCLH V+SPL+ +  +      +    G +  +++++I   A  SV   + S+S PP     FAF+GF+TS  WI     E+VN+L +LGVVF +  T+LGL++LA+ NS+GD  S+ TLA++ YPR+A++AC GG +FN+LVG+GL   ++ ++    + L+ D +   VL   + L    +L+ +P+  F+++++YG  LL  Y+ F ++ +
Sbjct:  270 LSDSEEDRVSSNTN---SYDYGDEYRPLFFYQETTAQILVRALNPLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNCLHLVISPLVVVLTLQSGTYGVYEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTEVKLEPDGLLVWVLAGALGLSLVFSLVSVPLQCFQLSRVYGFCLLLFYLNFLVVAL 572          

HSP 2 Score: 114.775 bits (286), Expect = 3.496e-25
Identity = 83/249 (33.33%), Postives = 136/249 (54.62%), Query Frame = 3
Query:  132 KNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVP--TIXXXXXXXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTNTVIFNNDR-RLDSSKCKANKNCSHDPL 869
            + + G N S+ C +++    C  D G+L+Y E  +C F   ++P    L + W L L L +  TA  FF P L  ++  L++S N+AGVT LA GNGA D+FS+L A   S+    GLALG++ GAG+LV T+ AG I I+ PF    RP  +DI+FY++A+    ++L R ++    ++ +L +Y+ YV    +   +Y      Q+Q R      + VT  ++ +++  R+ S+    +    + PL
Sbjct:   54 RKVCGLNVSDRCDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSALVAF--SDPHTAGLALGALFGAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWALGYLGLYVFYVVTVILCTWIY------QRQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYRPL 294          
BLAST of mitochondrial sodium/calcium exchanger protein vs. UniProt/SwissProt
Match: sp|Q925Q3|NCLX_MOUSE (Mitochondrial sodium/calcium exchanger protein OS=Mus musculus OX=10090 GN=Slc8b1 PE=2 SV=2)

HSP 1 Score: 168.318 bits (425), Expect = 4.920e-43
Identity = 95/263 (36.12%), Postives = 160/263 (60.84%), Query Frame = 3
Query: 1449 PVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPI-GTDGFIVTYXXXXXXXXXXXSVAITSKSN-SPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPIL-INLKSDTV---VLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILII 2219
            P+D   W   S+  ++L +V+ P+ F+L LT+ VV+ D   + W + LNCL  V+SPL+ +  +   +  I    G +  + +++I   A  SV   + SN  PP     FAF+GF+TS  WI     E+VN+L +LGV+F +  T+LGL++LA+ NS+GD  S+ TLA++ YPR+A++AC GG +FN+LVG+GL   ++  +  ++ + L+ D +   VL   + L    +L+ +P+  F+++K YG+ LL  YI F ++++
Sbjct:  311 PLDYRKWRTQSISWRVLKVVKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGIYEIGGLLPVWAVVVIVGTALASVTFFATSNREPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQIIRNHVVEVKLEPDGLLVWVLASALGLSLIFSLVSVPLQCFQLSKAYGLCLLLFYICFLVVVL 573          

HSP 2 Score: 103.99 bits (258), Expect = 9.197e-22
Identity = 76/217 (35.02%), Postives = 120/217 (55.30%), Query Frame = 3
Query:   96 SVPRKVMESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTIXXXXX--XXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKK 740
            SV +  M  C  + + G N S+ C +V+    C  ++G+L+Y E  +C F   ++P  + +     L L L +  TA  FF P L  ++  L++S N+AGVT LA GNGA D+FS+L A   S+    GLA+G++ GAG+LV T+ AG I I+ PF    RP ++DI FY++A+      L   +I    ++ +L +Y+ YV    I   +Y + + 
Sbjct:   44 SVNQTAMADC--RAVCGLNTSDRCDFVRRNPDCRSEAGYLDYLEGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNLSAISTNLKLSHNVAGVTFLAFGNGAPDIFSALVAF--SDPRTAGLAIGALFGAGVLVTTVVAGGITILHPFMAASRPFLRDIAFYMVAVFLTFTALYLGRITLTWALGYLGLYVFYVVTVIICTWVYQRQRS 256          
BLAST of mitochondrial sodium/calcium exchanger protein vs. UniProt/SwissProt
Match: sp|Q6AXS0|NCLX_RAT (Mitochondrial sodium/calcium exchanger protein OS=Rattus norvegicus OX=10116 GN=Slc8b1 PE=1 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 8.383e-43
Identity = 97/263 (36.88%), Postives = 158/263 (60.08%), Query Frame = 3
Query: 1449 PVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPI-GTDGFIVTYXXXXXXXXXXXSVAITSKSNS-PPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPI-LINLKSDTV---VLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILII 2219
            P+D   W   S+  K+L + + P+ F+L LT+ VV+ D   + W + LNCL  V+SPL+ +  +   +  I    G +  + +++I   A  SV   + SNS PP     FAF+GF+TS  WI     E+VN+L +LGVVF +  T+LGL++LA+ NS+GD  S+ TLA++ YPR+A++AC GG +FN+LVG+GL   ++  +     + L+ D +   VL   + L    +L+ +P+  F+++K YG+ LL  YI F ++++
Sbjct:  311 PLDYRKWRTQSISCKLLKVAKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGIYEIGGLLPVWAVVVIVGTALASVTFFATSNSEPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQIVRSHASEVKLEPDGLLVWVLASALGLSLVFSLVSVPLQCFQLSKAYGLCLLLFYICFIVVVL 573          

HSP 2 Score: 98.5969 bits (244), Expect = 4.449e-20
Identity = 74/217 (34.10%), Postives = 117/217 (53.92%), Query Frame = 3
Query:   96 SVPRKVMESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTIXXXXX--XXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKK 740
             V +  M  C  + +   N S+ C +VK    C  + G+L+Y +  +C F   ++P  + +     L L L +  TA  FF P L  ++  L++S N+AGVT LA GNGA D+FS+L A   S+    GLA+G++ GAG+LV T+ AG I I+ PF    RP ++DI FY++A+      L   +I    ++ +L +Y+ YV    I   +Y + + 
Sbjct:   44 GVNQTAMADC--RAVCSLNTSDRCDFVKRNPDCHSEGGYLDYLKGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNLSAISTSLKLSHNVAGVTFLAFGNGAPDIFSALVAF--SDPRTAGLAIGALFGAGVLVTTVVAGGITILRPFMAASRPFLRDITFYMVAVFLTFTALYLGRITLVWALGYLGLYVFYVVTVIICTWVYQRQRS 256          
BLAST of mitochondrial sodium/calcium exchanger protein vs. UniProt/SwissProt
Match: sp|P34322|NCX7_CAEEL (Putative sodium/calcium exchanger 7 OS=Caenorhabditis elegans OX=6239 GN=ncx-7 PE=3 SV=3)

HSP 1 Score: 158.303 bits (399), Expect = 3.205e-39
Identity = 95/266 (35.71%), Postives = 152/266 (57.14%), Query Frame = 3
Query: 1455 DLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMN-PIGTDGFIVTYXXXXXXXXXXXSVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPIL---INLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLI 2240
            + +DW  +++F K++A +      +  LTI + E       W K L  LH    P   +  I   +  P      +  Y + +  +LA + +  T  S  P  Y+  +++ GFI SI WIY I +E+VNV+  LGVV  +   +LGL+ILA++NS+GDL++++++ K+ YPR+A AA IGGPLFNLL+G GLPF+I   Q   +   IN     ++L   ISL+ T  LI +P+ KFR+ + +  +L++IYI F + +I   T ++
Sbjct:  411 EAEDWEEMNIFSKVMAYINVVPNLLFKLTIPLNE-----MSWSKPLTLLHAFTCPAFLLFSIQFFLETPFSGSPGLWVYGLAVSIVLAILIMVFTELSVQPKYYKEIYSYSGFIMSIAWIYLISSEVVNVVTMLGVVSRVSHEVLGLTILAWSNSIGDLIADVSVVKQGYPRMAMAAAIGGPLFNLLMGFGLPFTIAKLQGKYISMTINPTYRLLILFLAISLLAT--LIGIPVQKFRLQRPHAAVLISIYIAFIVFVILSETGVL 669          

HSP 2 Score: 99.7525 bits (247), Expect = 2.712e-20
Identity = 71/201 (35.32%), Postives = 120/201 (59.70%), Query Frame = 3
Query:  165 CQYVK-NVSACLFDSGFLNYFEWQYCGFD--SRIVPTIXXXXXXXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTI-ILLRRKIEFWSSIVFLSIYIVYVFVTAISRALY-LKLKKCQKQ 752
            C YV  N +AC    G+L + ++  C     SR++  I+ +++ LVL + V++ AD FF+P +  +   LR+S+++AGVT +A GNGA DVF S++++LSS  P   LALG + G G+ V T+    I++  PF++     I+D++FYL+AL +     +   ++  W  + FL +Y++YV     ++A++  K K  QKQ
Sbjct:   56 CDYVNCNDNACE-GGGYLLWTQYVECASSTFSRVILIIVGVIYMLVLFIMVSSAADDFFSPSISSIVAHLRISESVAGVTFMAFGNGAPDVFGSIASVLSSPTPKADLALGELFGGGLFVTTMVVSTIILTSPFDVEVFSTIRDLLFYLVALSFLAFCFVFYNRVTLWMPLTFLGLYLLYVITVIGAQAVHNRKRKALQKQ 255          
BLAST of mitochondrial sodium/calcium exchanger protein vs. UniProt/SwissProt
Match: sp|P34315|NCX6_CAEEL (Putative sodium/calcium exchanger 6 OS=Caenorhabditis elegans OX=6239 GN=ncx-6 PE=3 SV=3)

HSP 1 Score: 155.992 bits (393), Expect = 1.029e-38
Identity = 93/257 (36.19%), Postives = 154/257 (59.92%), Query Frame = 3
Query: 1458 LDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHV-NMNPIGTDGFIVTYXXXXXXXXXXXSVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQK---PILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILI 2216
            +D+W  +++F+K++A++ +   F+  LTI   E+      W K +  L C++ P+  +  I V +++P      +  Y +++  LL    +  T     PP Y+   ++ GF+ SI WIY I +E+VNV+  LGVV  +   +LGL+ILA++NS+GDL++++++AK+ YPR+A AA IGG LFNLL+G GLPF+I   Q     ++IN     ++L   ISL+ T  LI +   K+ + +I+   L+ IYI FF+ I
Sbjct:  330 MDEWDEMNIFQKVIAVLNTIPNFLFKLTIPHSEQP-----WSKPITLLQCLICPVFLLFCIQVCSISPFPNSPGLWMYGLILSVLLTAAVLFFTELHKEPPFYKSLISYAGFLMSIAWIYLISSEVVNVVTMLGVVSRVSHEVLGLTILAWSNSIGDLIADVSVAKQGYPRMAMAAAIGGQLFNLLIGFGLPFTIAKIQGKSISMIINPTYRLLMLFLAISLIFT--LIAMFAQKYFLRRIHSYSLVFIYISFFVFI 579          

HSP 2 Score: 98.2117 bits (243), Expect = 5.952e-20
Identity = 73/229 (31.88%), Postives = 125/229 (54.59%), Query Frame = 3
Query:  114 MESCNPKN------ITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDS--RIVPTIXXXXXXXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILL-RRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENI 773
            +E C P +        G N +  C+YVK         G++ +  +  C      RI+  I  +++ LVL + V++ AD FF+P +  +   LR+S+++AGVT +A GNGA DVF +++++LSS  P   LALG + GAG+ V T+   + +   PF+      I+DI FYL+AL +     +    +E W  I FL +Y++YV    +S+ L+ + KK +++   ++ +
Sbjct:   42 IEKCIPDDGEQCTIQAGWNSTQVCEYVKCNDDNCEGGGYVLWTRYVECASSPAVRIILIITGVIYMLVLFIMVSSAADDFFSPSISSIVAHLRISESVAGVTFMAFGNGAPDVFGAIASVLSSPTPKADLALGELFGAGLFVTTMVLAVTIFTRPFKAEVFSSIRDIAFYLVALAFLAFCFVYYDHVEIWMPITFLGVYLIYVCTVILSQILHNRHKKDEEKVDEVKTV 270          
BLAST of mitochondrial sodium/calcium exchanger protein vs. TrEMBL
Match: A0A0H3YF40 (Slc24a-5 OS=Schmidtea mediterranea OX=79327 GN=slc24a-5 PE=2 SV=1)

HSP 1 Score: 659.062 bits (1699), Expect = 0.000e+0
Identity = 398/734 (54.22%), Postives = 506/734 (68.94%), Query Frame = 3
Query:  114 MESCNPKNITGTNYSNE--CQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTIXXXXXXXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTNTVIFNNDRRLDSSKCKANKNCSHDPLNNGQINASYLNENAGEFLKVPQYNQLNR---KLNNPTRSAEASVVDIRTSFHRCSRKPIYSSLNLTRVRSTSHRSMGSFAKIIIKNEHEREIMXXXXXXXXXXXXXXXXXXLSALNDCSVPKL--KIRFYSAD---------TNMAARRIEEFKNIAVEKLKKKSISDVQNQRTESNLSRILQSNRNDDSSFLT----FPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIGTDGFIVTYXXXXXXXXXXXSVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQ-KPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLINVTI 2252
            MESCNPKN T     NE  C YV N  +C FDSGF+NYF+WQ+CGFD+RI+PTILM LWFLVLLL+VA TADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSA++S+++PNV LALGSILGAGILVNT+TAGIIMII PF++MRRPIIKD+IFYL+ALLWC  IL+RR+IE WSS+VFL IY++YV VT +SRA+Y+K K+                              K    ++  H    +G  N  Y  EN      V   N LN     L +P     ++    R   +  S  P+  S    R+ S  +R+MGS AKIII+NE+ +EI++    +   +        LS       PK   + RF S D         T    R+I+EF++ A     K +I   +NQ  +S++   L ++   D    T    FPG FKHFL+ I+P++ ++W   S+F K+L+++QSPIMFILTLTI VVEE+ +LKGWCK+LNCLHC+LSPLIWITFI  +  P+G+ GFI+ +L+LIIG+ A IS AITSK+N+PP Y   FAF+GF+TSIFWIY I NEIVN+L T GVV SIPQTILGL+ILAFANS+GDLVSNI LA++ +PRIAYAACIGGPLFNLLVGIGLPFSI  A+   I + LKS+T+VL+ TI L+T MNLI LP+++FR+  +YGII++ IY++F + ++ FATN+I VT+
Sbjct:    1 MESCNPKNKT----FNESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIPTILMFLWFLVLLLAVAVTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNVSLALGSILGAGILVNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWSSVVFLIIYVIYVTVTGVSRAIYVKQKR-----------------------------GKLTTQEDTQHKKDESGS-NIQYSRENRAYINDVEPCNSLNSLPSSLQSPNSLTNSNQDSER---NHLSLIPM-QSFRSKRIPSIRNRTMGSIAKIIIENEYHKEILEAKKNMNRKRS-------LSLDLATEKPKFNNRKRFISLDQENLKEIKKTEKENRKIKEFQSPA----PKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSETIVLISTILLITIMNLIYLPVMRFRLRPVYGIIMIVIYVLFLLFVLLFATNVIKVTL 685          
BLAST of mitochondrial sodium/calcium exchanger protein vs. TrEMBL
Match: A0A0H3YFD7 (Slc24a-7 OS=Schmidtea mediterranea OX=79327 GN=slc24a-7 PE=2 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 1.072e-119
Identity = 222/438 (50.68%), Postives = 294/438 (67.12%), Query Frame = 3
Query:  942 QLNRKLNNPTRSAEASVVDIRTSFHRCSRKPIYSSLNLTRVRSTSHRSMGSFAKIIIKNEHEREIMXXXXXXXXXXXXXXXXXXLSALNDCSVPKLKIRFYSADTNMAARRIEEFK-NIAVEKLKKKSISDVQNQRTESNLSRILQSNRNDDSSFLTFPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIGTDGFIVTYXXXXXXXXXXXSVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLINVTI 2252
            QL R  N  T  +E    ++    + CS K    S   +  RS SHRS+ S AKIII NEHE+E M+ +   K +      S  L+ LN+ ++ K  IR++S       R I++ K +I  E    +    V  +    N   I ++  N DS  +TFPG +KHF LTILPVDL++W   S F K L+I+QSP MFILTLTI +V+E  +LKGWCKILNC+HC+LS + W+   +V   P GT  F++ YL +I+G + G+ VA TSK + PPIYQPFFAF+G ITSI WIYEI NEIVN+L   GVVF+I   ILGLS+LAFANS GDLVSN+TLAK NYPRI Y+AC+GGPLFNLLVGIG+PFSI+T   PI + L   ++VL+FTI LVT +NL+ LP++KF+  + YGIIL+TIY+++F+L+I FA ++I VT+
Sbjct:  427 QLERFYN--TLPSERPSTEVNHLKYSCSIKQKNLSPRSSIERSASHRSIRSMAKIIIDNEHEKERMENHPTAKKANLIKSLS--LTVLNEYAL-KSNIRYWSM------REIQKAKSDITNEWDILEGNYKVHPENENENKFNI-ETGENGDS-VVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYLFIILGFIVGVVVAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 851          

HSP 2 Score: 252.677 bits (644), Expect = 1.255e-68
Identity = 134/225 (59.56%), Postives = 174/225 (77.33%), Query Frame = 3
Query:  114 MESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTIXXXXXXXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVT 788
            M +C P   +  NYSN C Y+ N   C  +SG +NY++WQYC F +R  P ILM LWFL LL  + T+ADSF APCLVVV K +RMS+NLAGVTLLALGNGAADVFSSLSA+ S++NPNVGLA G+ILGAG+ VN ITAGIIMI+ PF+IM+RPI+KD++FY +AL+WC II ++++IE WSS+VFL+IY++Y+ VT ISR LY++ +K  K      NI +++T
Sbjct:    1 MAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKSNKTIIQTNNISITIT 225          
BLAST of mitochondrial sodium/calcium exchanger protein vs. TrEMBL
Match: A0A0H3YKA1 (Slc24a-2 OS=Schmidtea mediterranea OX=79327 GN=slc24a-2 PE=2 SV=1)

HSP 1 Score: 375.555 bits (963), Expect = 7.466e-114
Identity = 235/519 (45.28%), Postives = 321/519 (61.85%), Query Frame = 3
Query:  732 LKKCQKQERPIENIEVSVTNTVIFNNDRRLDSSKCKANKNCSHDPLNNGQINASYLNENAGEFLKVPQYNQLNRKLNNPTRSAEASVVDIRTSFHRCSRKPIYSSLNLTRVRSTSHRSMGSFAKIIIKNEHEREIMXXXXXXXXXXXXXXXXXXLSALNDCSVPKLKIRFYSADTNMAARRIEEFKNIAVEKLKKKSISDVQNQ------------RTESNLSRILQSNRNDDSSFLTFPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIGTDGFIVTYXXXXXXXXXXXSVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLINVTI 2252
            +K+C   E  ++++ V  TN   +    RL +S+     +C H+   N +       +   ++L   Q+ +      N   S  +S++      H  S K  + S   +  RS+SHRS+GS A+III  EHE+E M+K+   K        S  L+ +N+  + K KIRF S   N                  +KS SD+ N+              E+     L++  N DS  +TFPG +KHF LTILPVDL++W   S F K L+I+QSP MFILTLTI +V+E  +LKGWCKILNC+HC+LS + W+   +V   P GT  F++ YL +I+G + G+ VA TSK + PPIYQPFFAF+G ITSI WIYEI NEIVN+L   GVVF+I   ILGLS+LAFANS GDLVSN+TLAK NYPRI Y+AC+GGPLFNLLVGIG+PFSI+T   PI + L   ++VL+FTI LVTT+NL+ LP++KF+  + YGIIL+ IYI++F+L+I FA ++I VT+
Sbjct:  411 IKECY--EDKLDHLNVPQTN---YQGKSRLVTSQ----HSCPHESECNAK-------KRVYDYLNSYQFERSYNSFENALPSLRSSIIGNHQK-HSYSIKRKHHSARNSMTRSSSHRSIGSLAQIIIDKEHEKERMEKHPTSKKITHFRSIS--LTIINESPL-KTKIRFRSMSEN------------------EKSKSDITNEWGIIKGNHKIPPENENENKFNLETGENGDS-VVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYLFIILGFIVGVVVAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTTLNLLCLPLMKFQPKRFYGIILIIIYIIYFVLVILFAVDIIKVTL 890          

HSP 2 Score: 255.758 bits (652), Expect = 1.747e-69
Identity = 153/285 (53.68%), Postives = 197/285 (69.12%), Query Frame = 3
Query:  114 MESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTIXXXXXXXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENI-------EVSVTNTVIFNNDRRLDSS----------KCKANKNCSHDPLNNGQINASYLNENAGE 917
            M+ C P N + +NYSN CQY+   S+C+ + GF+NYF+WQYC FD+R  PTILM+LWFL LL  +AT ADSF APCLVVV K +RMS+NLAGVTLLALGNGAADVFSSLSA+ S++NPNVGLA G ILGAGI VN+ITAGIIMII PF++M+RPIIKD +FY  AL+WC  I +RR+IE WSS+VFL +Y +Y+ VT ISR LY++  K +       N        +++V N  I   D R  S+          + KAN+N +   +NN +I  +  N+   +
Sbjct:    1 MDLCTPLNFSSSNYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTILMLLWFLFLLTGIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNVGLAFGGILGAGIFVNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRHIKSKATTIKTNNSNITIRTPDLNVENAEIQQKDNRDSSTSNSVLIFKDNRSKANQNIT---VNNIEITVTASNDEDDQ 282          
BLAST of mitochondrial sodium/calcium exchanger protein vs. TrEMBL
Match: A0A293N1M1 (Na+/Ca2+ exchanger (Fragment) OS=Ornithodoros erraticus OX=265619 PE=3 SV=1)

HSP 1 Score: 276.944 bits (707), Expect = 3.276e-79
Identity = 210/713 (29.45%), Postives = 356/713 (49.93%), Query Frame = 3
Query:  108 KVMESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDS-RIVPT-IXXXXXXXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTNTVIFNNDRRLDSSKCKANKNCSHDPLNNGQINASYLNENAGEFLKVPQYNQLNRKLNNPTRSAEASVVDIRTSF-----HRCSRKPIYSSLNLTRVRSTSHRSMGSFAKIIIKNEHEREIMXXXXXXXXXXXXXXXXXXLSALNDCSVPKLKIRFYSADTNMAARRIEEFKNIAVEKLKKKSISDVQNQRTESNLSRILQSNRNDDSSFLTFPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIGTDGFIVTYXXXXXXXXXXXSVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTVVLVFTISLVTTM--NLIVLPILKFRVNKIYGIILLTIYIVFFILII 2219
            ++ E C  +++   N S +C +V+    C  D  F+ Y  + YC F S    P  +++ +  L++ + +  TAD F AP L+V++  LR+SQN+AG+T LA GNGA D+ SSL+ I  +  P++ +      G    V  + AG I +   F+IM RP ++DIIFY+ A  W   I   +KI  + SI F+ +YI+++ V  +SR +Y ++K+                       +    + + K +++ +H    + Q+N     +  G +L  P     ++         E  V+  R SF     HR +R+P      +T V   +HR    F  +I  +E ER                             + +++ R   A +  + R      ++  +      I   Q   + S L  I  S    ++  L+     K   L ++P+DL+DWP  + + K   + ++PI FILTLT  VV+ +     WC++LNCLHCV+ P+  +    V  + +   GF V  ++++      ++V  TSK   PP Y   FA++GF  ++FWIY + NE+V++L  +G+V  +    LG+++LA+ NS+GD +SN+ +AK+ YPR+A +AC GGPL NLL+G G+P+++K  Q    +NLK   ++ V   ++  T+   L+V+ IL+F V + +G  LL +Y +F  + I
Sbjct:    6 ELAEVC--EHVHHFNVSEQCNFVRGCDQCQSDEQFIPYMTFVYCAFGSGNTAPALVVLTIALLIMFVGLGITADDFLAPALIVISDTLRLSQNIAGITFLAFGNGAPDIISSLAGIQQAR-PDLVIGELFGAGIY--VTCVVAGSICLTQDFKIMERPFLRDIIFYIGATYWAFFIFYTQKITLYHSIGFIILYIIFIIVVLMSRIVYQRMKE-----------------------NELAKAEEAKRSQSATHISAFHQQMNGPPDIDQTGNYLAPPIPPLFSKATYEEPEPEEMGVILRRFSFRESISHR-TRRP-----TITGVHLHNHRRNSIF--MITASEQER-----------------------------MAQIRSR---ASSKASTRS----GSVCTQSGIPPVILSPQATSSLSALVSIATSVEELEAPRLS---PLKELALHLMPIDLNDWPEKTWYGKFYEVCKAPIYFILTLTTPVVDYENDKNNWCRLLNCLHCVIGPVFILLVTGVVDSTVA--GFPVAVIVVLGATAVALTVFFTSKYEEPPRYHWAFAYLGFFVAVFWIYGLANEVVSLLKAVGIVIGLSDAFLGMTVLAWGNSIGDFISNLAVAKQGYPRMAISACYGGPLLNLLLGFGIPYTLKLVQIGGTLNLKWSKMIGVLYGTMCQTLVSTLVVMTILQFTVRRAFGAYLLAVYAIFLTVAI 641          
BLAST of mitochondrial sodium/calcium exchanger protein vs. TrEMBL
Match: A0A2R5L568 (Putative ca2+ antiporter (Fragment) OS=Ornithodoros turicata OX=34597 PE=3 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 6.818e-77
Identity = 209/704 (29.69%), Postives = 346/704 (49.15%), Query Frame = 3
Query:  150 NYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPT--IXXXXXXXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTNTVIFNNDRRLDSSKCKANKNCSHDPLNNGQINASYLNENAGEFLKVPQYNQLNRKLNNPTRSAEASVVDI---RTSF-----HRCSRKPIYSSLNLTRVRSTSHRSMGSFAKIIIKNEHEREIMXXXXXXXXXXXXXXXXXXLSALNDCSVPKLKIRFYSADTNMAARRIEEFKNIA--VEKLKKKSISDVQNQRTESNLSRILQSNRNDDSSFLTFPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIGTDGFIVTYXXXXXXXXXXXSVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTVVLVFTISLVTTM--NLIVLPILKFRVNKIYGIILLTIYIVFFILII 2219
            N S +C +V+    C  D  F+ Y  + YC F S   P   + +++  L + + +  TAD F AP L+V++  LR+SQN+AG+T LA GNGA D+ SSL+ I     P++ +      G    V  + AG I +   F+IM RP ++DIIFY+ A  W   I   +K+  + SI F+ +YI+++     SR +Y  +K     E+ +   E           + +L  SKC    +  H  +N  Q          G +L  P       K  +     E   + I   R SF     HR +R+P      +T V   +HR    F  +I  +E ER    ++     +          S  N   +P + +      +  AA  +    +IA  VE L+   +S +                              +   L +LP+DL++WP    + K+  + ++PI F+LTLT  VV+ +     WC++LN LHCV+SP+ +I  +   +N I   GF +  ++ ++     + V  TSK + PP Y   FA++GF  ++FWIY + NE+V++L T+G+V  +    LG+++LA+ NS+GD +SN+ +A++ YPR+A +AC GGPL NLL+G G+P+++K  Q   ++ L+   ++ V   ++  T+   L+V+ IL+F V + +G  LL +Y  +  + I
Sbjct:    8 NSSEQCAFVRGCQQCQEDEQFIPYMTFVYCAFGSGNTPPALVCLVIALLTMFVGLGITADDFLAPALIVISDTLRLSQNIAGITFLAFGNGAPDIISSLAGI-QQARPDLVIGELFGAGIY--VVCVVAGSICLTQDFKIMERPFLRDIIFYIGATYWAFYIFYTQKMTLYHSIGFIILYIMFIAFVVTSRVVYQHMK-----EKELAKAE-----------EAKL--SKCSQQISTIHQQMNGDQ---------TGNYLAPPPVPLTFSKAAHEEPEPEPEDMGIMLRRFSFRESISHR-TRRP-----TVTGVHLHNHRRNSIF--MITASEQERMAQIRSRASSKASSRRD-----SVSNQNGMPAVML------SPQAASSLSALVSIAASVEDLEAPQLSPL------------------------------RELGLHLLPIDLNEWPEKKWYGKLYEVCKAPIYFVLTLTTPVVDYENDKNNWCRLLNSLHCVISPM-FILLVTQVVN-ITVAGFPIAVIVFLVAACLALVVFFTSKYDEPPKYHWIFAYLGFFVAVFWIYGLANEVVSLLKTVGIVIGLSDAFLGMTVLAWGNSIGDFISNLAVARQGYPRMAISACYGGPLLNLLLGFGIPYTLKLVQTGGVLRLRWSNMIAVLYGTICQTLVSTLVVMTILRFTVRRAFGAYLLVVYATYLTVAI 630          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Cavefish
Match: slc8b1 (solute carrier family 8 member B1 [Source:NCBI gene;Acc:103022341])

HSP 1 Score: 152.14 bits (383), Expect = 1.893e-38
Identity = 106/305 (34.75%), Postives = 172/305 (56.39%), Query Frame = 3
Query: 1329 DVQ-NQRTESNLSRILQSNRNDDSSFLTF-PGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWI-TFI--HVNMNPIGTDGFIVTYXXXXXXXXXXXSVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTV---VLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILII 2219
            D+Q +     N++  LQ +  +    ++F   T K FL +I PVD   W R     + L I+Q P   +L LT+ VV+ D     W + LNCLH +  PL+ + TF   H  +  I  D F V  L  +IG+     V  T+ +  PP Y   F+ +GF+ S  WI  + +EIV+VL  LG+V S+  T+LGL++LA+ NS+GD  S+IT+A++ YPR+A +AC GG +FN+L G+GL   ++     +++ L+ + +   VL   + L   ++ +++P+ +F +N+ YGI LL  Y  F ++ +
Sbjct:  279 DIQASDYYRENINGTLQEHEAEYEPLISFTETTSKIFLKSISPVDTRIWRRSHWAWRALKIIQLPFEVVLLLTVPVVDTDKEDHNWKRPLNCLHIITGPLVCVLTFQSGHYGLYLIQGD-FPVWLLTALIGVFLSGIVFCTTNNERPPPYHFLFSLLGFVVSALWISTVASEIVSVLHLLGIVLSLSNTVLGLTLLAWGNSIGDCFSDITIARQGYPRMAISACFGGIIFNMLFGVGLGCLLQMFHNGVVM-LEPEGLLGWVLSGALGLSLVLSFVLVPLQRFHLNRAYGIFLLIFYAAFLVVAL 581          

HSP 2 Score: 112.079 bits (279), Expect = 2.404e-25
Identity = 81/240 (33.75%), Postives = 137/240 (57.08%), Query Frame = 3
Query:  156 SNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPT--IXXXXXXXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTNTVIFNNDRRLDSSKCKANKNCSHDPL 869
            ++ C++V N   C  + GF+NY +  +C     ++P    L I+W LV+ L +   A  FF P L  ++  LR++ N+AGVT LALGNGA DVFS+++A   S     GLA+G++ GAGI V T+ AG + ++ PF +  RP ++DIIFY+ A+ W   IL +  I+   ++ +L +Y++YV    +S   Y+  ++ +    P++N EV+  N +  ++  R + +         ++PL
Sbjct:   71 ADRCEFVLNTPDCAAEGGFINYPKITFCLLAPNLLPLAIFLYIVWLLVMFLVLGLIASQFFCPNLSAISSTLRLTHNVAGVTFLALGNGAPDVFSAMAAF--SRPQTAGLAIGALFGAGIFVTTVVAGSVTLVKPFTVASRPFLRDIIFYMAAVFWTFTILYKGWIDLKEALGYLGLYVLYVITVVVST--YIYRRRTRSLRGPLQNSEVA--NDIQASDYYRENINGTLQEHEAEYEPL 304          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Cavefish
Match: SLC24A2 (solute carrier family 24 member 2 [Source:NCBI gene;Acc:103026719])

HSP 1 Score: 70.4774 bits (171), Expect = 3.332e-12
Identity = 52/228 (22.81%), Postives = 103/228 (45.18%), Query Frame = 3
Query:  303 SVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTNTVIFNNDRRLDSSKCKANKNCSHDPLNNGQINASY----------LNENAGEFLKVPQYNQLNRK 956
            ++A   D FF P L V+T+ L +S ++AG T +A G  A ++F+S+  +  S++ NVG+          ++  I    +       +   P+ +D+ FY++ L+   +  L   I +W SI  L+ Y  YV     +  + + +K    + + +E +E     + +  +D    S+K +  +  S   L+N  +  S           L+E  G + K+  Y+ +  +
Sbjct:  120 ALAIVCDEFFVPALTVITEKLAISDDVAGATFMAAGGSAPELFTSVIGVFISHS-NVGIGTIVGSAVFNILFVIGMCAVFSKEILNLTWWPLFRDVSFYILGLIMLIVFFLDNYISYWESIALLTAYACYVIFMKYNGQVEMFIKGLINRNQVVEVVEAPPKVSPVAVDDESKVSAKPRLQRGGSSASLHNSLMRNSIFQLMIHTLDPLSEELGTYGKLKYYHSMTEE 346          

HSP 2 Score: 57.7658 bits (138), Expect = 3.121e-8
Identity = 39/165 (23.64%), Postives = 88/165 (53.33%), Query Frame = 3
Query: 1755 PIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLP---FSIKTAQKPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLI 2240
            P  + FF  + F+ +I WI      +V     +G    I + I+GL++LA   S+ DL++++ +A++    +A ++ +G  +F++ VG+  P   +S+    KPI+++  +     +  + L+    +I +   K++++K+ G I+  +Y+VF ++ +     +I
Sbjct:  446 PTSKKFFP-ITFLGAICWIAAFSYLMVWWAHQVGETIGITEEIMGLTMLAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPFPWLLYSLINGLKPIVVS-SNGLFCAIVLLFLMLLFVIISIAACKWKMSKLLGFIMFLLYLVFLVVSVMLEDKII 608          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Cavefish
Match: slc24a3 (solute carrier family 24 member 3 [Source:NCBI gene;Acc:103023188])

HSP 1 Score: 69.3218 bits (168), Expect = 8.397e-12
Identity = 46/162 (28.40%), Postives = 93/162 (57.41%), Query Frame = 3
Query: 1755 PIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTA--QKPILINLKSDTVVLVFTISLVTT-MNLIVLPILKFRVNKIYGIILLTIYIVF--FILIISF 2225
            P ++ +F F  FI+S  WI      +V ++  +G    IP  I+G++ LA   SV D ++++ +A++    +A +  IG  +F++LVG+GLP++++T       +I+L S  +++   + L +  + ++ + + K+ ++K  GI+ L +Y VF  F ++I F
Sbjct:  462 PRWERWFMFT-FISSTLWIAGFSYIMVWMVTVIGFTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNSIGSNVFDILVGLGLPWALQTLAIDYGSVIHLNSRGLIISVGLLLASVFLTVLGVHLNKWTLDKRLGILCLLMYAVFLCFSILIEF 622          

HSP 2 Score: 52.373 bits (124), Expect = 1.555e-6
Identity = 37/167 (22.16%), Postives = 81/167 (48.50%), Query Frame = 3
Query:  303 SVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNP----NVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTN 791
            ++A   D +F P L  + + L +S+++AG T +A G+ A ++F+S+  +  +        +  +    +   I V  I AG  + +  + +MR     D  +Y I++    + +   K+ +W S+V + +Y+VY+ +   +  +   L++ +K    + N   S T+
Sbjct:  115 ALALVCDDYFVPSLEKICERLHLSEDVAGATFMAAGSSAPELFTSVIGVFITKGDVGVGTIVGSAVFNILCIIGVCGIFAGQAVRLSCWTLMR-----DSTYYTISVTTLIVFIYDEKVTWWESLVLILMYLVYILIMKCNSRVVHYLERRKKNSTNLGNGTASNTD 276          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Cavefish
Match: slc24a3 (solute carrier family 24 member 3 [Source:NCBI gene;Acc:103023188])

HSP 1 Score: 68.5514 bits (166), Expect = 1.606e-11
Identity = 46/162 (28.40%), Postives = 93/162 (57.41%), Query Frame = 3
Query: 1755 PIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTA--QKPILINLKSDTVVLVFTISLVTT-MNLIVLPILKFRVNKIYGIILLTIYIVF--FILIISF 2225
            P ++ +F F  FI+S  WI      +V ++  +G    IP  I+G++ LA   SV D ++++ +A++    +A +  IG  +F++LVG+GLP++++T       +I+L S  +++   + L +  + ++ + + K+ ++K  GI+ L +Y VF  F ++I F
Sbjct:  424 PRWERWFMFT-FISSTLWIAGFSYIMVWMVTVIGFTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNSIGSNVFDILVGLGLPWALQTLAIDYGSVIHLNSRGLIISVGLLLASVFLTVLGVHLNKWTLDKRLGILCLLMYAVFLCFSILIEF 584          

HSP 2 Score: 51.9878 bits (123), Expect = 2.165e-6
Identity = 37/167 (22.16%), Postives = 81/167 (48.50%), Query Frame = 3
Query:  303 SVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNP----NVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTN 791
            ++A   D +F P L  + + L +S+++AG T +A G+ A ++F+S+  +  +        +  +    +   I V  I AG  + +  + +MR     D  +Y I++    + +   K+ +W S+V + +Y+VY+ +   +  +   L++ +K    + N   S T+
Sbjct:   77 ALALVCDDYFVPSLEKICERLHLSEDVAGATFMAAGSSAPELFTSVIGVFITKGDVGVGTIVGSAVFNILCIIGVCGIFAGQAVRLSCWTLMR-----DSTYYTISVTTLIVFIYDEKVTWWESLVLILMYLVYILIMKCNSRVVHYLERRKKNSTNLGNGTASNTD 238          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Cavefish
Match: SLC24A2 (solute carrier family 24 member 2 [Source:NCBI gene;Acc:103026719])

HSP 1 Score: 68.1662 bits (165), Expect = 2.056e-11
Identity = 46/191 (24.08%), Postives = 90/191 (47.12%), Query Frame = 3
Query:  303 SVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTNTVIFNNDRRLDSSKCKANKNCSHDPLNN 875
            ++A   D FF P L V+T+ L +S ++AG T +A G  A ++F+S+  +  S++ NVG+          ++  I    +       +   P+ +D+ FY++ L+   +  L   I +W SI  L+ Y  YV     +  + + +K    + + +E +E     + +  +D    S+K +  +  S   L+N
Sbjct:  120 ALAIVCDEFFVPALTVITEKLAISDDVAGATFMAAGGSAPELFTSVIGVFISHS-NVGIGTIVGSAVFNILFVIGMCAVFSKEILNLTWWPLFRDVSFYILGLIMLIVFFLDNYISYWESIALLTAYACYVIFMKYNGQVEMFIKGLINRNQVVEVVEAPPKVSPVAVDDESKVSAKPRLQRGGSSASLHN 309          

HSP 2 Score: 58.151 bits (139), Expect = 2.663e-8
Identity = 39/165 (23.64%), Postives = 88/165 (53.33%), Query Frame = 3
Query: 1755 PIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLP---FSIKTAQKPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLI 2240
            P  + FF  + F+ +I WI      +V     +G    I + I+GL++LA   S+ DL++++ +A++    +A ++ +G  +F++ VG+  P   +S+    KPI+++  +     +  + L+    +I +   K++++K+ G I+  +Y+VF ++ +     +I
Sbjct:  451 PTSKKFFP-ITFLGAICWIAAFSYLMVWWAHQVGETIGITEEIMGLTMLAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPFPWLLYSLINGLKPIVVS-SNGLFCAIVLLFLMLLFVIISIAACKWKMSKLLGFIMFLLYLVFLVVSVMLEDKII 613          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Sea Lamprey
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 144.821 bits (364), Expect = 3.672e-38
Identity = 96/277 (34.66%), Postives = 155/277 (55.96%), Query Frame = 3
Query: 1416 GTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTI---SVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVN---MNPIGTDGFIVTYXXXXXXXXXXXSVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGL-------PFSIKTAQKPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFF 2207
            G    FLL++ P+D  +W R     ++L +V  P+  +L LT+   +V+ ED   + W + LNCL  +  PL  +  ++     M P+G  G +  + +++        VA  + S  PP +Q  FA +GF+ S  W+  I NE+VN+L T GVVF I  T+LGL++LA+ NSV D V++IT+A++ YPR+A +AC GG +FN+LVGIGL       P  ++ AQ   L+       VL  ++ +   ++ + LP+  F + + YG+ L  +Y+ F 
Sbjct:   82 GKLYRFLLSLSPLDPAEWRRRGYIWRLLKVVVLPVELLLILTVPVMNVMHED---RKWNRPLNCLQLMTGPLAALYSLNGGLYFMLPVG--GTLPLWSLILAIGCLLAVVAFITTSEQPPAFQLAFAVLGFVVSALWMNAIANEVVNLLQTFGVVFGISSTVLGLTLLAWGNSVPDFVADITMARQGYPRMAISACFGGIVFNILVGIGLGCLLSMPPSHMQQAQ---LVPDVPLVWVLCASLGISLVLSFVALPLQGFYLTRKYGVCLFALYLAFL 350          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Sea Lamprey
Match: slc24a1 (solute carrier family 24 member 1 [Source:ZFIN;Acc:ZDB-GENE-060503-191])

HSP 1 Score: 62.7734 bits (151), Expect = 1.859e-10
Identity = 43/139 (30.94%), Postives = 72/139 (51.80%), Query Frame = 3
Query:  303 SVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRR--------PIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYV 695
            ++A   D FF P L V+T+ L +S ++AG T +A G  A ++F+SL  +  S++ NV        G G +V +    I+ +I    +  R        P+ +D+ FY++ L    I  L   I++W S++ LS Y+ YV
Sbjct:   47 ALAIVCDEFFVPALGVITEKLAISDDVAGATFMAAGGSAPELFTSLIGVFISHS-NV--------GIGTIVGSAVFNILFVIGMCAVFSREILVLTWWPLFRDVSFYIVGLSMLIIFFLDNLIQWWESMLLLSCYVSYV 176          

HSP 2 Score: 55.4546 bits (132), Expect = 3.386e-8
Identity = 37/163 (22.70%), Postives = 82/163 (50.31%), Query Frame = 3
Query: 1773 FAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLP---FSIKTAQKPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLINVTI 2252
            F  + F  SI WI      +V     +G    I + I+GL+ILA   S+ DL++++ +A++    +A ++ +G  +F++ VG+ +P   FS+     P+ ++  +     +  + L+    ++ +   ++ +NK+ G  +  +Y VF I+ +   T  ++  +
Sbjct:  391 FFMVTFFGSILWIAIFSYLMVWWAHQVGETIGITEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPMPWLMFSLVKGFAPVQVS-SNGLFCAIVLLFLMLLFVILTIAACRWHMNKLLGFCMFLLYFVFLIISVMLETRTLHCPV 552          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Sea Lamprey
Match: slc24a4b (solute carrier family 24 member 4b [Source:ZFIN;Acc:ZDB-GENE-081031-75])

HSP 1 Score: 61.2326 bits (147), Expect = 5.709e-10
Identity = 40/151 (26.49%), Postives = 87/151 (57.62%), Query Frame = 3
Query: 1788 FITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTVVLVFTIS-LVTTMNLIVLPIL--KFRVNKIYGIILLTIYIVF--FILIISF 2225
            F+ S  WI      +V ++  +G    IP  I+G++ LA   SV D ++++ +A++    +A +  IG  +F++LVG+GLP++++T       +++ ++  L++++  L+ ++ + VL I    +++++  G+  L +Y VF  F ++I F
Sbjct:  383 FVISTIWIAVFSYVMVWMVTVIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNVFDILVGLGLPWALQTLLVDYGSHVEINSRGLIYSVVLLLASVGITVLGIYLNNWKLDRKLGLACLFVYAVFLCFSIMIEF 533          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Yeast
Match: YDL206W_mRNA (Putative protein of unknown function; YDL206W is not an essential protein [Source:SGD;Acc:S000002365])

HSP 1 Score: 71.2478 bits (173), Expect = 3.697e-13
Identity = 59/174 (33.91%), Postives = 84/174 (48.28%), Query Frame = 3
Query: 1728 AITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLP-FSIKTAQKPILINLKSDTVVLVFTISLVTTMNLI---------------VLPILKFRVNKIYGIILLTIYIV 2201
             I +K NS  I+      + F+ S+  + + V+ IV  L     VF+I +TILGL+I  + NS+GDLVSNIT  K     IA  AC G PL   L G+G     I    K   I    D+ +L+  I      NLI               ++P+  ++++K   I LLT+YIV
Sbjct:  581 TIPNKFNSDIIFT-----VAFLLSLACLSKAVHIIVVTLTHWINVFNISETILGLTIFTWGNSIGDLVSNITFVKIGVLEIAIGACFGSPLLYFLFGVGFDGIMIMLGDKTGKIVSGRDSNILMHHIDFKVDKNLINTGVGILIAFLIFTVLIPLNDWKIDKKISIALLTLYIV 749          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Yeast
Match: ECM27 (Protein involved in calcium homeostasis and exit from quiescence; required for proper trehalose levels during quiescence; may play a role in cell wall biosynthesis, mutants are hypersensitive to antifungal, Papulacandin B; null mutants have increased plasmid loss; interacts with Pdr5p [Source:SGD;Acc:S000003867])

HSP 1 Score: 49.2914 bits (116), Expect = 1.855e-6
Identity = 25/84 (29.76%), Postives = 44/84 (52.38%), Query Frame = 3
Query: 1818 IVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAY---------------AACIGGPLFNLLVGIG 2024
            + N ++ ++     +  + + ILGL+I A+ NSVGDL+SNI++ +    +  Y               A+C+GG + N + GIG
Sbjct:  545 LANSLIEMMEIYQKILGLSKAILGLTIFAWGNSVGDLISNISMCRLYKTQTHYQDRVRLATKFFMISCASCLGGVMLNSMGGIG 628          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Nematostella
Match: EDO31950 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWG6])

HSP 1 Score: 109.383 bits (272), Expect = 2.322e-25
Identity = 60/197 (30.46%), Postives = 101/197 (51.27%), Query Frame = 3
Query: 1443 ILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIGT------DGFIVTYXXXXXXXXXXXSVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLV 2015
            +LP    D+    +F K+  I+++P   +L +TI V++ D   + W K LN LH +  P+  +         +G         ++V Y       +   S            +   F ++ FI S+ WIY   NEIVN+L + G+V  +   ILGL+ LA+ NS+GDLV++ T+A++ +P +A  AC GGP+ ++L+
Sbjct:  236 VLPFTSADFELSGIFNKVFLILKAPAAVVLNVTIPVIDYDEPYQNWNKWLNVLHLITGPMFCVLATRAAKVSLGRLYKPPRCHWVVLYKPPRCHWVGFTSRQGFCSQIHKNCFLQMFGYLAFIVSVVWIYVTANEIVNILQSFGIVLGLSNAILGLTFLAWGNSIGDLVADTTMARQGFPNMATGACFGGPMLSILL 432          

HSP 2 Score: 100.908 bits (250), Expect = 1.259e-22
Identity = 68/208 (32.69%), Postives = 109/208 (52.40%), Query Frame = 3
Query:  165 CQYVKNVSACLFDSGFLNYFEWQYCGFDSRI-VPTIXXXXXXXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILS-SNNPNVXXXXXXXXXXXXXVNTITAGII--------MIICP--FEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQ 752
            C +V+  S C    GF+ Y  + YC     I +  +++ +  L L + +  TAD +F P L V++K LR+SQN+AGVT LA GNGA D+FS+++A+ + S NPN                 + AGI         + +C   F +  RP  +D++FYL A+ W  I + R++I    +I F+  Y  YV V  + R +  + K+ Q++
Sbjct:    1 CAFVQANSDCDLSDGFIQYIHFIYCKLPKAIPLALVILFVLMLFLFIVLGITADDYFCPSLTVISKTLRLSQNVAGVTFLAYGNGAPDIFSAIAAVSAHSKNPNAA--------------QLGAGIFVTTVVVGSVTLCTGGFHLNNRPFTRDVLFYLGAVSWMFITMYRQRITMLEAIGFIIFYFAYVVVVIVGRYVNQRWKRRQEE 194          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Nematostella
Match: EDO41421 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4I7])

HSP 1 Score: 65.4698 bits (158), Expect = 4.926e-11
Identity = 43/141 (30.50%), Postives = 75/141 (53.19%), Query Frame = 3
Query: 1788 FITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTVVLVFTISLVTTMNLIVLPIL--KFRVNKIYGIILLTIYIVF 2204
            F+ SIFWI      +V     +G  F IP  ++GL+ LA   SV DL++++ +A++ +  +A ++ IG  LF++ VG+ LP+   +A    L    S   +L   I L   +  +V+ I   ++R++K  G  +   YI+F
Sbjct:  491 FLMSIFWIAFFSYFMVWWATEVGYTFDIPTEVMGLTFLAAGTSVPDLITSVLVARKGFGDMAVSSSIGSNLFDITVGLPLPWLCYSAVNLGLAVNVSSRGILYSVIMLFCMLIAVVVSIAASRWRMSKSLGACMFVFYIIF 631          

HSP 2 Score: 56.225 bits (134), Expect = 3.393e-8
Identity = 38/132 (28.79%), Postives = 61/132 (46.21%), Query Frame = 3
Query:  303 SVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRK-IEFWSSIVFLSIYIVYV 695
            ++A   D FF P L V+ + L + +++AG T +A G  A ++F+S          NVG+          ++  I    +      E+   P+ +D IFY +AL+   I  L    I +W S+V L  Y  YV
Sbjct:  121 ALAIACDEFFVPSLTVIIEKLELKEDVAGATFMAAGGSAPELFTSFIGTFIDPKSNVGIGTIVGSAVFNVLFVIGMCAMFSKGVLELTWWPLFRDCIFYSLALIILIIFFLSGDVIVWWESLVLLLCYFAYV 252          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Nematostella
Match: EDO32048 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW69])

HSP 1 Score: 65.0846 bits (157), Expect = 5.728e-11
Identity = 42/145 (28.97%), Postives = 80/145 (55.17%), Query Frame = 3
Query: 1782 MGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTA----QKPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVF 2204
            + FI  I WI      +V ++  +G  F IP +++GLS++AF +SV D +S++ +A++    +A +  +G  +F++L+ +G+P+ IKT        ++IN     +   F +  +  + LI++   K+ +NK  G I L  Y +F
Sbjct:  323 LSFIICIVWIGVTSYVLVWMVTVIGYTFLIPDSVMGLSLVAFGSSVPDCLSSLFVARKGDGDMAVSHTVGSNVFDILLCLGIPWLIKTTVWEYDSSVVINSHGLFISCFFILGSI-AVTLIIIWYYKWTLNKKVGCIYLVFYFIF 466          

HSP 2 Score: 55.8398 bits (133), Expect = 4.310e-8
Identity = 44/210 (20.95%), Postives = 94/210 (44.76%), Query Frame = 3
Query:  303 SVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNP----NVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTNTVIFNNDRRLDSSKCKANKNCSHDPLN--NGQINASYLNENAG 914
            +VA   D +F PCL ++   L +  ++AG T +ALG+ A ++F+S+  +  +        +  +    +   I V  + AG ++ +  +     P+++D +FYL +L+   ++L+   + +  +   +S Y VY+ +   +  +   L +  K   P                + + D  + KA K   +DP+   + ++ A  L+   G
Sbjct:   38 AVAIVCDDYFVPCLEIICDRLGLQTDVAGATFMALGSSAPELFASVIGVFITKGDIGVGTILGSAVFNVLFVIGVCGVGAGTVLYLAWW-----PMVRDSVFYLFSLVGLMLVLMDNVVVWSEATAMVSFYSVYLLIMYFNPRIEAYLYRVTKTTTP----------------EYKSDLHEQKATKT-KYDPVQQTDNEVEAEILDNVNG 225          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Nematostella
Match: EDO35212 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM57])

HSP 1 Score: 64.3142 bits (155), Expect = 9.582e-11
Identity = 43/168 (25.60%), Postives = 91/168 (54.17%), Query Frame = 3
Query:  303 SVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIE--NIEVSVTNTVI 800
            ++A   D FF P L  +++ L +S+++AG T +A G+ A ++F+S++ +   ++  VG  +GS +   +++  +TA     +   ++  RP+++D + Y +++ +  I     K E + + V L +YI Y+ V   +  L   L +   Q +P E  N+ VS  ++++
Sbjct:   16 ALAIVCDDFFVPSLEAISEKLDLSEDVAGATFMAAGSSAPELFTSIAGVTVDSDVGVGTIVGSAIFNLLVIIALTAAFSGQV--LQLDWRPLLRDSVAYSLSIAFFIIFSWDGKFEMYEAAVLLILYIAYIVVMKFNPKLMDLLAEVGPQGQPTEVTNLGVSDADSLV 181          

HSP 2 Score: 57.3806 bits (137), Expect = 1.649e-8
Identity = 41/156 (26.28%), Postives = 82/156 (52.56%), Query Frame = 3
Query: 1788 FITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIK---TAQKPILINLKSDTVVLVFTISLVTTMNL--------------IVLPILKFRVNKIYGIILLTIYIVF 2204
            F  SI WI  +   +V V+G  G + ++ +  +GL I+A   SV D +S+I +A+  +  +A +  IG  +F++ +G+GLPF I+      +PI +   ++ ++L  T  +V + ++               ++   KF++NK  G+  + +Y++F
Sbjct:  361 FTMSIVWIAILSFGLVTVVGRSGCILNVDKFTMGLVIIAIGTSVPDALSSIIVARDGFGDMAVSNAIGSNVFDINLGLGLPFVIRILIDKMEPIRMLTPAEEIMLE-TGEIVISPHVKFGFLLLLFLVIALFLMAAFKFKLNKRLGLSFVFMYVLF 515          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Nematostella
Match: EDO48006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKL3])

HSP 1 Score: 64.3142 bits (155), Expect = 1.254e-10
Identity = 46/143 (32.17%), Postives = 79/143 (55.24%), Query Frame = 3
Query: 1788 FITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIK-TAQKPILINLKSDTVVLVFTISLVTTMNLIVLPIL--KFRVNKIYGIILLTIYIVFF 2207
            F  SI W+  +   +V  +  +G  FSIP+ I+GL++LA  +SV D++S++ +AK     +A A CIG  +F++L  +GLP+ +  TA  P  + L     ++  ++ L  T+  IV  I    +R+++  G+IL   Y  F 
Sbjct:  453 FALSIIWMAALSYVLVWTVSIIGETFSIPEYIMGLTLLAAGSSVPDVMSSLIVAKHGMGDMALANCIGSNIFDVLC-LGLPWLLATTAVHPNSVVLIHSGHIVYVSMCLFGTVLTIVSAIHLNGWRLDRRLGVILFIAYAFFL 594          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Medaka
Match: slc8b1 (solute carrier family 8 member B1 [Source:NCBI gene;Acc:101159512])

HSP 1 Score: 143.665 bits (361), Expect = 7.637e-36
Identity = 102/333 (30.63%), Postives = 180/333 (54.05%), Query Frame = 3
Query: 1236 RFYSADTNMAARRIEEFKNIAVEKLKKKSISDVQNQRTESNLSRILQSNRNDDSSFLTFPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNM--NPIGTDGFIVTYXXXXXXXXXXXSVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSD---TVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILII 2219
            R Y   +N  A  I+EF +         +++    Q+   +  R L       S  L         L ++ PVD   W R S   ++L ++++P+  +L L + VV+ D   K W + LNCLH V++P++ +         N +  + F +  LIL++G      V  T+ ++ PP Y   FA +GF+ S   I    +E+V++L  LGVV S+  T+LGL++LA+ NS+GD  S+IT+A++ YPR+A +AC GG +FN+++G+GL   ++  +    +  +S+   T +L  ++ L   ++ I++P+ +F + + YGI LL  Y++F I+ +
Sbjct:  199 RNYVNTSNQNAPHIQEFPSSDSSDDDLPNLTGGNIQQDYESEYRPLLPYSEPTSRIL---------LSSLNPVDSRKWRRKSWRWRVLKVLKTPLEVLLLLCVPVVDPDKEDKNWRRPLNCLHLVIAPVVCVLAFQSGKYGNYMIQEQFPLWVLILLLGFFLAAIVFCTTTNDHPPKYHAVFALLGFVVSAVLISAAASEVVSLLHMLGVVLSLSNTVLGLTLLAWGNSIGDCFSDITIAQQGYPRMAISACFGGIIFNMVIGVGLGCLVQMVKTNSDVQFESEGLLTWILAGSLGLSLVLSFIIVPLSQFHLGRTYGIFLLAFYVIFLIIAL 522          

HSP 2 Score: 111.309 bits (277), Expect = 3.527e-25
Identity = 70/196 (35.71%), Postives = 114/196 (58.16%), Query Frame = 3
Query:  156 SNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVP-TIXXXXXXXXXXXSV-ATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLK 737
            +  C +VKN   C  + GF+NY    +C     + P TI +   +L  L  +   TA  FF P L  ++  L ++ N+AGVT LALGNGA D+FS+++A   S+    GLA+G++ GAG+ V T+ AG + +  PF +  RP ++D+IFY++A+ W  ++L R       ++ +LS+Y++YV    IS  +Y + +
Sbjct:    6 AERCTFVKNTPDCDMEDGFINYLNVVFCLLPPNLTPFTITLCCMWLFFLFMILGLTASKFFCPNLSAISSSLHLTHNVAGVTFLALGNGAPDIFSAMAAF--SHPHTAGLAVGALFGAGVFVTTVVAGSVSLFKPFAVASRPFLRDVIFYMVAVFWTFLMLYRGTTTLGETLGYLSLYVLYVLTVIISTYIYKRQR 199          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Medaka
Match: slc8b1 (solute carrier family 8 member B1 [Source:NCBI gene;Acc:101159512])

HSP 1 Score: 141.739 bits (356), Expect = 2.037e-35
Identity = 89/262 (33.97%), Postives = 157/262 (59.92%), Query Frame = 3
Query: 1449 PVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNM--NPIGTDGFIVTYXXXXXXXXXXXSVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSD---TVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILII 2219
            PVD   W R S   ++L ++++P+  +L L + VV+ D   K W + LNCLH V++P++ +         N +  + F +  LIL++G      V  T+ ++ PP Y   FA +GF+ S   I    +E+V++L  LGVV S+  T+LGL++LA+ NS+GD  S+IT+A++ YPR+A +AC GG +FN+++G+GL   ++  +    +  +S+   T +L  ++ L   ++ I++P+ +F + + YGI LL  Y++F I+ +
Sbjct:  231 PVDSRKWRRKSWRWRVLKVLKTPLEVLLLLCVPVVDPDKEDKNWRRPLNCLHLVIAPVVCVLAFQSGKYGNYMIQEQFPLWVLILLLGFFLAAIVFCTTTNDHPPKYHAVFALLGFVVSAVLISAAASEVVSLLHMLGVVLSLSNTVLGLTLLAWGNSIGDCFSDITIAQQGYPRMAISACFGGIIFNMVIGVGLGCLVQMVKTNSDVQFESEGLLTWILAGSLGLSLVLSFIIVPLSQFHLGRTYGIFLLAFYVIFLIIAL 492          

HSP 2 Score: 110.923 bits (276), Expect = 3.597e-25
Identity = 70/192 (36.46%), Postives = 112/192 (58.33%), Query Frame = 3
Query:  156 SNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVP-TIXXXXXXXXXXXSV-ATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALY 725
            +  C +VKN   C  + GF+NY    +C     + P TI +   +L  L  +   TA  FF P L  ++  L ++ N+AGVT LALGNGA D+FS+++A   S+    GLA+G++ GAG+ V T+ AG + +  PF +  RP ++D+IFY++A+ W  ++L R       ++ +LS+Y++YV    IS  +Y
Sbjct:    6 AERCTFVKNTPDCDMEDGFINYLNVVFCLLPPNLTPFTITLCCMWLFFLFMILGLTASKFFCPNLSAISSSLHLTHNVAGVTFLALGNGAPDIFSAMAAF--SHPHTAGLAVGALFGAGVFVTTVVAGSVSLFKPFAVASRPFLRDVIFYMVAVFWTFLMLYRGTTTLGETLGYLSLYVLYVLTVIISTYIY 195          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Medaka
Match: ENSORLT00000000373.2 (sodium/potassium/calcium exchanger 3 [Source:NCBI gene;Acc:101174615])

HSP 1 Score: 71.2478 bits (173), Expect = 1.821e-12
Identity = 45/155 (29.03%), Postives = 91/155 (58.71%), Query Frame = 3
Query: 1749 SPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTVVLVFTIS-LVTTMNLIVLPIL--KFRVNKIYGIILLTIYIVF 2204
            S P ++  F  + F++S  WI  +   +V ++  +G    IP  I+G++ LA   SV D ++++ +A++    +A +  IG  +F++LVG+GLP+++KT       ++K ++  L+F++  L+ ++ L VL +   K+ ++K  G+  L +Y+VF
Sbjct:  394 SSPRWEKCF-MLSFVSSTLWIAGLSYIMVWMVTVIGFTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNVFDILVGLGLPWALKTLAINYGSDIKLNSKGLIFSVGLLLGSVFLTVLGVHLNKWTLDKRLGVCCLLLYLVF 547          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Medaka
Match: slc24a4b (solute carrier family 24 member 4 [Source:NCBI gene;Acc:101164447])

HSP 1 Score: 66.2402 bits (160), Expect = 8.682e-11
Identity = 47/159 (29.56%), Postives = 90/159 (56.60%), Query Frame = 3
Query: 1749 SPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTVV----LVFTIS-LVTTMNLIVLPIL--KFRVNKIYGIILLTIYIVF 2204
            + P ++ FF  + FI S  WI      +V ++   G    IP  I+G++ LA   SV D ++++ +A++    +A +  IG  +F++LVG+G+P++I+T    I ++  S+  +    LV+++  L+ ++ L VL I   K+R++   G+ +L +Y VF
Sbjct:  434 AKPRWERFF-MLSFILSTVWIAIFSYVMVWMVTVAGYTLGIPDVIMGITFLAAGTSVPDCIASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWAIQT----ICVSYGSEVAINSRGLVYSVVLLLGSVALTVLGIHFNKWRLDFKLGVYVLVLYAVF 587          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Medaka
Match: SLC24A2 (solute carrier family 24 member 2 [Source:NCBI gene;Acc:101167489])

HSP 1 Score: 65.4698 bits (158), Expect = 1.466e-10
Identity = 66/264 (25.00%), Postives = 116/264 (43.94%), Query Frame = 3
Query:  303 SVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIE-----NIEVSVTNTVI--FNNDRRLDSSKCKANKNCS-----------H--DPLNNGQI--NASYLNENAGEFLKVPQYNQLNRKLNNPTRSAEASVVDIRTSFHRCSR 1028
            ++A   D FF P L V+T+ L +S ++AG T +A G  A ++F+S+  +  S++ NVG+          ++  I    I       +   P+ +D+ FY++ L+   I  L   I  W S+  LS Y  YV     +  +   +K C  + + +E      ++ ++T+T+   F    RL      A+ + S           H  DPL+ G+    AS L++ A +  +V      + K N  +  A      I TS  R ++
Sbjct:  122 ALAIVCDEFFVPALTVITEKLNISDDVAGATFMAAGGSAPELFTSIIGVFISHS-NVGIGTIVGSAVFNILFVIGMCAIFSKEILNLTWWPLFRDVSFYILDLIMLIIFFLDNIILVWESVTLLSAYAAYVIFMKFNSKMEGFVKSCMHRNQVVEVEVQPKVKDNLTDTLTLPFQARPRLQRGGSSASLHNSLMRNSIFQLMIHTLDPLSEGKFREKASILHKIAKKKCQVED----SEKANGVSSRAGKMTSKISTSKDRVTQ 380          

HSP 2 Score: 56.9954 bits (136), Expect = 5.212e-8
Identity = 38/155 (24.52%), Postives = 80/155 (51.61%), Query Frame = 3
Query: 1788 FITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLP---FSIKTAQKPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLIN 2243
            F+ SI WI      +V     +G    I + I+GL+ILA   S+ DL++++ +A++    +A ++ +G  +F++ VG+  P   +S     KP+ ++  +     +  + L+    +I +   K+R++K+ G I+  +Y VF ++ +     +I 
Sbjct:  450 FLGSITWIAVFSYLMVWWAHQVGETIGITEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPFPWLFWSFFNGLKPVQVS-SNGLFCAIVLLFLMLLFVIISIAACKWRMSKLLGFIMFMLYFVFLVVSVMLEDRVIT 603          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Planmine SMEST
Match: SMESG000022808.1 (SMESG000022808.1)

HSP 1 Score: 1312.75 bits (3396), Expect = 0.000e+0
Identity = 711/713 (99.72%), Postives = 712/713 (99.86%), Query Frame = 3
Query:  114 MESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTIXXXXXXXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTNTVIFNNDRRLDSSKCKANKNCSHDPLNNGQINASYLNENAGEFLKVPQYNQLNRKLNNPTRSAEASVVDIRTSFHRCSRKPIYSSLNLTRVRSTSHRSMGSFAKIIIKNEHEREIMXXXXXXXXXXXXXXXXXXLSALNDCSVPKLKIRFYSADTNMAARRIEEFKNIAVEKLKKKSISDVQNQRTESNLSRILQSNRNDDSSFLTFPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIGTDGFIVTYXXXXXXXXXXXSVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLINVTI 2252
            MESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTILMILWFLVLLLSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVGLALGSILGAGILVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTNTVIFNNDRRLDSSKCKANKNCSHDPLNNGQINASYLNENAGEFLKVPQYNQLNR LNNPTRSAEASVVDIRTSFHRCSRKPIYSSLNLTRVRSTSHRSMGSFAKIIIKNEHEREIMKKNSKVKVSKKC+KRSVSLSALNDCSVPKLKIRFYSADTNMAARRIEEFKNIAVEKLKKKSISDVQNQRTESNLSRILQSNRNDDSSFLTFPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIGTDGFIVTYLILIIGLLAGISVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLINVTI
Sbjct:    1 MESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTILMILWFLVLLLSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVGLALGSILGAGILVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTNTVIFNNDRRLDSSKCKANKNCSHDPLNNGQINASYLNENAGEFLKVPQYNQLNRNLNNPTRSAEASVVDIRTSFHRCSRKPIYSSLNLTRVRSTSHRSMGSFAKIIIKNEHEREIMKKNSKVKVSKKCLKRSVSLSALNDCSVPKLKIRFYSADTNMAARRIEEFKNIAVEKLKKKSISDVQNQRTESNLSRILQSNRNDDSSFLTFPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIGTDGFIVTYLILIIGLLAGISVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLINVTI 713          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Planmine SMEST
Match: SMESG000022808.1 (SMESG000022808.1)

HSP 1 Score: 1258.43 bits (3255), Expect = 0.000e+0
Identity = 690/713 (96.77%), Postives = 692/713 (97.05%), Query Frame = 3
Query:  114 MESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTIXXXXXXXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTNTVIFNNDRRLDSSKCKANKNCSHDPLNNGQINASYLNENAGEFLKVPQYNQLNRKLNNPTRSAEASVVDIRTSFHRCSRKPIYSSLNLTRVRSTSHRSMGSFAKIIIKNEHEREIMXXXXXXXXXXXXXXXXXXLSALNDCSVPKLKIRFYSADTNMAARRIEEFKNIAVEKLKKKSISDVQNQRTESNLSRILQSNRNDDSSFLTFPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIGTDGFIVTYXXXXXXXXXXXSVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLINVTI 2252
            MESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTILMILWFLVLLLSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVGLALGSILGAGILVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTNTVIFNNDRRLDSSKCKANKNCSHDPLNNGQINASYLNENAGEFLKVPQYNQLNR LNNPTRSAEASVVDIRTSFHRCSRKPIYSSLNLTRVRSTSHRSMGSFAKIIIKNEHEREIMKKNSKVKVSKKC+KRSVSLSALNDCSVPKLKIRFYSADTNMAARRIEEFKNIAVEKLKKKSISDVQNQRTESNLSRILQSNRNDDSSFLTFPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIGTDGFIVTYLILIIGLLAGISVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGT           LGL +        DLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLINVTI
Sbjct:    1 MESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTILMILWFLVLLLSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVGLALGSILGAGILVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTNTVIFNNDRRLDSSKCKANKNCSHDPLNNGQINASYLNENAGEFLKVPQYNQLNRNLNNPTRSAEASVVDIRTSFHRCSRKPIYSSLNLTRVRSTSHRSMGSFAKIIIKNEHEREIMKKNSKVKVSKKCLKRSVSLSALNDCSVPKLKIRFYSADTNMAARRIEEFKNIAVEKLKKKSISDVQNQRTESNLSRILQSNRNDDSSFLTFPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIGTDGFIVTYLILIIGLLAGISVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGT-----------LGLEVCEI-----DLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLINVTI 697          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Planmine SMEST
Match: SMESG000022808.1 (SMESG000022808.1)

HSP 1 Score: 943.34 bits (2437), Expect = 0.000e+0
Identity = 508/510 (99.61%), Postives = 509/510 (99.80%), Query Frame = 3
Query:  114 MESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTIXXXXXXXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTNTVIFNNDRRLDSSKCKANKNCSHDPLNNGQINASYLNENAGEFLKVPQYNQLNRKLNNPTRSAEASVVDIRTSFHRCSRKPIYSSLNLTRVRSTSHRSMGSFAKIIIKNEHEREIMXXXXXXXXXXXXXXXXXXLSALNDCSVPKLKIRFYSADTNMAARRIEEFKNIAVEKLKKKSISDVQNQRTESNLSRILQSNRNDDSSFLTFPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIH 1643
            MESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTILMILWFLVLLLSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVGLALGSILGAGILVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTNTVIFNNDRRLDSSKCKANKNCSHDPLNNGQINASYLNENAGEFLKVPQYNQLNR LNNPTRSAEASVVDIRTSFHRCSRKPIYSSLNLTRVRSTSHRSMGSFAKIIIKNEHEREIMKKNSKVKVSKKC+KRSVSLSALNDCSVPKLKIRFYSADTNMAARRIEEFKNIAVEKLKKKSISDVQNQRTESNLSRILQSNRNDDSSFLTFPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIH
Sbjct:    1 MESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTILMILWFLVLLLSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVGLALGSILGAGILVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTNTVIFNNDRRLDSSKCKANKNCSHDPLNNGQINASYLNENAGEFLKVPQYNQLNRNLNNPTRSAEASVVDIRTSFHRCSRKPIYSSLNLTRVRSTSHRSMGSFAKIIIKNEHEREIMKKNSKVKVSKKCLKRSVSLSALNDCSVPKLKIRFYSADTNMAARRIEEFKNIAVEKLKKKSISDVQNQRTESNLSRILQSNRNDDSSFLTFPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIH 510          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Planmine SMEST
Match: SMESG000022809.1 (SMESG000022809.1)

HSP 1 Score: 657.136 bits (1694), Expect = 0.000e+0
Identity = 394/733 (53.75%), Postives = 510/733 (69.58%), Query Frame = 3
Query:  114 MESCNPKNITGTNYSNE--CQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTIXXXXXXXXXXXSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTNTVIFNNDRRLDSSKCKANKNCSHDPLNNGQINASYLN--ENAGEFLKVPQYNQLNRKLNNPTRSAEASVVDIRTSFHRCSRKPIYSSLNLTRVRSTSHRSMGSFAKIIIKNEHEREIMXXXXXXXXXXXXXXXXXXLSALNDCSVPKL--KIRFYSAD---------TNMAARRIEEFKNIAVEKLKKKSISDVQNQRTESNLSRILQSNRNDDSSFLT----FPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIGTDGFIVTYXXXXXXXXXXXSVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQ-KPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLINVTI 2252
            MESCNPKN T     NE  C YV N  +C FDSGF+NYF+WQ+CGFD+RI+PTILM LWFLVLLL+VA TADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSA++S+++PNV LALGSILGAGILVNT+TAGIIMII PF++MRRPIIKD+IFYL+ALLWC  IL+RR+IE WSS+VFL IY++YV VT +SRA+Y+K K+ +  ++                 D +    +  +N   S +       N +Y+N  E       +P   Q    L N  + +E          +  S  P+  S    R+ S  +R+MGS AKIII+NE+ +EI++    +   +        LS       PK   + RF S D         T    R+I+EF++ A     K +I   +NQ  +S++   L ++   D    T    FPG FKHFL+ I+P++ ++W   S+F K+L+++QSPIMFILTLTI VVEE+ +LKGWCK+LNCLHC+LSPLIWITFI  +  P+G+ GFI+ +L+LIIG+ A IS AITSK+N+PP Y   FAF+GF+TSIFWIY I NEIVN+L T GVV SIPQTILGL+ILAFANS+GDLVSNI LA++ +PRIAY+ACIGGPLFNLLVGIGLPFSI  A+   I + LKS+T+VL+ TI L+T MNLI LP+++FR+  +YGII++ IY++F + ++ FATN+I +T+
Sbjct:    1 MESCNPKNKT----FNESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIPTILMFLWFLVLLLAVAVTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNVSLALGSILGAGILVNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWSSVVFLIIYVIYVTVTGVSRAIYVKQKRGKLTKK----------------EDTQHKKDESGSNIQYSRE-------NRAYINDVEPCNSLNSLPSSLQSPNSLTNSNQDSER---------NHLSLIPM-QSFRSKRIPSIRNRTMGSIAKIIIENEYHKEILEAKKFMNRKRS-------LSLDLATEKPKFNNRKRFISLDQENLKEIKKTEKENRKIKEFQSPA----PKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYSACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSETIVLISTILLITIMNLIYLPVMRFRLRPVYGIIMIVIYVLFLLFVLLFATNVIKITL 685          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Planmine SMEST
Match: SMESG000022809.1 (SMESG000022809.1)

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 349/668 (52.25%), Postives = 459/668 (68.71%), Query Frame = 3
Query:  303 SVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVXXXXXXXXXXXXXVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTNTVIFNNDRRLDSSKCKANKNCSHDPLNNGQINASYLN--ENAGEFLKVPQYNQLNRKLNNPTRSAEASVVDIRTSFHRCSRKPIYSSLNLTRVRSTSHRSMGSFAKIIIKNEHEREIMXXXXXXXXXXXXXXXXXXLSALNDCSVPKL--KIRFYSAD---------TNMAARRIEEFKNIAVEKLKKKSISDVQNQRTESNLSRILQSNRNDDSSFLT----FPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIGTDGFIVTYXXXXXXXXXXXSVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQ-KPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLINVTI 2252
            +VA TADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSA++S+++PNV LALGSILGAGILVNT+TAGIIMII PF++MRRPIIKD+IFYL+ALLWC  IL+RR+IE WSS+VFL IY++YV VT +SRA+Y+K K+ +  ++                 D +    +  +N   S +       N +Y+N  E       +P   Q    L N  + +E          +  S  P+  S    R+ S  +R+MGS AKIII+NE+ +EI++    +   +        LS       PK   + RF S D         T    R+I+EF++ A     K +I   +NQ  +S++   L ++   D    T    FPG FKHFL+ I+P++ ++W   S+F K+L+++QSPIMFILTLTI VVEE+ +LKGWCK+LNCLHC+LSPLIWITFI  +  P+G+ GFI+ +L+LIIG+ A IS AITSK+N+PP Y   FAF+GF+TSIFWIY I NEIVN+L T GVV SIPQTILGL+ILAFANS+GDLVSNI LA++ +PRIAY+ACIGGPLFNLLVGIGLPFSI  A+   I + LKS+T+VL+ TI L+T MNLI LP+++FR+  +YGII++ IY++F + ++ FATN+I +T+
Sbjct:   11 AVAVTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNVSLALGSILGAGILVNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWSSVVFLIIYVIYVTVTGVSRAIYVKQKRGKLTKK----------------EDTQHKKDESGSNIQYSRE-------NRAYINDVEPCNSLNSLPSSLQSPNSLTNSNQDSER---------NHLSLIPM-QSFRSKRIPSIRNRTMGSIAKIIIENEYHKEILEAKKFMNRKRS-------LSLDLATEKPKFNNRKRFISLDQENLKEIKKTEKENRKIKEFQSPA----PKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYSACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSETIVLISTILLITIMNLIYLPVMRFRLRPVYGIIMIVIYVLFLLFVLLFATNVIKITL 634          
The following BLAST results are available for this feature:
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC8B16.243e-4534.64solute carrier family 8 member B1 [Source:HGNC Sym... [more]
SLC8B12.739e-4434.64solute carrier family 8 member B1 [Source:HGNC Sym... [more]
SLC8B12.739e-4434.64solute carrier family 8 member B1 [Source:HGNC Sym... [more]
SLC8B12.872e-3938.49solute carrier family 8 member B1 [Source:HGNC Sym... [more]
SLC8B16.216e-2439.11solute carrier family 8 member B1 [Source:HGNC Sym... [more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncx-72.520e-4035.71Putative sodium/calcium exchanger 7 [Source:UniPr... [more]
ncx-68.090e-4036.19Putative sodium/calcium exchanger 6 [Source:UniPr... [more]
ncx-91.549e-3635.55Mitochondrial sodium/calcium exchanger protein [S... [more]
ncx-84.140e-3032.94Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:O16... [more]
ncx-109.117e-2829.93Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:Q96... [more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG147441.460e-2625.00gene:FBgn0033324 transcript:FBtr0307024[more]
CG53481.441e-2525.63gene:FBgn0034156 transcript:FBtr0305318[more]
CG123763.661e-2426.32gene:FBgn0033323 transcript:FBtr0088706[more]
CG123767.342e-2426.32gene:FBgn0033323 transcript:FBtr0339335[more]
CG147435.637e-2124.09gene:FBgn0033326 transcript:FBtr0307023[more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc8b14.661e-3139.02solute carrier family 8 member B1 [Source:ZFIN;Acc... [more]
slc24a4a9.444e-1027.45solute carrier family 24 member 4a [Source:ZFIN;Ac... [more]
slc24a31.004e-926.04solute carrier family 24 member 3 [Source:ZFIN;Acc... [more]
slc24a54.412e-925.73solute carrier family 24 member 5 [Source:ZFIN;Acc... [more]
slc24a14.910e-929.38solute carrier family 24 member 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc8b18.519e-4134.75solute carrier family 8 (sodium/lithium/calcium ex... [more]
slc8b11.138e-4034.75solute carrier family 8 (sodium/lithium/calcium ex... [more]
slc8b12.335e-4034.75solute carrier family 8 (sodium/lithium/calcium ex... [more]
slc8b13.037e-4034.75solute carrier family 8 (sodium/lithium/calcium ex... [more]
slc8b11.498e-2138.65solute carrier family 8 (sodium/lithium/calcium ex... [more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc8b11.663e-4436.12solute carrier family 8 (sodium/lithium/calcium ex... [more]
Slc8b15.755e-4436.12solute carrier family 8 (sodium/lithium/calcium ex... [more]
Slc8b17.034e-4436.12solute carrier family 8 (sodium/lithium/calcium ex... [more]
Slc8b12.731e-2334.72solute carrier family 8 (sodium/lithium/calcium ex... [more]
Slc24a43.090e-1229.65solute carrier family 24 (sodium/potassium/calcium... [more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6J4K2|NCLX_HUMAN1.315e-4334.64Mitochondrial sodium/calcium exchanger protein OS=... [more]
sp|Q925Q3|NCLX_MOUSE4.920e-4336.12Mitochondrial sodium/calcium exchanger protein OS=... [more]
sp|Q6AXS0|NCLX_RAT8.383e-4336.88Mitochondrial sodium/calcium exchanger protein OS=... [more]
sp|P34322|NCX7_CAEEL3.205e-3935.71Putative sodium/calcium exchanger 7 OS=Caenorhabdi... [more]
sp|P34315|NCX6_CAEEL1.029e-3836.19Putative sodium/calcium exchanger 6 OS=Caenorhabdi... [more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF400.000e+054.22Slc24a-5 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YFD71.072e-11950.68Slc24a-7 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YKA17.466e-11445.28Slc24a-2 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A293N1M13.276e-7929.45Na+/Ca2+ exchanger (Fragment) OS=Ornithodoros erra... [more]
A0A2R5L5686.818e-7729.69Putative ca2+ antiporter (Fragment) OS=Ornithodoro... [more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc8b11.893e-3834.75solute carrier family 8 member B1 [Source:NCBI gen... [more]
SLC24A23.332e-1222.81solute carrier family 24 member 2 [Source:NCBI gen... [more]
slc24a38.397e-1228.40solute carrier family 24 member 3 [Source:NCBI gen... [more]
slc24a31.606e-1128.40solute carrier family 24 member 3 [Source:NCBI gen... [more]
SLC24A22.056e-1124.08solute carrier family 24 member 2 [Source:NCBI gen... [more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SLC8B13.672e-3834.66solute carrier family 8 member B1 [Source:HGNC Sym... [more]
slc24a11.859e-1030.94solute carrier family 24 member 1 [Source:ZFIN;Acc... [more]
slc24a4b5.709e-1026.49solute carrier family 24 member 4b [Source:ZFIN;Ac... [more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
YDL206W_mRNA3.697e-1333.91Putative protein of unknown function; YDL206W is n... [more]
ECM271.855e-629.76Protein involved in calcium homeostasis and exit f... [more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO319502.322e-2530.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414214.926e-1130.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320485.728e-1128.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352129.582e-1125.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480061.254e-1032.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc8b17.637e-3630.63solute carrier family 8 member B1 [Source:NCBI gen... [more]
slc8b12.037e-3533.97solute carrier family 8 member B1 [Source:NCBI gen... [more]
ENSORLT00000000373.21.821e-1229.03sodium/potassium/calcium exchanger 3 [Source:NCBI ... [more]
slc24a4b8.682e-1129.56solute carrier family 24 member 4 [Source:NCBI gen... [more]
SLC24A21.466e-1025.00solute carrier family 24 member 2 [Source:NCBI gen... [more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022808.10.000e+099.72SMESG000022808.1[more]
SMESG000022808.10.000e+096.77SMESG000022808.1[more]
SMESG000022808.10.000e+099.61SMESG000022808.1[more]
SMESG000022809.10.000e+053.75SMESG000022809.1[more]
SMESG000022809.10.000e+052.25SMESG000022809.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001861 ID=SMED30001861|Name=mitochondrial sodium/calcium exchanger protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2277bp
GAAATTTAAGTTGATATTTGCATAAATTAAAAACTTTCATATTTATTAAG
TTACCTTTATTTGAAGTTTAAATGTACATTTGAAGTTTCCGTTTTTCCGT
TCCTAGAAAGGTTATGGAGAGCTGTAATCCAAAAAACATTACCGGAACTA
ACTATTCCAATGAATGTCAATACGTTAAAAATGTCAGTGCCTGTCTTTTT
GATTCTGGATTTTTGAATTATTTTGAATGGCAATATTGTGGATTTGACAG
TCGAATAGTGCCCACCATTTTGATGATTCTTTGGTTTCTAGTGCTTTTGC
TGAGTGTTGCTACTACTGCTGACAGTTTTTTCGCTCCATGTTTGGTTGTT
GTCACGAAAATATTGCGAATGAGTCAGAATTTAGCGGGTGTTACTTTATT
GGCTCTTGGAAATGGTGCAGCCGATGTTTTCAGTTCATTATCAGCAATTC
TTTCTTCCAATAACCCCAATGTTGGATTAGCTTTGGGATCAATTTTGGGT
GCCGGAATTTTGGTAAACACAATTACTGCCGGAATAATCATGATAATTTG
TCCATTCGAAATTATGAGACGGCCAATAATAAAAGACATCATTTTCTATT
TGATCGCACTTCTATGGTGCACAATCATTTTGTTGCGCAGAAAAATAGAA
TTCTGGTCTTCAATTGTGTTTCTATCAATCTATATAGTATACGTCTTTGT
GACGGCAATTTCCAGAGCTCTCTATCTTAAACTAAAGAAATGTCAAAAGC
AAGAAAGACCAATAGAAAACATAGAAGTATCTGTCACAAATACAGTAATT
TTCAACAATGACAGAAGATTAGATTCTTCTAAATGTAAGGCAAATAAAAA
TTGTTCCCACGATCCTTTGAATAATGGTCAAATAAATGCCAGTTATTTAA
ATGAAAATGCTGGTGAATTTCTAAAGGTTCCTCAATACAATCAACTTAAT
AGAAAATTAAACAATCCGACTAGATCAGCAGAAGCTTCTGTGGTTGATAT
AAGAACATCTTTCCATAGATGTTCCAGAAAACCAATTTATAGTAGTTTAA
ATCTGACCAGAGTGAGGTCCACAAGTCATAGATCAATGGGATCTTTTGCA
AAAATAATTATAAAAAATGAGCATGAAAGAGAAATAATGAAAAAAAATTC
AAAAGTTAAAGTCTCAAAGAAATGCATCAAAAGATCAGTTTCATTAAGTG
CTTTAAATGATTGTTCTGTTCCGAAACTAAAGATTAGATTTTATTCAGCT
GATACAAATATGGCGGCTAGAAGGATTGAAGAATTCAAAAATATTGCAGT
TGAAAAATTAAAAAAGAAATCTATCTCAGATGTGCAAAATCAACGAACTG
AATCAAATTTAAGCAGAATTTTACAATCAAATCGAAATGATGACTCCAGC
TTCTTGACTTTTCCGGGGACCTTCAAGCATTTTCTCCTAACAATTTTACC
AGTAGATCTAGATGACTGGCCACGTTTATCTGTATTTAAAAAGATTCTCG
CAATTGTGCAAAGTCCAATTATGTTTATTTTAACATTGACAATTTCTGTC
GTTGAAGAAGATGTTTTTTTAAAAGGATGGTGCAAGATATTAAATTGCTT
GCATTGTGTTTTGTCGCCTTTGATTTGGATTACATTTATTCACGTTAACA
TGAATCCAATTGGAACTGACGGTTTCATAGTTACCTATCTGATTCTGATC
ATTGGTTTATTAGCTGGAATCTCTGTAGCTATTACCTCCAAGTCCAACAG
CCCTCCAATTTATCAACCATTCTTTGCTTTTATGGGATTTATAACTTCGA
TATTTTGGATTTATGAAATAGTTAACGAAATTGTCAACGTTCTTGGAACC
CTTGGGGTGGTGTTTTCAATTCCACAAACAATTCTCGGTCTTAGCATATT
GGCTTTTGCGAATTCAGTTGGAGATTTGGTATCGAATATTACATTGGCTA
AAAGGAATTATCCGAGAATTGCATACGCAGCCTGTATTGGGGGCCCTCTG
TTCAATTTGCTAGTTGGAATCGGACTTCCATTTTCAATCAAGACTGCACA
AAAACCGATTTTGATTAATCTGAAATCAGATACAGTGGTTCTTGTTTTTA
CGATTTCTCTAGTAACAACAATGAATTTAATTGTTTTACCAATACTGAAA
TTCAGGGTGAACAAGATCTATGGAATAATCTTACTGACAATATACATTGT
ATTCTTTATTTTAATCATTTCTTTTGCGACAAATCTCATCAATGTAACAA
TATAAAGTCTATATGTAGTAAAAAGTG
back to top

protein sequence of SMED30001861-orf-1

>SMED30001861-orf-1 ID=SMED30001861-orf-1|Name=SMED30001861-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=714bp
MESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVP
TILMILWFLVLLLSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGN
GAADVFSSLSAILSSNNPNVGLALGSILGAGILVNTITAGIIMIICPFEI
MRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAIS
RALYLKLKKCQKQERPIENIEVSVTNTVIFNNDRRLDSSKCKANKNCSHD
PLNNGQINASYLNENAGEFLKVPQYNQLNRKLNNPTRSAEASVVDIRTSF
HRCSRKPIYSSLNLTRVRSTSHRSMGSFAKIIIKNEHEREIMKKNSKVKV
SKKCIKRSVSLSALNDCSVPKLKIRFYSADTNMAARRIEEFKNIAVEKLK
KKSISDVQNQRTESNLSRILQSNRNDDSSFLTFPGTFKHFLLTILPVDLD
DWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVL
SPLIWITFIHVNMNPIGTDGFIVTYLILIIGLLAGISVAITSKSNSPPIY
QPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFAN
SVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPIL
INLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFIL
IISFATNLINVTI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000047collecting duct
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR004837NaCa_Exmemb
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004837Sodium/calcium exchanger membrane regionPFAMPF01699Na_Ca_excoord: 555..701
e-value: 9.9E-23
score: 80.8
coord: 56..197
e-value: 4.1E-20
score: 72.3
NoneNo IPR availableGENE3DG3DSA:1.20.58.1130coord: 73..85
e-value: 1.1E-12
score: 49.6
NoneNo IPR availableGENE3DG3DSA:1.20.1420.30coord: 86..200
e-value: 1.1E-12
score: 49.6
coord: 513..705
e-value: 1.4E-10
score: 42.8
NoneNo IPR availablePANTHERPTHR12266NA+/CA2+ K+ INDEPENDENT EXCHANGERcoord: 7..706
NoneNo IPR availableTMHMMTMhelixcoord: 576..598
NoneNo IPR availableTMHMMTMhelixcoord: 547..566
NoneNo IPR availableTMHMMTMhelixcoord: 685..707
NoneNo IPR availableTMHMMTMhelixcoord: 90..112
NoneNo IPR availableTMHMMTMhelixcoord: 462..480
NoneNo IPR availableTMHMMTMhelixcoord: 183..205
NoneNo IPR availableTMHMMTMhelixcoord: 656..678
NoneNo IPR availableTMHMMTMhelixcoord: 492..511
NoneNo IPR availableTMHMMTMhelixcoord: 428..447
NoneNo IPR availableTMHMMTMhelixcoord: 47..69
NoneNo IPR availableTMHMMTMhelixcoord: 521..540
NoneNo IPR availableTMHMMTMhelixcoord: 159..178
NoneNo IPR availableTMHMMTMhelixcoord: 127..146
NoneNo IPR availableTMHMMTMhelixcoord: 619..641