Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30001853
Length (bp)2143
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30001853) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30001853) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30001853) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30001853) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001853

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30001853SMESG000003859.1 Contig980newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001853SMESG000003859.1 Contig5760GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001853SMESG000022762.1 Contig980newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30001853SMESG000003859.1 dd_Smed_v4_1897_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30001853SMESG000003859.1 dd_Smed_v4_1897_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001853SMESG000003859.1 dd_Smed_v4_1897_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30001853SMESG000003859.1 dd_Smed_v4_1897_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30001853SMESG000003859.1 dd_Smed_v6_1897_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30001853SMESG000003859.1 dd_Smed_v6_1897_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001853SMESG000003859.1 dd_Smed_v6_1897_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001853SMESG000003859.1 dd_Smed_v4_1897_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30001853SMESG000003859.1 dd_Smed_v4_1897_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: NEK4 (NIMA related kinase 4 [Source:HGNC Symbol;Acc:HGNC:11399])

HSP 1 Score: 62.7734 bits (151), Expect = 1.703e-9
Identity = 52/190 (27.37%), Postives = 91/190 (47.89%), Query Frame = 1
Query: 1438 YKSASEIGVSMELMVMSMKNILDI----PENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV----YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKL 1983
            YK + E G  +  +VM      D+     E + +L+    +V+W  QI   L +LH++ I++ +L   ++ L   + IK+  + I ++  +H       +    Y +PEL  N+P+N KSDVW+ G  ++E+ T K  H   A + N+  +  I G     P        ++I+  L K P  R SV+ +
Sbjct:   68 YKESWEGGDGLLYIVMGFCEGGDLYRKLKEQKGQLLPENQVVEWFVQIAMALQYLHEKHILHRDLKTQNVFLTRTNIIKVGDLGIARVLENHCDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLK--HAFNAKDMNSLVYRIIEGKLPPMPRDYSPELAELIRTMLSKRPEERPSVRSI 255          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: NEK4 (NIMA related kinase 4 [Source:HGNC Symbol;Acc:HGNC:11399])

HSP 1 Score: 62.7734 bits (151), Expect = 2.071e-9
Identity = 52/190 (27.37%), Postives = 91/190 (47.89%), Query Frame = 1
Query: 1438 YKSASEIGVSMELMVMSMKNILDI----PENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV----YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKL 1983
            YK + E G  +  +VM      D+     E + +L+    +V+W  QI   L +LH++ I++ +L   ++ L   + IK+  + I ++  +H       +    Y +PEL  N+P+N KSDVW+ G  ++E+ T K  H   A + N+  +  I G     P        ++I+  L K P  R SV+ +
Sbjct:   68 YKESWEGGDGLLYIVMGFCEGGDLYRKLKEQKGQLLPENQVVEWFVQIAMALQYLHEKHILHRDLKTQNVFLTRTNIIKVGDLGIARVLENHCDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLK--HAFNAKDMNSLVYRIIEGKLPPMPRDYSPELAELIRTMLSKRPEERPSVRSI 255          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K12 (mitogen-activated protein kinase kinase kinase 12 [Source:HGNC Symbol;Acc:HGNC:6851])

HSP 1 Score: 60.4622 bits (145), Expect = 5.445e-9
Identity = 66/264 (25.00%), Postives = 116/264 (43.94%), Query Frame = 1
Query: 1222 EKPLKEKIKRKLSKENASLYKAIDNFSKQESALLKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMS-MKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSN---EKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNE------SMFPEGKYKWFEDIIKNCLIKNPINRISVKKL 1983
            E P +E +  +     A     +  F  +E A+ K +       KE    IK L +LK    H   +   G+   A    + ME      +  +L         V+   +V WS  I  G+ +LH   II+ +L   ++++     +K+S     K  +D  +         + APE+++NEP + K D+WSFGVVL+E++TG+   +P  + D++     +  N       S  P+G    F+ +++ C    P NR S +++
Sbjct:  119 EVPFEEILDLQWVGSGAQGAVFLGRFHGEEVAVKKVR-----DLKETD--IKHLRKLK----HPNIITFKGVCTQAPCYCILMEFCAQGQLYEVL----RAGRPVTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGE---IPYKDVDSSAIIWGVGSNSLHLPVPSSCPDG----FKILLRQCWNSKPRNRPSFRQI 360          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K13 (mitogen-activated protein kinase kinase kinase 13 [Source:HGNC Symbol;Acc:HGNC:6852])

HSP 1 Score: 58.5362 bits (140), Expect = 3.773e-8
Identity = 62/241 (25.73%), Postives = 111/241 (46.06%), Query Frame = 1
Query: 1288 IDNFSKQESALLKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMS-MKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSN---EKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGN------ESMFPEGKYKWFEDIIKNCLIKNPINRISVKK 1980
            +  F  +E A+ K +       ++N   IK L +LK    H   +   G+   A    + ME      +  +L     RK  ++ + +V WS  I  G+ +LH   II+ +L   ++++     +K+S     K  +D  +         + APE+++NEP + K D+WSFGVVL+E++TG+   +P  + D++     +  N       S  P+G    F+ ++K      P NR S ++
Sbjct:   40 LGKFRAEEVAIKKVR-------EQNETDIKHLRKLK----HPNIIAFKGVCTQAPCYCIIMEYCAHGQLYEVLRA--GRK--ITPRLLVDWSTGIASGMNYLHLHKIIHRDLKSPNVLVTHTDAVKISDFGTSKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGE---IPYKDVDSSAIIWGVGSNSLHLPVPSTCPDG----FKILMKQTWQSKPRNRPSFRQ 258          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: LYN (LYN proto-oncogene, Src family tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:6735])

HSP 1 Score: 58.151 bits (139), Expect = 3.953e-8
Identity = 44/174 (25.29%), Postives = 85/174 (48.85%), Query Frame = 1
Query: 1345 KSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMV-MSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV-----YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANN 1848
            ++F E  NL+K L        H++ V ++ +      I +  E M   S+ + L   E  K L+    ++ +S QI EG+A++  +  I+ +L  +++++      K++   + ++  D++   +        + APE +    + IKSDVWSFG++L+EI+T      P   N
Sbjct:  264 QAFLEEANLMKTLQ-------HDKLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLP--KLIDFSAQIAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTN 428          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: pkc-2 (Protein kinase C-like 2 [Source:UniProtKB/Swiss-Prot;Acc:P90980])

HSP 1 Score: 59.3066 bits (142), Expect = 1.007e-8
Identity = 49/172 (28.49%), Postives = 86/172 (50.00%), Query Frame = 1
Query: 1477 MVMSMKNILDIPENRKELVSFKNIVK--WSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGK--LFTDHKSNEKNAV--YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISV 1974
             VM   N  D+    +++  FK  V   ++ +I  GL FLH +GIIY +L + +++L+    IK++   + K  +F D  +        Y APE++  +P+    D W++GV+LFE++ G+    P    D +  +  I+ +   +P+   K    + K  LIKNP  R+  
Sbjct:  564 FVMEFVNGGDLMYQIQQVGKFKEPVAVFYAAEIAVGLFFLHSKGIIYRDLKLDNVMLERDGHIKITDFGMCKENIFGDATTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLFEMLAGQP---PFDGEDEDELFTAITEHNVSYPKSLSKEAVSLCKALLIKNPSKRLGC 732          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: pkc-2 (Protein kinase C-like 2 [Source:UniProtKB/Swiss-Prot;Acc:P90980])

HSP 1 Score: 58.9214 bits (141), Expect = 1.036e-8
Identity = 49/171 (28.65%), Postives = 86/171 (50.29%), Query Frame = 1
Query: 1480 VMSMKNILDIPENRKELVSFKNIVK--WSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGK--LFTDHKSNEKNAV--YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISV 1974
            VM   N  D+    +++  FK  V   ++ +I  GL FLH +GIIY +L + +++L+    IK++   + K  +F D  +        Y APE++  +P+    D W++GV+LFE++ G+    P    D +  +  I+ +   +P+   K    + K  LIKNP  R+  
Sbjct:  470 VMEFVNGGDLMYQIQQVGKFKEPVAVFYAAEIAVGLFFLHSKGIIYRDLKLDNVMLERDGHIKITDFGMCKENIFGDATTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLFEMLAGQP---PFDGEDEDELFTAITEHNVSYPKSLSKEAVSLCKALLIKNPSKRLGC 637          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: pkc-2 (Protein kinase C-like 2 [Source:UniProtKB/Swiss-Prot;Acc:P90980])

HSP 1 Score: 58.9214 bits (141), Expect = 1.152e-8
Identity = 49/172 (28.49%), Postives = 86/172 (50.00%), Query Frame = 1
Query: 1477 MVMSMKNILDIPENRKELVSFKNIVK--WSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGK--LFTDHKSNEKNAV--YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISV 1974
             VM   N  D+    +++  FK  V   ++ +I  GL FLH +GIIY +L + +++L+    IK++   + K  +F D  +        Y APE++  +P+    D W++GV+LFE++ G+    P    D +  +  I+ +   +P+   K    + K  LIKNP  R+  
Sbjct:  424 FVMEFVNGGDLMYQIQQVGKFKEPVAVFYAAEIAVGLFFLHSKGIIYRDLKLDNVMLERDGHIKITDFGMCKENIFGDATTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLFEMLAGQP---PFDGEDEDELFTAITEHNVSYPKSLSKEAVSLCKALLIKNPSKRLGC 592          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: pkc-2 (Protein kinase C-like 2 [Source:UniProtKB/Swiss-Prot;Acc:P90980])

HSP 1 Score: 58.5362 bits (140), Expect = 1.454e-8
Identity = 49/172 (28.49%), Postives = 86/172 (50.00%), Query Frame = 1
Query: 1477 MVMSMKNILDIPENRKELVSFKNIVK--WSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGK--LFTDHKSNEKNAV--YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISV 1974
             VM   N  D+    +++  FK  V   ++ +I  GL FLH +GIIY +L + +++L+    IK++   + K  +F D  +        Y APE++  +P+    D W++GV+LFE++ G+    P    D +  +  I+ +   +P+   K    + K  LIKNP  R+  
Sbjct:  424 FVMEFVNGGDLMYQIQQVGKFKEPVAVFYAAEIAVGLFFLHSKGIIYRDLKLDNVMLERDGHIKITDFGMCKENIFGDATTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLFEMLAGQP---PFDGEDEDELFTAITEHNVSYPKSLSKEAVSLCKALLIKNPSKRLGC 592          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: src-2 (Tyrosine protein-kinase src-2 [Source:UniProtKB/Swiss-Prot;Acc:O45539])

HSP 1 Score: 58.151 bits (139), Expect = 1.493e-8
Identity = 53/228 (23.25%), Postives = 97/228 (42.54%), Query Frame = 1
Query: 1321 LKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAVYR------APELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKLQ 1986
            LK   +D   F     ++K+L        H + + ++ +      I +  ELM    +N+L   + R        +V+ S Q+  G+A+L +   I+ +L   +I++++   +K++   + ++       E     R      APE      +  KSDVWSFG++L EI+T      P   N      ++ +G     P G      DI++ C   +P  R + + LQ
Sbjct:  270 LKAGTADPTDFLAEAQIMKKLR-------HPKLLSLYAVCTRDEPILIVTELM---QENLLTFLQRRGRQCQMPQLVEISAQVAAGMAYLEEMNFIHRDLAARNILINNSLSVKIADFGLARILMKENEYEARTGARFPIKWTAPEAANYNRFTTKSDVWSFGILLTEIVTFGRLPYPGMTNAEVLQQVD-AGYRMPCPAGCPVTLYDIMQQCWRSDPDKRPTFETLQ 486          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: wnd (gene:FBgn0036896 transcript:FBtr0302513)

HSP 1 Score: 61.2326 bits (147), Expect = 3.241e-9
Identity = 57/214 (26.64%), Postives = 105/214 (49.07%), Query Frame = 1
Query: 1372 IKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMS-MKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTD---HKSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGN------ESMFPEGKYKWFEDIIKNCLIKNPINRISVKKL 1983
            IK L +L     HE  ++  G+   +    + ME      ++NIL      ++++    +V WS+QI  G+ +LH   II+ +L   +I++ +   +K+S     + + +     S      + APE+++NEP + K D+WS+GVVL+E++T     +P  + D++     +  N       S  PEG    F+ ++K C    P NR S +++
Sbjct:  171 IKHLRKL----DHENIIKFKGVCTQSPVFCIIMEFCPYGPLQNIL----KEEQVMLPSRLVSWSKQIALGMQYLHSHKIIHRDLKSPNILISTNEVVKISDFGTSREWNEISTKMSFAGTVAWMAPEVIRNEPCSEKVDIWSYGVVLWEMLT---CEIPYKDVDSSAIIWGVGNNSLKLLVPSTCPEG----FKLLVKLCWKSKPRNRPSFRQI 369          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: wnd (gene:FBgn0036896 transcript:FBtr0074964)

HSP 1 Score: 60.8474 bits (146), Expect = 3.719e-9
Identity = 57/214 (26.64%), Postives = 105/214 (49.07%), Query Frame = 1
Query: 1372 IKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMS-MKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTD---HKSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGN------ESMFPEGKYKWFEDIIKNCLIKNPINRISVKKL 1983
            IK L +L     HE  ++  G+   +    + ME      ++NIL      ++++    +V WS+QI  G+ +LH   II+ +L   +I++ +   +K+S     + + +     S      + APE+++NEP + K D+WS+GVVL+E++T     +P  + D++     +  N       S  PEG    F+ ++K C    P NR S +++
Sbjct:  198 IKHLRKL----DHENIIKFKGVCTQSPVFCIIMEFCPYGPLQNIL----KEEQVMLPSRLVSWSKQIALGMQYLHSHKIIHRDLKSPNILISTNEVVKISDFGTSREWNEISTKMSFAGTVAWMAPEVIRNEPCSEKVDIWSYGVVLWEMLT---CEIPYKDVDSSAIIWGVGNNSLKLLVPSTCPEG----FKLLVKLCWKSKPRNRPSFRQI 396          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: wnd (gene:FBgn0036896 transcript:FBtr0074963)

HSP 1 Score: 60.8474 bits (146), Expect = 3.719e-9
Identity = 57/214 (26.64%), Postives = 105/214 (49.07%), Query Frame = 1
Query: 1372 IKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMS-MKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTD---HKSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGN------ESMFPEGKYKWFEDIIKNCLIKNPINRISVKKL 1983
            IK L +L     HE  ++  G+   +    + ME      ++NIL      ++++    +V WS+QI  G+ +LH   II+ +L   +I++ +   +K+S     + + +     S      + APE+++NEP + K D+WS+GVVL+E++T     +P  + D++     +  N       S  PEG    F+ ++K C    P NR S +++
Sbjct:  198 IKHLRKL----DHENIIKFKGVCTQSPVFCIIMEFCPYGPLQNIL----KEEQVMLPSRLVSWSKQIALGMQYLHSHKIIHRDLKSPNILISTNEVVKISDFGTSREWNEISTKMSFAGTVAWMAPEVIRNEPCSEKVDIWSYGVVLWEMLT---CEIPYKDVDSSAIIWGVGNNSLKLLVPSTCPEG----FKLLVKLCWKSKPRNRPSFRQI 396          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: wnd (gene:FBgn0036896 transcript:FBtr0074965)

HSP 1 Score: 60.8474 bits (146), Expect = 3.719e-9
Identity = 57/214 (26.64%), Postives = 105/214 (49.07%), Query Frame = 1
Query: 1372 IKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMS-MKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTD---HKSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGN------ESMFPEGKYKWFEDIIKNCLIKNPINRISVKKL 1983
            IK L +L     HE  ++  G+   +    + ME      ++NIL      ++++    +V WS+QI  G+ +LH   II+ +L   +I++ +   +K+S     + + +     S      + APE+++NEP + K D+WS+GVVL+E++T     +P  + D++     +  N       S  PEG    F+ ++K C    P NR S +++
Sbjct:  198 IKHLRKL----DHENIIKFKGVCTQSPVFCIIMEFCPYGPLQNIL----KEEQVMLPSRLVSWSKQIALGMQYLHSHKIIHRDLKSPNILISTNEVVKISDFGTSREWNEISTKMSFAGTVAWMAPEVIRNEPCSEKVDIWSYGVVLWEMLT---CEIPYKDVDSSAIIWGVGNNSLKLLVPSTCPEG----FKLLVKLCWKSKPRNRPSFRQI 396          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Egfr (gene:FBgn0003731 transcript:FBtr0071654)

HSP 1 Score: 60.4622 bits (145), Expect = 4.943e-9
Identity = 52/200 (26.00%), Postives = 100/200 (50.00%), Query Frame = 1
Query: 1342 WKSFKEN---PNLIKELSRLKIVKSHERFVEIFGLYKSASEIGV--------SMELMV----MSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAVYRAP------ELLKNEPWNIKSDVWSFGVVLFEIIT-GKDFHLPTANNDNNPDWIEI 1875
            W    EN   P  IKEL +    +S E F+    +  S   + +        S ++M+    M +  +LD   N ++ +  K ++ WS QI +G+++L ++ +++ +L   ++++ + S +K++   + KL +   +  K A  + P      E ++N  +  KSDVW+FGV ++E++T G+  H      D  PD IE+
Sbjct:  957 WVPEGENVKIPVAIKELLKSTGAESSEEFLREAYIMASVEHVNLLKLLAVCMSSQMMLITQLMPLGCLLDYVRNNRDKIGSKALLNWSTQIAKGMSYLEEKRLVHRDLAARNVLVQTPSLVKITDFGLAKLLSSDSNEYKAAGGKMPIKWLALECIRNRVFTSKSDVWAFGVTIWELLTFGQRPHENIPAKD-IPDLIEV 1155          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: SRMS (zgc:194282 [Source:ZFIN;Acc:ZDB-GENE-081022-95])

HSP 1 Score: 62.3882 bits (150), Expect = 1.237e-9
Identity = 43/155 (27.74%), Postives = 87/155 (56.13%), Query Frame = 1
Query: 1369 LIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVM-SMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKL-----FTDHKSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIIT 1815
             +KE+  LK +  H + +E+  L      + +  ELM   S+K+ L   E   +L++  +++  + QI EG+A+L D+ I++ +L   +I++ +    K++   + ++     FT  K+ +    + APE    + +++KSDVWSFGV+L+E+++
Sbjct:  268 FVKEVHALKNLH-HPKLIELLALCSRGEPVYIVTELMAKGSLKSYLSSAEG--QLLTSAHLIYMAAQIAEGMAYLEDRHIVHRDLAARNILVGNDLVCKVADFGLARIIKDSVFTASKTTKIPVRWTAPEAALYQRFSVKSDVWSFGVLLYEMMS 419          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: lyn (LYN proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-040912-7])

HSP 1 Score: 61.2326 bits (147), Expect = 2.454e-9
Identity = 51/224 (22.77%), Postives = 104/224 (46.43%), Query Frame = 1
Query: 1345 KSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMSMKNILDIPENRK-ELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV-----YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKLQNLIN 1998
            ++F E  NL+K L        H+R V ++ +      I +  E M     ++LD  +++    +    ++ +S QI EG+A++  +  I+ +L  +++++      K++   + ++  D +   +        + APE +    + IKSD+WSFGV+L+EIIT      P  +N      ++  G     PE       +I+  C    P +R +   +Q++++
Sbjct:  283 EAFLEEANLMKTLQ-------HDRLVRLYAVVTKTEPIYIITEYMANG--SLLDFLKSQAGSKIQLPKLIDFSAQIAEGMAYIEKKNYIHRDLRAANVLVSEMLLCKIADFGLARVIEDDQYTAREGAKFPIKWTAPEAINYGSFTIKSDMWSFGVLLYEIITYGKIPYPGMSNSEVMSSVQ-RGYRMPRPENCPVELYEIMTTCWKNKPEDRPTFDYIQSVLD 496          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: lck (LCK proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-040617-1])

HSP 1 Score: 59.6918 bits (143), Expect = 7.822e-9
Identity = 59/261 (22.61%), Postives = 122/261 (46.74%), Query Frame = 1
Query: 1240 KIKRKLSKEN-ASLYKAIDNFSKQES-ALLKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV-----YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIE--ISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKLQNLI 1995
            K++R+L +     ++  + N ++Q +   LK       +F    NL+K L        H R V +F +        ++  +   S+ + L  PE     +    ++  + Q+ EG+A++  +  I+ +L  ++I++  +   K++   + +L  +++   +        + APE +    ++IKSDVWSFGV+L EI+T      P      NP+ I     G     P+   +   +++K+C  +NP NR + + L++++
Sbjct:  239 KLERRLGQGQFGEVWMGLYNNNRQVAIKSLKPGTMSISAFLAEANLMKSLQ-------HPRLVRLFAVVTQEPIYIITEYMENGSLVDFLKTPEGSD--IPINTLIDMAAQVAEGMAYVEQKNYIHRDLRAANILVSHELTCKIADFGLARLIENNEYTAREGAKFPIKWTAPEAINYGTFSIKSDVWSFGVLLTEIVTYGRIPYPGM---TNPEVIANLERGYRMPCPDNCPEALYNVMKHCWTENPDNRPTFEFLRSVL 487          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: lck (LCK proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-040617-1])

HSP 1 Score: 59.6918 bits (143), Expect = 7.822e-9
Identity = 59/261 (22.61%), Postives = 122/261 (46.74%), Query Frame = 1
Query: 1240 KIKRKLSKEN-ASLYKAIDNFSKQES-ALLKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV-----YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIE--ISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKLQNLI 1995
            K++R+L +     ++  + N ++Q +   LK       +F    NL+K L        H R V +F +        ++  +   S+ + L  PE     +    ++  + Q+ EG+A++  +  I+ +L  ++I++  +   K++   + +L  +++   +        + APE +    ++IKSDVWSFGV+L EI+T      P      NP+ I     G     P+   +   +++K+C  +NP NR + + L++++
Sbjct:  239 KLERRLGQGQFGEVWMGLYNNNRQVAIKSLKPGTMSISAFLAEANLMKSLQ-------HPRLVRLFAVVTQEPIYIITEYMENGSLVDFLKTPEGSD--IPINTLIDMAAQVAEGMAYVEQKNYIHRDLRAANILVSHELTCKIADFGLARLIENNEYTAREGAKFPIKWTAPEAINYGTFSIKSDVWSFGVLLTEIVTYGRIPYPGM---TNPEVIANLERGYRMPCPDNCPEALYNVMKHCWTENPDNRPTFEFLRSVL 487          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: lck (LCK proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-040617-1])

HSP 1 Score: 59.6918 bits (143), Expect = 7.822e-9
Identity = 59/261 (22.61%), Postives = 122/261 (46.74%), Query Frame = 1
Query: 1240 KIKRKLSKEN-ASLYKAIDNFSKQES-ALLKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV-----YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIE--ISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKLQNLI 1995
            K++R+L +     ++  + N ++Q +   LK       +F    NL+K L        H R V +F +        ++  +   S+ + L  PE     +    ++  + Q+ EG+A++  +  I+ +L  ++I++  +   K++   + +L  +++   +        + APE +    ++IKSDVWSFGV+L EI+T      P      NP+ I     G     P+   +   +++K+C  +NP NR + + L++++
Sbjct:  239 KLERRLGQGQFGEVWMGLYNNNRQVAIKSLKPGTMSISAFLAEANLMKSLQ-------HPRLVRLFAVVTQEPIYIITEYMENGSLVDFLKTPEGSD--IPINTLIDMAAQVAEGMAYVEQKNYIHRDLRAANILVSHELTCKIADFGLARLIENNEYTAREGAKFPIKWTAPEAINYGTFSIKSDVWSFGVLLTEIVTYGRIPYPGM---TNPEVIANLERGYRMPCPDNCPEALYNVMKHCWTENPDNRPTFEFLRSVL 487          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: pdcd2l (programmed cell death 2-like [Source:Xenbase;Acc:XB-GENE-5805051])

HSP 1 Score: 62.3882 bits (150), Expect = 1.357e-9
Identity = 50/194 (25.77%), Postives = 92/194 (47.42%), Query Frame = 1
Query: 1291 DNFSKQESALLKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMV-MSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV-----YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDN 1854
            +N +K     LK      ++F E  NL+K L        H++ V ++ +      I +  E M   S+ + L   E  K  V    ++ +S QI EG+A++  +  I+ +L  +++++      K++   + ++  D++   +        + APE +    + IKSDVWSFGV+L+EIIT      P  +N +
Sbjct:  161 NNSTKVAVKTLKPGTMSVQAFMEEANLMKSLQ-------HDKLVRLYAVVSKEEPIYIITEFMAKGSLLDFLKSDEGAK--VILPKLIDFSAQIAEGMAYIEKKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGVLLYEIITTGKIPYPGMSNSD 345          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: pdcd2l (programmed cell death 2-like [Source:Xenbase;Acc:XB-GENE-5805051])

HSP 1 Score: 62.003 bits (149), Expect = 2.039e-9
Identity = 46/176 (26.14%), Postives = 86/176 (48.86%), Query Frame = 1
Query: 1345 KSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMV-MSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV-----YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDN 1854
            ++F E  NL+K L        H++ V ++ +      I +  E M   S+ + L   E  K  V    ++ +S QI EG+A++  +  I+ +L  +++++      K++   + ++  D++   +        + APE +    + IKSDVWSFGV+L+EIIT      P  +N +
Sbjct:  292 QAFMEEANLMKSLQ-------HDKLVRLYAVVSKEEPIYIITEFMAKGSLLDFLKSDEGAK--VILPKLIDFSAQIAEGMAYIEKKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGVLLYEIITTGKIPYPGMSNSD 458          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: pdcd2l (programmed cell death 2-like [Source:Xenbase;Acc:XB-GENE-5805051])

HSP 1 Score: 62.003 bits (149), Expect = 2.185e-9
Identity = 46/176 (26.14%), Postives = 86/176 (48.86%), Query Frame = 1
Query: 1345 KSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMV-MSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV-----YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDN 1854
            ++F E  NL+K L        H++ V ++ +      I +  E M   S+ + L   E  K  V    ++ +S QI EG+A++  +  I+ +L  +++++      K++   + ++  D++   +        + APE +    + IKSDVWSFGV+L+EIIT      P  +N +
Sbjct:  297 QAFMEEANLMKSLQ-------HDKLVRLYAVVSKEEPIYIITEFMAKGSLLDFLKSDEGAK--VILPKLIDFSAQIAEGMAYIEKKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGVLLYEIITTGKIPYPGMSNSD 463          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: pdcd2l (programmed cell death 2-like [Source:Xenbase;Acc:XB-GENE-5805051])

HSP 1 Score: 61.6178 bits (148), Expect = 2.218e-9
Identity = 50/192 (26.04%), Postives = 90/192 (46.88%), Query Frame = 1
Query: 1291 DNFSKQESALLKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMV-MSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV-----YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANN 1848
            +N +K     LK      ++F E  NL+K L        H++ V ++ +      I +  E M   S+ + L   E  K  V    ++ +S QI EG+A++  +  I+ +L  +++++      K++   + ++  D++   +        + APE +    + IKSDVWSFGV+L+EIIT      P   N
Sbjct:  261 NNSTKVAVKTLKPGTMSVQAFMEEANLMKSLQ-------HDKLVRLYAVVSKEEPIYIITEFMAKGSLLDFLKSDEGAK--VILPKLIDFSAQIAEGMAYIEKKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGVLLYEIITTGKIPYPGKGN 443          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: pdcd2l (programmed cell death 2-like [Source:Xenbase;Acc:XB-GENE-5805051])

HSP 1 Score: 62.003 bits (149), Expect = 2.401e-9
Identity = 46/176 (26.14%), Postives = 86/176 (48.86%), Query Frame = 1
Query: 1345 KSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMV-MSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV-----YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDN 1854
            ++F E  NL+K L        H++ V ++ +      I +  E M   S+ + L   E  K  V    ++ +S QI EG+A++  +  I+ +L  +++++      K++   + ++  D++   +        + APE +    + IKSDVWSFGV+L+EIIT      P  +N +
Sbjct:  272 QAFMEEANLMKSLQ-------HDKLVRLYAVVSKEEPIYIITEFMAKGSLLDFLKSDEGAK--VILPKLIDFSAQIAEGMAYIEKKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGVLLYEIITTGKIPYPGMSNSD 438          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Nek4 (NIMA (never in mitosis gene a)-related expressed kinase 4 [Source:MGI Symbol;Acc:MGI:1344404])

HSP 1 Score: 63.5438 bits (153), Expect = 1.442e-10
Identity = 51/190 (26.84%), Postives = 92/190 (48.42%), Query Frame = 1
Query: 1438 YKSASEIGVSMELMVMSMKNILDI----PENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV----YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKL 1983
            YK + E G  +  +VM      D+     E + +L+    +V+W  QI   L +LH++ I++ +L   ++ L   + IK+  + I ++  +H       +    Y +PEL  N+P+N KSDVW+ G  ++E+ T K  H   A + N+  +  I G     P+       ++I+  L + P  R SV+ +
Sbjct:   68 YKESWEGGDGLLYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEWFVQIAMALQYLHEKHILHRDLKTQNVFLTRTNIIKVGDLGIARVLENHGDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLK--HAFNAKDMNSLVYRIIEGKLPPMPKVYSTELAELIRTMLSRRPEERPSVRSI 255          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Nek4 (NIMA (never in mitosis gene a)-related expressed kinase 4 [Source:MGI Symbol;Acc:MGI:1344404])

HSP 1 Score: 62.003 bits (149), Expect = 2.221e-9
Identity = 51/190 (26.84%), Postives = 92/190 (48.42%), Query Frame = 1
Query: 1438 YKSASEIGVSMELMVMSMKNILDI----PENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV----YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKL 1983
            YK + E G  +  +VM      D+     E + +L+    +V+W  QI   L +LH++ I++ +L   ++ L   + IK+  + I ++  +H       +    Y +PEL  N+P+N KSDVW+ G  ++E+ T K  H   A + N+  +  I G     P+       ++I+  L + P  R SV+ +
Sbjct:   61 YKESWEGGDGLLYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEWFVQIAMALQYLHEKHILHRDLKTQNVFLTRTNIIKVGDLGIARVLENHGDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLK--HAFNAKDMNSLVYRIIEGKLPPMPKVYSTELAELIRTMLSRRPEERPSVRSI 248          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Nek4 (NIMA (never in mitosis gene a)-related expressed kinase 4 [Source:MGI Symbol;Acc:MGI:1344404])

HSP 1 Score: 61.6178 bits (148), Expect = 2.649e-9
Identity = 51/190 (26.84%), Postives = 92/190 (48.42%), Query Frame = 1
Query: 1438 YKSASEIGVSMELMVMSMKNILDI----PENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV----YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKL 1983
            YK + E G  +  +VM      D+     E + +L+    +V+W  QI   L +LH++ I++ +L   ++ L   + IK+  + I ++  +H       +    Y +PEL  N+P+N KSDVW+ G  ++E+ T K  H   A + N+  +  I G     P+       ++I+  L + P  R SV+ +
Sbjct:   68 YKESWEGGDGLLYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEWFVQIAMALQYLHEKHILHRDLKTQNVFLTRTNIIKVGDLGIARVLENHGDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLK--HAFNAKDMNSLVYRIIEGKLPPMPKVYSTELAELIRTMLSRRPEERPSVRSI 255          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:MGI Symbol;Acc:MGI:1203481])

HSP 1 Score: 60.8474 bits (146), Expect = 3.466e-9
Identity = 97/429 (22.61%), Postives = 179/429 (41.72%), Query Frame = 1
Query:  850 LVTFVKKPVKAANYSDL---------NNEEQTLENAGVKDNDRIAAITKISVKTKFSSILEDDEASFEINLLNIEKASTIYSLVKNKFKSSD---FVLMMNNQHLKSDKFM---FQYHIVDVGE-INYCRFY-SLSALTEDEKPLKEKIKRKLSKENA---------------SLYKAIDNFS-----KQESALLKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVM-SMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDN------LTMSHXXXXXXXXXXXXXXXXGKLFTDH----KSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFE---DIIKNCLIKNPINRISVKKL 1983
            +VTF   P++ A+  DL         + E + +      D+  +  +T   + T+  S+L+ D +S E+  +++  +     L  +   S+       ++  Q  +SD+F      Y     G  IN  R Y   + LT +EK  K    + L+ E A               ++Y  + +       KQ +     KL+  K +++   L +E+  LK +K H   V   G     + + + ME +   S+ +I++      E+V      K+++QIL+G+A+LHD  +++ +      + M   I+          ++   L   H    KS      + APE++    +  KSD+WS G  +FE+ TGK    P A+ D       I  +  + P    ++ E   D ++ CL ++   R S  +L
Sbjct:   91 IVTFPPDPLQEASQEDLKESNQVTSEHQEREQVHPVSPPDDAEMVGLTGRMLTTQ-PSLLKTDGSSEELCGVDVALSPPRPCLDSSLAASAAGEVAPCVLKEQQRQSDEFPTSDISYSSRRTGRCINGFRIYDEENFLTSNEK--KTLSDKSLNHEEAIFWTKGEILGRGAYGTVYCGLTSLGQLIAVKQVALDTSDKLATEKEYRK---LQEEVDLLKALK-HVNIVAYLGTCLEENTLSIFMEFVPGGSISSIINRFGPLPEMV----FCKYTRQILQGVAYLHDNCVVHRDIKGNNVMLMPTGIIKLIDFGCAKRLAWAGLNGTHSDMLKSMRGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKP---PLASMDRMAAMFYIGAHRGLMPPLPARFSEPAADFVRLCLTRDQHERPSALQL 505          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Nek4 (NIMA (never in mitosis gene a)-related expressed kinase 4 [Source:MGI Symbol;Acc:MGI:1344404])

HSP 1 Score: 61.2326 bits (147), Expect = 4.010e-9
Identity = 51/190 (26.84%), Postives = 92/190 (48.42%), Query Frame = 1
Query: 1438 YKSASEIGVSMELMVMSMKNILDI----PENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV----YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKL 1983
            YK + E G  +  +VM      D+     E + +L+    +V+W  QI   L +LH++ I++ +L   ++ L   + IK+  + I ++  +H       +    Y +PEL  N+P+N KSDVW+ G  ++E+ T K  H   A + N+  +  I G     P+       ++I+  L + P  R SV+ +
Sbjct:   68 YKESWEGGDGLLYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEWFVQIAMALQYLHEKHILHRDLKTQNVFLTRTNIIKVGDLGIARVLENHGDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLK--HAFNAKDMNSLVYRIIEGKLPPMPKVYSTELAELIRTMLSRRPEERPSVRSI 255          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P42686|SRK1_SPOLA (Tyrosine-protein kinase isoform SRK1 OS=Spongilla lacustris OX=6055 GN=SRK1 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.484e-10
Identity = 56/213 (26.29%), Postives = 104/213 (48.83%), Query Frame = 1
Query: 1369 LIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGK-----LFTDHKSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIE-ISGNESM-FPEGKYKWFEDIIKNCLIKNPINRISVKKLQ 1986
             ++E S +K ++ H + ++++ +      I +  ELM     ++L+       ++  + +V  + Q+  G+++L  Q  I+ +L   +I++      K++   + +     ++  H   +    + APE      + IKSDVWSFGVVL+EIIT   F  P      NP+ +E I  N  M  P    K F DI+ +C  ++P +R + + LQ
Sbjct:  280 FLQEASIMKRLR-HPKLIQLYAVCTKEEPIYIVTELM--KYGSLLEYLRGEDGVLKIEQLVDVAAQVASGMSYLEQQNYIHRDLAARNILVGEHGICKVADFGLARVIDEEIYEAHTGAKFPIKWTAPEAAMYNRFTIKSDVWSFGVVLYEIITYGRFPYPGM---TNPEVLEKIQQNYRMPCPANCPKQFHDIMLDCWREDPASRPTFETLQ 486          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2QAV0|TIO_ARATH (Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana OX=3702 GN=TIO PE=1 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 2.171e-9
Identity = 60/245 (24.49%), Postives = 122/245 (49.80%), Query Frame = 1
Query: 1276 LYKAIDNFSKQESALLKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMSMKNILD----IPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDH----KSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKLQ 1986
            +YK    ++ Q  A+ K+ +   K+ K+  +L +E+  L+ +K HE  +E+   +++A E  V  E     +  IL+    +PE + + ++        +Q+++ L +LH   II+ ++   +I++ + S +KL      +  + +    +S +   +Y APEL+K +P++   D+WS GV+L+E+  G+    P   N        I  +   +P+    +FE  +K  L K P +R++   L+
Sbjct:   20 VYKGRRKYTGQTVAM-KFIMKQGKTDKDIHSLRQEIEILRKLK-HENIIEMLDSFENAREFCVVTEFAQGELFEILEDDKCLPEEQVQAIA--------KQLVKALDYLHSNRIIHRDMKPQNILIGAGSVVKLCDFGFARAMSTNTVVLRSIKGTPLYMAPELVKEQPYDRTVDLWSLGVILYELYVGQP---PFYTNSVYALIRHIVKDPVKYPDEMSTYFESFLKGLLNKEPHSRLTWPALR 251          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P51957|NEK4_HUMAN (Serine/threonine-protein kinase Nek4 OS=Homo sapiens OX=9606 GN=NEK4 PE=1 SV=2)

HSP 1 Score: 62.7734 bits (151), Expect = 9.944e-9
Identity = 52/190 (27.37%), Postives = 91/190 (47.89%), Query Frame = 1
Query: 1438 YKSASEIGVSMELMVMSMKNILDI----PENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV----YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKL 1983
            YK + E G  +  +VM      D+     E + +L+    +V+W  QI   L +LH++ I++ +L   ++ L   + IK+  + I ++  +H       +    Y +PEL  N+P+N KSDVW+ G  ++E+ T K  H   A + N+  +  I G     P        ++I+  L K P  R SV+ +
Sbjct:   68 YKESWEGGDGLLYIVMGFCEGGDLYRKLKEQKGQLLPENQVVEWFVQIAMALQYLHEKHILHRDLKTQNVFLTRTNIIKVGDLGIARVLENHCDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLK--HAFNAKDMNSLVYRIIEGKLPPMPRDYSPELAELIRTMLSKRPEERPSVRSI 255          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0CL79|SEPH_ASPTN (Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=sepH PE=3 SV=2)

HSP 1 Score: 62.003 bits (149), Expect = 1.836e-8
Identity = 64/248 (25.81%), Postives = 111/248 (44.76%), Query Frame = 1
Query: 1270 ASLYKAIDNFSKQESALLKYKLSDWK--SFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMEL-----MVMSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFT--DHKSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNE-SMFPEGKYKWFEDIIKNCLIKNPINRISVKKL 1983
             S+Y+A++  + +  A+ + KL+D      +   +L+K L    IVK         G  KSA  + + +E      +    KN    PEN   LV       +  Q+L GL +LH+QG+I+ ++  ++I+   +  +KL+   +    T     S      + APE+++       SD+WS G  + E++ GK    P  N    P    I  ++    P+G     +D +  C  K+P  R+S +KL
Sbjct:   73 GSVYRALNWNTGETVAVKQIKLADLPKSELRLEIDLLKNLDHPNIVKYQ-------GFVKSAETLNIILEYCENGSLHSIAKNFGRFPEN---LVGL-----YMSQVLHGLLYLHEQGVIHRDIKGANILTTKEGLVKLADFGVASRTTGLSESSVVGTPYWMAPEVIELSGATTASDIWSLGCTVIELLEGKP---PYYNMQPMPALFRIVNDDHPPLPQGASPAVKDFLMQCFQKDPNLRVSARKL 302          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Z1J2|NEK4_MOUSE (Serine/threonine-protein kinase Nek4 OS=Mus musculus OX=10090 GN=Nek4 PE=1 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 2.903e-8
Identity = 51/190 (26.84%), Postives = 92/190 (48.42%), Query Frame = 1
Query: 1438 YKSASEIGVSMELMVMSMKNILDI----PENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV----YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKL 1983
            YK + E G  +  +VM      D+     E + +L+    +V+W  QI   L +LH++ I++ +L   ++ L   + IK+  + I ++  +H       +    Y +PEL  N+P+N KSDVW+ G  ++E+ T K  H   A + N+  +  I G     P+       ++I+  L + P  R SV+ +
Sbjct:   68 YKESWEGGDGLLYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEWFVQIAMALQYLHEKHILHRDLKTQNVFLTRTNIIKVGDLGIARVLENHGDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLK--HAFNAKDMNSLVYRIIEGKLPPMPKVYSTELAELIRTMLSRRPEERPSVRSI 255          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1Q3G1P1 (Putative mitogen-activated protein kinase kinase kinase 12 OS=Culex tarsalis OX=7177 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.330e-10
Identity = 68/209 (32.54%), Postives = 107/209 (51.20%), Query Frame = 1
Query: 1372 IKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMS-MKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTD---HKSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMF---PEGKYKWFEDIIKNCLIKNPINRISVK 1977
            IK L +L     HE  V+  G+   A    + ME      +  IL       +++S + +V WSQQI  G+ +LH   II+ +L   +I++D K  IK+S     + + +     S      + APE+++NEP N K D+WSFGVVL+E++TG+   +P  N D++     + GN S++   P    + F+ +IK C    P NR S K
Sbjct:  196 IKHLRKL----DHENIVKFKGVCTQAPVFCMIMEYCAFGPLHTIL---AQGGDVISPQRLVSWSQQIAHGMQYLHSHKIIHRDLKSPNILIDDKEVIKISDFGTSREWNEISTKMSFAGTVAWMAPEVIRNEPCNEKVDIWSFGVVLWELLTGE---VPYKNVDSSQIMYGV-GNNSLYLPIPASCPEGFKLLIKQCWSPKPRNRPSFK 393          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A067RRE9 (Protein kinase domain-containing protein (Fragment) OS=Zootermopsis nevadensis OX=136037 GN=L798_01989 PE=4 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.362e-10
Identity = 55/220 (25.00%), Postives = 108/220 (49.09%), Query Frame = 1
Query: 1345 KSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMS-MKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEK------NAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFP----EGKYKWFEDIIKNCLIKNPINRIS 1971
            ++  +   ++ E++ LKI     R V +  +Y++++E+ + +EL     ++ +LD  E  +E    +++ +  +QILEGL +LHD  I + +L   +++L          +    +    KS  +         Y APE+L  EP ++ +D+WS GV+ + +++G   + P A N     +  IS     FP    +G     +D I+  L+K+P  R++
Sbjct:   28 RATDQRKGILHEVAVLKIAADSARIVRLHEVYETSTEMALILELAAGGELQRVLDAEEGLEE----QHVARVMRQILEGLCYLHDNNIAHLDLKPQNLLLTGAYPDCDIKLCDFGISRVIKSGVEVREILGTPDYVAPEVLGYEPISLATDIWSVGVLTYVLLSG---YSPFAGNTKQETFCNISQCCLSFPDELFDGVSSVAKDFIQATLVKDPSKRLT 240          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1Q3G1Y9 (Putative mitogen-activated protein kinase kinase kinase 12 OS=Culex tarsalis OX=7177 PE=4 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.398e-10
Identity = 68/209 (32.54%), Postives = 107/209 (51.20%), Query Frame = 1
Query: 1372 IKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMS-MKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTD---HKSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMF---PEGKYKWFEDIIKNCLIKNPINRISVK 1977
            IK L +L     HE  V+  G+   A    + ME      +  IL       +++S + +V WSQQI  G+ +LH   II+ +L   +I++D K  IK+S     + + +     S      + APE+++NEP N K D+WSFGVVL+E++TG+   +P  N D++     + GN S++   P    + F+ +IK C    P NR S K
Sbjct:  196 IKHLRKL----DHENIVKFKGVCTQAPVFCMIMEYCAFGPLHTIL---AQGGDVISPQRLVSWSQQIAHGMQYLHSHKIIHRDLKSPNILIDDKEVIKISDFGTSREWNEISTKMSFAGTVAWMAPEVIRNEPCNEKVDIWSFGVVLWELLTGE---VPYKNVDSSQIMYGV-GNNSLYLPIPASCPEGFKLLIKQCWSPKPRNRPSFK 393          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: V4B9W7 (Protein kinase domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_53984 PE=4 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 5.238e-10
Identity = 71/249 (28.51%), Postives = 126/249 (50.60%), Query Frame = 1
Query: 1270 ASLYKAIDNFSKQE-SALLKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMS-MKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXX-XXXXXXGKLFTDHKSNE-----KNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPE----GKYKWFEDIIKNCLIKNPINRISVKK 1980
            A + K I+N +K+  +A    K    KS +E   +++E+  L++  SH R V++  +Y++ SE+ +  E      + +   I E+ +E    +++VK   QILEGL FLH+Q I++ +L   +I+L        +    +G     HK  +       A Y APE+L  EP +I++D+WS GV+ + ++T      P A ++    +  IS  +  FPE     K +  +D I   L+KN   R++ ++
Sbjct:    5 AVVKKCINNETKEVVAAKFIKKRRKGKSAREE--ILREVVMLEMAMSHPRLVDLLEVYETPSELILITEYCEGGELFHECVIEESFQE----QDVVKLVIQILEGLVFLHEQKIVHLDLKPQNILLTKPFPHGNIKICDLGFACLVHKGEDIRDIIGTADYVAPEVLDYEPLDIQTDMWSMGVLTYVMLTAFS---PFAGDNQQETFCNISTVKLDFPEELFDDKSEHCKDFISKLLVKNSRKRLTARQ 244          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A182IUM8 (Protein kinase domain-containing protein OS=Anopheles atroparvus OX=41427 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 8.958e-10
Identity = 65/208 (31.25%), Postives = 102/208 (49.04%), Query Frame = 1
Query: 1372 IKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMS--MKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTD---HKSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMF---PEGKYKWFEDIIKNCLIKNPINRIS 1971
            IK L +L     HE  V+  G+   A    + ME        K + D       ++S + +V WSQQI  G+ +LH   II+ +L   +I++     IK+S     + + +     S      + APE+++NEP N K D+WS+GVVL+E++TG+   +P  N D++   I   GN S++   P      F+ +IK C    P NR S
Sbjct:  244 IKHLRKL----DHENIVKFKGVCTQAPAFCIIMEYCAHGPLHKKLQD----NGGIISPQQLVSWSQQIAHGMQYLHSHKIIHRDLKSPNILIGENEVIKISDFGTSREWNEISTKMSFAGTVAWMAPEVIRNEPCNEKVDIWSYGVVLWELLTGE---VPYKNVDSS-QIIFGVGNNSLYLPIPASCPDGFQKLIKQCWNAKPRNRPS 439          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: zgc:194282 (tyrosine-protein kinase Srms [Source:NCBI gene;Acc:103032452])

HSP 1 Score: 68.1662 bits (165), Expect = 1.429e-11
Identity = 104/461 (22.56%), Postives = 212/461 (45.99%), Query Frame = 1
Query:  865 KKPVKAANYSDLNN-EEQTLENAGVKDNDRIAAITKIS----------------VKTKFSSILEDDEASFEINLLNIEKASTIYSLVKNKFKSSDFVLMMNNQH-------LKSDK--FMFQYHIVDVG------EINYC------RFY-----SLSALTED--------------EKPLKE-KIKRKLSKEN-ASLYKAIDNFSKQESALLKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMV-MSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKL-----FTDHKSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIIT-GKDFHLPTANNDNNPDWIEI--SG----NESMFPEGKYKWFEDIIKNCLIKNPINRISVKKLQNLIN*KYFN*YFKFI 2031
            KKPV+   Y+ L + E ++ E   V++ D+++ I K                  V   + ++++D+ A ++    NI +      L+  + K   F++ ++  H        +SDK  F F+ H   +G      ++++       R+Y     SL    +               E+P +E ++ RKL + +   +++A+     Q  A+   K  D K        +KE+  LK +  H + +++  L      + +  ELM   S+K+ L  PE   ++++  +++  + Q+ EG+A+L D+ I++ +L   +I++ S+ + K++   + ++     +T  ++ +    + APE   ++ +++KSDVWSFGV+L+E+++ GK   +P     NN + +EI  SG    + S  P   Y+    ++  C   +   R S   L + ++  Y   Y+K I
Sbjct:   47 KKPVQL--YAALFDFEARSEEELSVREGDKLSVIEKRGEYVLAKKLTGTLESGLVPANYVALVQDEFAKYKWYYGNINRQKAEKLLLATQNKPGSFLVRISESHSDEYTISARSDKNVFHFRIHRSTIGAYFVSDKVSFATLDELIRYYQNNPRSLGCPLDQPCVQQRELFDMEPWERPREEFQLSRKLGEGHFGEVWEALWTTKNQRVAIKMLKQEDTKL----DEFVKEVHALKNLH-HPKLIQLLALCTRGEPVFIITELMTKGSLKSYLATPEG--QVLTSAHLIYMACQVAEGMAYLEDRHIVHRDLAARNILVGSELECKVADFGLARIIKDSVYTASRNTKIPVRWTAPEAALHQRFSVKSDVWSFGVLLYEMMSRGK---MPY-EGKNNKEVLEILASGYRLPSPSRCPPNIYR----MMMECWAADGSKRPSFHALHSQLDNIYSRIYYKTI 490          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: lyn (tyrosine-protein kinase Lyn-like [Source:NCBI gene;Acc:103026730])

HSP 1 Score: 62.003 bits (149), Expect = 1.396e-9
Identity = 56/242 (23.14%), Postives = 109/242 (45.04%), Query Frame = 1
Query: 1291 DNFSKQESALLKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMSMKNILD-IPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV-----YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKLQNLIN 1998
            +N +K     LK      ++F E  NL+K L        HER V ++ +      I +  E M     ++LD +  +    +    ++ +S QI EG+A++  +  I+ +L  +++++      K++   + ++  D +   +        + APE +    + IKSD+WSFG++L+EIIT      P  +N      ++  G     PE       DI+  C    P +R +   +Q++++
Sbjct:  270 NNTTKVAVKTLKPGTMSVEAFLEEANLMKTLQ-------HERLVRLYAVVTKIEPIYIITEFMANG--SLLDFLKSDAGSKLQLPKLIDFSAQIAEGMAYIEKKNYIHRDLRAANVLVSESLLCKIADFGLARVIEDDQYTAREGAKFPIKWTAPEAINYGSFTIKSDMWSFGILLYEIITYGKIPYPGMSNGEVMTSVQ-RGYRMPRPESCPTELYDIMNTCWKNKPDDRPTFDYIQSVLD 501          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: TSSK6 (testis-specific serine/threonine-protein kinase 6-like [Source:NCBI gene;Acc:103023345])

HSP 1 Score: 61.6178 bits (148), Expect = 1.531e-9
Identity = 51/170 (30.00%), Postives = 91/170 (53.53%), Query Frame = 1
Query: 1333 LSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSA-SEIGVSMELMVMSM-KNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXX---XXXXGKLFTDHKSNEKNAV-YRAPELLKNEPWNIK-SDVWSFGVVLFEIITGK 1821
            ++DW     N  L +EL+ LK V+ H   V++  + ++    + + ME    ++ K IL+ P      VS  N  KW  Q++  + +LH++ I++ +L   +++L +   IK++      + K F D        + Y APE+L   P++ K SDVWS G+VL+E++TG+
Sbjct:   48 MTDWHV---NKFLSRELATLKTVR-HPHIVKVHKILETRKGRVFIVMEAAESTLLKKILEGP------VSVANAKKWFSQLVSAMVYLHERDIVHRDLKCENVLLSTDDQIKVTDFGLSCVCKGFPDLTETFSGTLQYMAPEVLSGRPYDPKKSDVWSLGIVLYELVTGR 207          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: stk17al (serine/threonine-protein kinase 17A-like [Source:NCBI gene;Acc:103021349])

HSP 1 Score: 60.8474 bits (146), Expect = 1.738e-9
Identity = 65/261 (24.90%), Postives = 130/261 (49.81%), Query Frame = 1
Query: 1243 IKRKLSKEN-ASLYKAIDNFSKQE-SALLKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMSMKNILD-IPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEK------NAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISG-----NESMFPEGKYKWFEDIIKNCLIKNPINRISVKKL 1983
            + R+L +   A + K ++  + +E +A    K    KS +E+  ++ E++ L+  K+++  V +  +Y++++EI + +E    +   I D    +  E  + K++++ ++QIL G+AFLH + +++ +L   +I+L     +    I    L     S  +         Y APE+L  E  +  +D+WS GV+ + ++TG+    P   NDN   ++ IS      ++ +F  G      D IK+ L KNP +R + ++ 
Sbjct:   32 VGRELGRGKFAVVKKCVEKATGKEYAAKFLRKRRKGKSCRED--IMNEIAVLESAKANQYVVGLHEVYETSNEIILVLE--CAAGGEIFDQCVGDSDEAFTEKDVIRLARQILTGVAFLHKKNVVHLDLKPQNILLTCTQPLGDIRIVDFGLSRHVNSTSEVREIVGTPEYVAPEILDYEKISTATDMWSIGVLTYVMLTGES---PFLGNDNQETYLNISQVNVDYSQDVF-HGISSLAVDFIKSLLHKNPADRATAEQC 284          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: STK4 (serine/threonine kinase 4 [Source:HGNC Symbol;Acc:HGNC:11408])

HSP 1 Score: 60.077 bits (144), Expect = 4.555e-9
Identity = 63/242 (26.03%), Postives = 106/242 (43.80%), Query Frame = 1
Query: 1369 LIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV----YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKD-----------FHLPT--ANNDNNPD-WIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKLQNLIN*KYFN*Y-FKFIMF 2037
            +IKE+S ++   S    V  +G Y   S++ + ME       ++ DI   R + ++   I    Q  L+GL +LH    I+ ++   +I+L+S+   KL+   +    TD  +     +    + APE+++   +N  +D+WS G+   E+  GK            F +PT       NPD W E               F D +  CL+KNP NR +  +L  +    YF  Y + F+ F
Sbjct:   73 IIKEISIMQQCNS-PHVVRYYGSYFKNSDLWIVMEYC--GAGSVSDIIRQRNKTLAEDEIAAILQSTLKGLEYLHFMRKIHRDIKAGNILLNSEGQAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRNPDQWSEP--------------FRDFVSQCLVKNPENRATATQLLQVFIFVYFGLYLYLFLHF 297          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 58.9214 bits (141), Expect = 9.567e-10
Identity = 44/144 (30.56%), Postives = 76/144 (52.78%), Query Frame = 1
Query: 1555 WSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGK--LFTDHKSNEKNAV--YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISV 1974
            ++ +I+ GL FLHDQGIIY +L + +I+LD    +K++   + K  +  D ++        Y APE++  + +N   D WSFGV+L+E++ G+    P   +D    +  I  +   +P    K   DI+   L + P+ R+ V
Sbjct:   93 YAAEIVSGLQFLHDQGIIYRDLKLDNILLDKDGHVKIADFGMCKENIVGDVRAGTFCGTPDYIAPEIVIGQKYNCSVDWWSFGVLLYEMLIGQS---PFRGDDEEELFESIRTSVPYYPRWITKDSRDILPLLLEREPMKRLGV 233          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008193.1 (pep scaffold:Pmarinus_7.0:GL476850:102262:127365:-1 gene:ENSPMAG00000007385.1 transcript:ENSPMAT00000008193.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 1.037e-9
Identity = 46/162 (28.40%), Postives = 81/162 (50.00%), Query Frame = 1
Query: 1531 VSFKNIVKWSQQILEGLAFLHDQGIIY-----DNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNE------SMFPEGKYKWFEDIIKNCLIKNPINRISVKKL 1983
            +S + +V W++ I  G+++LH   II+      N+ ++H      SD   S     K  +   S      + APE+++NEP + K D+WSFGVVL+E++TG+   +P  + D++     +  N       +  PEG    F+ ++  C    P NR S +++
Sbjct:   97 ISPELLVGWTRGIARGMSYLHLHKIIHRDLKSPNVLITHDDEVKISDFGTSKEMREK--STRMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGE---IPYRDVDSSAIIWGVGSNSLHLPIPASCPEG----FKILLTQCWNSKPRNRPSFRQI 249          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006670.1 (pep scaffold:Pmarinus_7.0:GL482639:18:11990:1 gene:ENSPMAG00000006016.1 transcript:ENSPMAT00000006670.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 1.119e-9
Identity = 54/216 (25.00%), Postives = 98/216 (45.37%), Query Frame = 1
Query: 1366 NLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMV-MSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV--------YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKLQ 1986
            + ++E   +K ++ H + ++++ +      I +  ELM   S+ N L  PE R   +    +V  + Q+  G+A+L  Q  I+ +L   +I++   +  K++   + ++      +E  A         + APE      ++IKSDVWSFGV+L EIIT      P   N      ++  G     P G  + F D++  C   +   R + + LQ
Sbjct:  153 DFLREAQLMKRLR-HPKLIQLYAVCTQEEPIYIITELMSNGSLANYLQTPEGRS--LDLVELVDMAAQVAAGMAYLEAQNYIHRDLAARNILVAEHNACKVADFGLARVIKMSNEDEYEARVGSKFPIKWTAPEAANYNRFSIKSDVWSFGVLLHEIITYGKLPYPGQTNAEVLAAVD-RGYRMPCPPGCPQAFYDLMLECWNVDDQARPTFETLQ 364          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: hck (HCK proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-090313-72])

HSP 1 Score: 59.3066 bits (142), Expect = 1.637e-9
Identity = 51/223 (22.87%), Postives = 105/223 (47.09%), Query Frame = 1
Query: 1345 KSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMSMKNILD-IPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV-----YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKLQNLI 1995
            ++F +  NL+K L   ++V+          LY   ++  + +    M   ++LD +       +    ++  + QI EG+AF+  +  I+ +L  ++I+++ +   K++   + ++  D++   +        + APE +    ++IKSDVWSFG++L EIIT      P  +N +    +E  G     PE   K    ++ +C  + P  R + + LQ ++
Sbjct:  220 EAFLDEANLMKTLQHPRLVR----------LYAVVTQEPIYIVTEFMENGSLLDYLKSTEGSTLPMPKMIDMAAQIAEGMAFIERKNYIHRDLRAANILVNEQLASKIADFGLARIIEDNEYTAREGAKFPIKWTAPEAINYGSFSIKSDVWSFGILLTEIITFGRIPYPGMSNSDVIRQLE-RGYRMPCPEQAPKQLYGVMMDCWKERPEERPTFEYLQGVL 431          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002088.1 (pep scaffold:Pmarinus_7.0:GL478600:446:35095:-1 gene:ENSPMAG00000001892.1 transcript:ENSPMAT00000002088.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 2.416e-9
Identity = 41/155 (26.45%), Postives = 78/155 (50.32%), Query Frame = 1
Query: 1546 IVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSN---EKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNE------SMFPEGKYKWFEDIIKNCLIKNPINRISVKKL 1983
            + +W+  I  G+ +LH   II+ +L   ++++     +K+S     K   D  +         + APE+++NEP + K D+WSFGVVL+E++TG+   +P  + D++     +  N       +  P+G    F+ ++  C    P NR S +++
Sbjct:   37 LYRWTTGIASGMNYLHLHKIIHRDLKSPNVLITHDDLVKISDFGTSKELMDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGE---IPYRDVDSSAIIWGVGSNSLHLPVPTSCPDG----FKILLTQCWTGKPRNRPSFRQI 184          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: STE7 (Signal transducing MAP kinase kinase; involved in pheromone response where it phosphorylates Fus3p; involved in the pseudohyphal/invasive growth pathway where it phosphorylates of Kss1p; phosphorylated by Ste11p; degraded by ubiquitin pathway [Source:SGD;Acc:S000002318])

HSP 1 Score: 58.151 bits (139), Expect = 2.540e-9
Identity = 64/229 (27.95%), Postives = 114/229 (49.78%), Query Frame = 1
Query: 1369 LIKELSRLKIVKSHERFVEIFGLYKSA---SEIGVSMELM-VMSMKNILDIPEN--RKELVSFK-------NIVKWSQQILEGLAFLHDQ-GIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNE--KNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIE------ISGNESMFPEGKY--KWFEDIIKNCLIKNPINRISVKKL 1983
            L++ELS +K VK HE  +  +G Y +    +EI + ME     S+  IL + +   ++  VS K        I K +  +L GL  L+ Q  II+ ++  S+++++SK  IKL    + K   +  ++     + Y +PE ++   ++IK DVWS G+++ E++TG+    P   +++ PD I       ++      P+ +   K   D +  C IKN   R S+ +L
Sbjct:  235 LVRELSIVKNVKPHENIITFYGAYYNQHINNEIIILMEYSDCGSLDKILSVYKRFVQRGTVSSKKTWFNELTISKIAYGVLNGLDHLYRQYKIIHRDIKPSNVLINSKGQIKLCDFGVSKKLINSIADTFVGTSTYMSPERIQGNVYSIKGDVWSLGLMIIELVTGE---FPLGGHNDTPDGILDLLQRIVNEPSPRLPKDRIYSKEMTDFVNRCCIKNERERSSIHEL 460          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: PHO85 (Cyclin-dependent kinase; has ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle; human lissencephaly-associated homolog CDK5 functionally complements null mutation [Source:SGD;Acc:S000005952])

HSP 1 Score: 56.6102 bits (135), Expect = 4.384e-9
Identity = 62/221 (28.05%), Postives = 117/221 (52.94%), Query Frame = 1
Query: 1270 ASLYKAIDNFSKQESALLKYKLSDWKSFKENPNL-IKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMSMKNILDIPENRKELVSFK-NIVKWSQ-QILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV----YRAPE-LLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWI-EISG--NESMFP 1899
            A++YK ++  +    AL + KL    S +  P+  I+E+S +K +K HE  V ++ +  + +++ +  E M   +K  +D           + N+VK+ Q Q+L+GLAF H+  I++ +L   +++++ +  +KL    + + F    +   + V    YRAP+ L+ +  ++   D+WS G +L E+ITGK    P  N++     I +I G  NES++P
Sbjct:   19 ATVYKGLNKTTGVYVALKEVKLD---SEEGTPSTAIREISLMKELK-HENIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPL-FPGTNDEEQLKLIFDIMGTPNESLWP 234          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: FRK1 (Protein kinase of unknown cellular role; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm; interacts with rRNA transcription and ribosome biogenesis factors and the long chain fatty acyl-CoA synthetase Faa3p; FRK1 has a paralog, KIN4, that arose from the whole genome duplication [Source:SGD;Acc:S000006062])

HSP 1 Score: 55.0694 bits (131), Expect = 3.259e-8
Identity = 57/246 (23.17%), Postives = 123/246 (50.00%), Query Frame = 1
Query: 1294 NFSKQESALLKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMS--MKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDH----KSNEKNAVYRAPEL-LKNEPWNI-KSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEIS-------GNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKLQ 1986
            +F KQ +  L  + S    +++   + +E++ LK + SH   V++  + +++  IG+ +E        K I      +K  +   N  +   Q++ G+ ++H +G+++ +L + +++LD   ++ ++       F       K++  +  Y APEL +  EP+   K+D+WS GV+L+ I+ G   +LP  ++ NNP+  +I             FP+       D+++  L+ +P  RI++K+++
Sbjct:   72 DFPKQVAIKLIKRDSISNDYRKEVKIYREINALKHL-SHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYI-----QKKRRLKEMNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNELMKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAILAG---YLPWDDDPNNPEGSDIGRLYNYINSTPLKFPDYILPIPRDLLRRMLVSDPKKRINLKQIK 308          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 52.7582 bits (125), Expect = 1.308e-7
Identity = 57/227 (25.11%), Postives = 103/227 (45.37%), Query Frame = 1
Query: 1369 LIKELSRLKIVKSHERFVEIFGLY--KSASEIGVSMELMV-----MSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIY-----DNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMF-------PEGKYKW---FEDIIKNCLIKNPINRISVKKL 1983
            + +EL   K  KS +  V+ +G++  + +S I ++ME M       + KN+L     R   +S + I K ++ +L GL++LH++ +I+      N+ ++        D  +S  ++  L          + Y APE ++ +P+++  DVWS G+ L E+  G+ F   +     N   IE+      F       PE    W   F   I  CL K+   R S +++
Sbjct:  258 IFRELQFNKSFKS-DYIVQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLL----KRGGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKGEIKLCDFGVSGEAVNSLAMTFTGT---SFYMAPERIQGQPYSVTCDVWSLGLTLLEVAGGR-FPFESDKITQNVAPIELLTMILTFSPQLKDEPELDISWSKTFRSFIDYCLKKDARERPSPRQM 475          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: MKK1 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p; MKK1 has a paralog, MKK2, that arose from the whole genome duplication [Source:SGD;Acc:S000005757])

HSP 1 Score: 52.7582 bits (125), Expect = 1.405e-7
Identity = 40/149 (26.85%), Postives = 74/149 (49.66%), Query Frame = 1
Query: 1411 ERFVEIFGLYK--SASEIGVSMELMVMS-----MKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIY-----DNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGK 1821
            E  V  +G++     S I ++ME M         KN+L+    R   +S K + K ++ +L GL++LH++ +I+      N+ ++        D  +S  ++  L T        + Y APE ++ +P+++ SDVWS G+ + E+  GK
Sbjct:  278 EYIVRYYGMFTDDENSSIYIAMEYMGGRSLDAIYKNLLE----RGGRISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNENGQVKLCDFGVSGEAVNSLATTFTGT---SFYMAPERIQGQPYSVTSDVWSLGLTILEVANGK 419          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49138 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH03])

HSP 1 Score: 63.1586 bits (152), Expect = 5.901e-11
Identity = 48/157 (30.57%), Postives = 77/157 (49.04%), Query Frame = 1
Query: 1525 ELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLF---TDH-KSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKL 1983
            E  S + I+ W  Q+L  L  +H Q I++ +L   +I L     +K+    I ++     DH ++      Y +PE+ + +P+N KSD+W+ G VL+E+ T    H  TA+N  N     + GN    P       ED++   L  NP +R S K+L
Sbjct:   97 EPFSSERILNWLAQLLLALKHIHGQNILHRDLKTQNIFLTKDDVVKIGDFGIARILDSTCDHARTTVGTPYYLSPEICQRQPYNNKSDIWALGCVLYELTTRT--HPFTADNLTNLVVKILHGNYPPIPRFYGPLLEDLVAVMLKINPADRPSAKQL 251          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO37575 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFG8])

HSP 1 Score: 62.7734 bits (151), Expect = 1.849e-10
Identity = 59/206 (28.64%), Postives = 101/206 (49.03%), Query Frame = 1
Query: 1408 HERFVEIFGLYKSASEIGVSMELMVMSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNA--------VYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGN------ESMFPEGKYKWFEDIIKNCLIKNPINRISVKKL 1983
            H   +   G+   A    V ME        + ++  + +E ++ + +V W+ QI +G+ +LH   II+ +L   +I++ S   +K+S     K F     NEK+A         + APE+++NEP + K DVWSFGV+L+E++TG+   LP    D++     +  N       S  PEG     + ++K C    P NR S +++
Sbjct:   80 HPNIIRFKGVCNQAPVYCVVMEYC--PYGQLFEVLRDGRE-ITPELLVGWTTQIADGMHYLHGNKIIHRDLKSPNILVSSNDILKISDFGTCKEF-----NEKSAKMTFAGTVAWMAPEVIRNEPCSEKVDVWSFGVLLWELLTGE---LPYKGVDSSAIIWGVGSNNLQLPVPSTCPEG----IQLLMKLCWNSKPKNRPSFRQV 270          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO32137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVX1])

HSP 1 Score: 58.5362 bits (140), Expect = 2.828e-9
Identity = 56/232 (24.14%), Postives = 102/232 (43.97%), Query Frame = 1
Query: 1348 SFKENPNLIKELSRLKIVKSHERFVEIFG-------LYKSASEIGVSMELMVMSMKNILDIPENR-KELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAVYRAP-------ELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKLQNLIN 1998
            S +E  +L+KE   LK +K H   +++ G       L+K+   +    E       +    PE + K  +S + +++++ Q+ +G+ +L  Q II+ +L   +I++      K++   + K  ++     +    R P        L+    +   SDVWSFGVVL+EI T      P     + PD +E +G     P         ++ +C    P +R +   LQ L+N
Sbjct:   54 SDRETRDLMKEFELLKTLKPHPHVIKMLGCGEDDGMLHKTGGGLCRGEE------DDYYSDPEIKPKTSLSSQQLIRFAWQVADGMEYLSSQKIIHRDLAARNILVGEGEVCKVADFGMAKDVSNEDIYIRTTEGRLPVKWTAVEALIGGGEYTTLSDVWSFGVVLYEICTIGGEPYPGIAGKDIPDCLE-TGYRMPCPTHVDATLYQVMASCWATCPDDRPTFASLQKLLN 278          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO34646 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNS0])

HSP 1 Score: 56.6102 bits (135), Expect = 1.053e-8
Identity = 45/196 (22.96%), Postives = 102/196 (52.04%), Query Frame = 1
Query: 1240 KIKRKLSKENASL-YKAIDNFSKQESALLKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELM-VMSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV----YRAPELLKNEPWNIKSDVWSFGVVLFEI 1809
            +I++K+ +   S+ YKA    + Q  AL K ++ D    K   + IKE+  LK + +H   ++ +  +   +E+ + +EL     +  ++   + +K L+  + + K+  Q+   L  +H + +++ ++  +++ + +   +KL  + +G+ F+   +   + V    Y +PE +K   +N KSD+WS G +L+E+
Sbjct:   22 EIEKKIGRGQFSVVYKARCTANNQIVALKKIQIFDMMDAKARQDCIKEIDLLKQL-NHPNVIKYYASFIENNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLTAALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIKENGYNFKSDIWSLGCLLYEM 216          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49822 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG20])

HSP 1 Score: 54.6842 bits (130), Expect = 4.279e-8
Identity = 45/151 (29.80%), Postives = 75/151 (49.67%), Query Frame = 1
Query: 1543 NIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV----YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDI---IKNCLIKNPINRISV 1974
             ++ W  QI  GL  +HD+ I++ ++   +I L     IK+    I ++        +  +    Y +PE+++N P+N KSD+WS G VL+E++T K  H   A N  N     I G+   +P    ++  DI   +   L +NP +R SV
Sbjct:  104 QVMDWFVQICLGLKHVHDRKILHRDIKSQNIFLTRHGIIKMGDFGIARVLHSTVELARTCIGTPYYLSPEIVENRPYNNKSDIWSLGCVLYEMLTLK--HAFEAGNMKNLVLKIIRGS---YPPIPLRYSADIRMLVAQLLKRNPHDRPSV 249          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000038909.1 (tyrosine-protein kinase SRK3 [Source:NCBI gene;Acc:101169425])

HSP 1 Score: 66.2402 bits (160), Expect = 6.155e-11
Identity = 71/284 (25.00%), Postives = 138/284 (48.59%), Query Frame = 1
Query: 1222 EKPLKE-KIKRKLSKEN-ASLYKAIDNFSKQESALLKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMV-MSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKL-----FTDHKSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIIT-GKDFHLPTANNDNNPDWIEISGN-----ESMFPEGKYKWFEDIIKNCLIKNPINRISVKKLQNLIN*KYFN*YFKFI 2031
            E+P +E K+ +KL + N   +++A+     ++ A+   K  D K        +KE+  LK +  H R +++  +      + +  ELM   S+K+ L   E    ++S  +++  S QI EG+A+L D+ I++ +L   +I++      K++   + ++     +T  ++ +    + APE   ++ +++KSDVWSFGV+L+E+++ GK   +P     N      ++        +  PE  YK    I+ +C    P  R S   L + ++  Y   YFK +
Sbjct:  233 ERPREEFKLYKKLGEGNFGEVWEALWVKENKKVAIKTLKQEDTK----QDEFVKEVHALKNLH-HPRLIQLLAMCSRGEPVYIVTELMSKGSLKSYLASAEG--HMLSSAHLIYMSGQISEGMAYLEDRNIVHRDLAARNILVGDDLVCKVADFGLARIIRDSVYTASRNTKIPVRWTAPEAALHQRFSVKSDVWSFGVLLYEMMSRGK---MPYEGKSNKEVMTILTSGYRLACPTRCPENIYK----IMMDCWAAEPSKRPSFHALHSQLDAIYAKIYFKTV 502          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: nek4 (NIMA related kinase 4 [Source:NCBI gene;Acc:101169778])

HSP 1 Score: 60.077 bits (144), Expect = 8.035e-9
Identity = 46/159 (28.93%), Postives = 79/159 (49.69%), Query Frame = 1
Query: 1513 ENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV----YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVK 1977
            + + EL+  + +V+W  QI   L +LH++ I++ +L   +I L   + IK+  + I ++  +        +    Y +PEL  N+P+N KSDVW+ G  ++E+ T K  H   A + N+  +  + G     P        D+IK+ L K P  R  VK
Sbjct:   95 QRKGELLPERQVVEWFVQIAMALQYLHERNILHRDLKTQNIFLTKTNIIKVGDLGIARVLENQNDMASTLIGTPYYMSPELFSNKPYNHKSDVWALGCCVYEMSTLK--HAFNAKDMNSLVYRIVEGKLPQMPSRYDPQLGDLIKSMLSKKPEERPDVK 251          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: nek6 (NIMA related kinase 6 [Source:NCBI gene;Acc:101173323])

HSP 1 Score: 57.7658 bits (138), Expect = 1.228e-8
Identity = 42/196 (21.43%), Postives = 102/196 (52.04%), Query Frame = 1
Query: 1240 KIKRKLSKENAS-LYKAIDNFSKQESALLKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELM-VMSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV----YRAPELLKNEPWNIKSDVWSFGVVLFEI 1809
            +++RK+ +   S +Y+A+    +Q  AL K ++ +    K   + IKE+  LK + +H   ++    +   +E+ + +EL     +  ++   + ++ L+  + I K+  Q+   L  +H + +++ ++  +++ + +  ++KL  + +G+ F+   +   + V    Y +PE +    +N KSD+WS G +L+E+
Sbjct:   42 RVERKIGRGQFSEVYRAVRLLDRQSVALKKVQIFEMMDAKARQDCIKEIDLLKQL-NHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKKRRLIPERTIWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGEVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEM 236          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: lyn (tyrosine-protein kinase Lyn [Source:NCBI gene;Acc:101167902])

HSP 1 Score: 58.9214 bits (141), Expect = 1.290e-8
Identity = 51/224 (22.77%), Postives = 104/224 (46.43%), Query Frame = 1
Query: 1345 KSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMSMKNILDIPENR-KELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAV-----YRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKLQNLIN 1998
            ++F E  N++K L        HER V ++ +      I +  E M     ++LD  ++     +    ++ +S QI EG++F+  +  I+ +L  +++++      K++   + ++  D + + +        + APE +    + IKSD+WSFGV+L+EIIT      P          I+  G     PE       +I+ +C    P +R + + +Q++++
Sbjct:  284 EAFLEEANIMKTLQ-------HERLVRLYAVVTKTEPIYIITEYMANG--SLLDFLKSEVGGKLQLPKLIDFSAQIAEGMSFIEKRNYIHRDLRAANVLVSESLLCKIADFGLARVIEDDEYSAREGAKFPIKWTAPEAINYGSFTIKSDMWSFGVLLYEIITFGKIPYPGMTKGEVVSSIQ-RGYRMPRPENCPTQLYEIMTSCWKFRPEDRPTFEYMQSVLD 497          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k12 (mitogen-activated protein kinase kinase kinase 12 [Source:NCBI gene;Acc:101162759])

HSP 1 Score: 58.9214 bits (141), Expect = 1.518e-8
Identity = 60/211 (28.44%), Postives = 101/211 (47.87%), Query Frame = 1
Query: 1372 IKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMS-MKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSN---EKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESM---FPEGKYKWFEDIIKNCLIKNPINRISVKKL 1983
            IK L +LK    H   +   G+   A    + ME      +  +L     RK   S   +V WS  I  G+ +LH   II+ +L   ++++     +K+S     K  +D  +         + APE+++NEP + K D+WSFGVVL+E++TG+   +P  + D++   I   GN S+    PE     F+ +++ C    P NR S +++
Sbjct:  200 IKHLRKLK----HPNIITFKGVCTQAPCYCILMEYCAQGQLYEVLRA--GRKITPSL--LVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITHDDLVKISDFGTSKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWEMLTGE---IPYKDVDSS-AIIWGVGNNSLQLPIPESCPDGFKILLRQCWNCKPRNRPSFRQI 398          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000003859.1 (SMESG000003859.1)

HSP 1 Score: 1240.33 bits (3208), Expect = 0.000e+0
Identity = 652/652 (100.00%), Postives = 652/652 (100.00%), Query Frame = 1
Query:   43 MILFVFVIYLCILSTLNGEEPISVCAREFPFRLSDSKCANFNAICVKKDDAQCNLLQDACKQCPPSKITVIILQEILRIVKYRLXXXXXXXXXXXXXXXXXXMLENRFKLISKCCFSVIKKKKIDYYQLLRSRKRITAVSNFTKDSGVNLKFLVPLKKSIELHVYGNENNVSVKKRICKKWPEARAGSYKMMKFICNGVELDDNQYLMSCITSYKDEITCQLDYSLDIRNILVLRVNGIKRHTELVQIDKDKKISDLNKILCKLLDQSDLVTFVKKPVKAANYSDLNNEEQTLENAGVKDNDRIAAITKISVKTKFSSILEDDEASFEINLLNIEKASTIYSLVKNKFKSSDFVLMMNNQHLKSDKFMFQYHIVDVGEINYCRFYSLSALTEDEKPLKEKIKRKLSKENASLYKAIDNFSKQESALLKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKLQNLIN 1998
            MILFVFVIYLCILSTLNGEEPISVCAREFPFRLSDSKCANFNAICVKKDDAQCNLLQDACKQCPPSKITVIILQEILRIVKYRLVNFLIVIFTFNVVVVILLMLENRFKLISKCCFSVIKKKKIDYYQLLRSRKRITAVSNFTKDSGVNLKFLVPLKKSIELHVYGNENNVSVKKRICKKWPEARAGSYKMMKFICNGVELDDNQYLMSCITSYKDEITCQLDYSLDIRNILVLRVNGIKRHTELVQIDKDKKISDLNKILCKLLDQSDLVTFVKKPVKAANYSDLNNEEQTLENAGVKDNDRIAAITKISVKTKFSSILEDDEASFEINLLNIEKASTIYSLVKNKFKSSDFVLMMNNQHLKSDKFMFQYHIVDVGEINYCRFYSLSALTEDEKPLKEKIKRKLSKENASLYKAIDNFSKQESALLKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHIILDSKSDIKLSSISIGKLFTDHKSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKLQNLIN
Sbjct:    1 MILFVFVIYLCILSTLNGEEPISVCAREFPFRLSDSKCANFNAICVKKDDAQCNLLQDACKQCPPSKITVIILQEILRIVKYRLVNFLIVIFTFNVVVVILLMLENRFKLISKCCFSVIKKKKIDYYQLLRSRKRITAVSNFTKDSGVNLKFLVPLKKSIELHVYGNENNVSVKKRICKKWPEARAGSYKMMKFICNGVELDDNQYLMSCITSYKDEITCQLDYSLDIRNILVLRVNGIKRHTELVQIDKDKKISDLNKILCKLLDQSDLVTFVKKPVKAANYSDLNNEEQTLENAGVKDNDRIAAITKISVKTKFSSILEDDEASFEINLLNIEKASTIYSLVKNKFKSSDFVLMMNNQHLKSDKFMFQYHIVDVGEINYCRFYSLSALTEDEKPLKEKIKRKLSKENASLYKAIDNFSKQESALLKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHIILDSKSDIKLSSISIGKLFTDHKSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKLQNLIN 652          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000003862.1 (SMESG000003862.1)

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 364/657 (55.40%), Postives = 473/657 (71.99%), Query Frame = 1
Query:   43 MILFVFVIYLCILSTLNGEEPISVCAREFPFRLSDSKCANFNAICVKKDDAQCNLLQDACKQCPPSKITVIILQEILRIVKYRLXXXXXXXXXXXXXXXXXXMLENRFKLISKCCFSVIKKKKIDYYQLLRSRKRITAVSNFTKDSGVNLKFLVPLK-KSIELHVYGNENNVSVKKRICKKWPEARAGSYKMMKFICNGVELDDNQYLMSCITSYKDEITCQLDYSLDIRNILVLRVNGIKRHTELVQIDKDKKISDLNKILCKLLDQSDLVTFVKKPVKAANYSDLNNEEQTLENAGVKDNDRIAAITKISVKTKFSSILEDDEASFEINLLNIEKASTIYSLVKNKFKSSDFVLMMNNQHLKSDKFMFQYHIVDVGEINYCRFYSLSALTEDEKPLKEKIKR-KLS-------KENASLYKAIDNFSKQESALLKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPT-ANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKL 1983
            M LFV  IYL ILS +NG+EPISVC+R  PFRLSDSKCAN+  IC K+DD QCN LQ+ACKQCPPS++TVI+LQEILRIVKYRLVNFLI I   NVV   LL+ ENRFK+I+K C  + KKK+++ Y LL+SRK  T  +N   D G  LK  +P + K IELHVYGNEN V +KKR+CKKWP+A++ SYK+MK I  G  LDDN+ ++S I S++ EI CQ+DYS++  +ILVLRV GI+R TELVQI+K KKISDLN+ILCKLLDQSDLV +V KP  AANYSDLNN + TL  AGVKDND+I AITK  VK  FSSIL +DE +F   L N+E+ S+I ++V+ KFKS D VL++  + + S++F+FQY+I D  +I YCRF  + A  ++ KPLKE + R + S       +E + +YKA DNF+ +E AL++Y+LSDWK+F  N +LIKEL +L ++ + ERFV IF +YK    + VSMELM +S+K      + +  + S   ++KW +QILEGLA LHD GI+YD LTMSHI+LDSK DIKL+SI+IGK+    K NE N  Y APE+L N+PWNIK+DVWSFG++L EIITGK F+        N   + +I   + +FP    + F+ +I +CL ++P NRISV+ L
Sbjct:    1 MNLFVIFIYLYILSNVNGQEPISVCSRNRPFRLSDSKCANYTGICSKQDDDQCNQLQNACKQCPPSEMTVIMLQEILRIVKYRLVNFLIAILIVNVVAFFLLVFENRFKIITKFCSLLCKKKQVNVYHLLQSRKGKTYYANCIGDFGTKLKLRLPTENKVIELHVYGNENVVKIKKRVCKKWPKAKSDSYKIMKLIYKGKCLDDNENILSLIGSHRGEILCQMDYSVNASDILVLRVAGIRRDTELVQINKGKKISDLNQILCKLLDQSDLVIYV-KPSDAANYSDLNNPDLTLVKAGVKDNDQIVAITKKPVKIMFSSILSNDE-NFNSELSNVERVSSILNIVEQKFKSED-VLIIGERDMISEQFLFQYNIDDESQIKYCRFNEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKIIPGQKRNEINKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIHSCLNEDPNNRISVRVL 654          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000003878.1 (SMESG000003878.1)

HSP 1 Score: 489.189 bits (1258), Expect = 4.379e-165
Identity = 305/637 (47.88%), Postives = 412/637 (64.68%), Query Frame = 1
Query:   88 LNGEEPISVCAREFPFRLSDSKCANFNAICVKKDDAQCNLLQDACKQCPPSKITVIILQEILRIVKYRLXXXXXXXXXXXXXXXXXXMLENRFKLISKCCFSVIKKKKIDYYQLLRSRKRITAVSNFTKDSGVNLKFLVPLK-KSIELHVYGNENNVSVKKRICKKWPEARAGSYKMMKFICNGVELDDNQYLMSCITSYKDEITCQLDYSLDIRNILVLRVNGIKRHTELVQIDKDKKISDLNKILCKLLDQSDLVTFVKKPVKAANYSDLNNEEQTLENAGVKDNDRIAAITKISVKTKFSSILEDDEASFEINLLNIEKASTIYSLVKNKFKSSDFVLMMNNQHLKSDKFMFQYHIVDVGEINYCRFYSLSALTEDEKPLKEK-IKRKLSKENASLYKAIDNFSKQESALLKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPT---ANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKL 1983
            L  +EPISVC++  P+ L DSKCANF  IC K+DD +C+ LQ +CKQCPPSKITV          KY+L+N +I I TFN+V+ +LL++ENRFKLI          KK + YQ++ SRKR    SNF  D G  LKF +P + K IELHVYGN+N V++KK ICKKWP+A++ SYK+MK I  G  LDDNQ ++S I S++ EI CQ+DYS++  +ILVLRV GI+R TELVQI+K K ISDL +ILCKL +   +  FV KP K   YS L + + T E A + D  RI  + +  V+ KF SIL +DE  F I     E  S I++ +K KFKS +FVLMMNN  +KSD+F+FQY+I +  +  YCRFY            K   IK++ SK    L KA DN + +E A+++YKLSDWK+F  +  LI EL +L     +ERFV+I  +YK    + VSMELM MS+K      + + +  S + ++KWS+QILEGL  LHD GI YD LTMS+I+LD+K DIKL++I+I       K ++ N ++ APE+ K + WNIK+DVWSFGV+L EIITGK F+      A ND+N  + +I   + +FP    + F+ +I  CL+++P  RISV +L
Sbjct:    5 LEFKEPISVCSQNRPYTLFDSKCANFFDICTKQDDYECDQLQASCKQCPPSKITV----------KYQLMNIMIQILTFNIVIFVLLIIENRFKLI----------KKFNTYQIIHSRKREIEFSNFIGDFGTKLKFRLPTENKVIELHVYGNDNVVNIKKHICKKWPKAQSDSYKIMKLIYKGKCLDDNQNILSFIGSHRGEILCQMDYSVNANDILVLRVAGIRRDTELVQINKGKNISDLKQILCKLFNCKGISMFV-KPSKDEKYSPLKDLDMTFEAAKLCDKVRIVVVKEKPVRIKFQSIL-NDEDPFVIEQSRTESVSAIFARLKQKFKSENFVLMMNNCIMKSDRFLFQYNIDEETQTTYCRFYEREERKRGFHSFKSLFIKQEFSK----LGKATDNITNREVAVMEYKLSDWKAFMNSSGLINELRKLDAANGNERFVQIIAIYKGLESVTVSMELMSMSVKERFATIDGKVKKASNEQVIKWSRQILEGLVCLHDNGIAYDELTMSNILLDNKDDIKLATINIDTAIHGLKFDDNNGMHLAPEIRKGKLWNIKADVWSFGVILLEIITGKCFNFSAKKEALNDSN--FFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHEL 613          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000003878.1 (SMESG000003878.1)

HSP 1 Score: 463.766 bits (1192), Expect = 5.301e-156
Identity = 285/578 (49.31%), Postives = 379/578 (65.57%), Query Frame = 1
Query:   88 LNGEEPISVCAREFPFRLSDSKCANFNAICVKKDDAQCNLLQDACKQCPPSKITVIILQEILRIVKYRLXXXXXXXXXXXXXXXXXXMLENRFKLISKCCFSVIKKKKIDYYQLLRSRKRITAVSNFTKDSGVNLKFLVPLK-KSIELHVYGNENNVSVKKRICKKWPEARAGSYKMMKFICNGVELDDNQYLMSCITSYKDEITCQLDYSLDIRNILVLRVNGIKRHTELVQIDKDKKISDLNKILCKLLDQSDLVTFVKKPVKAANYSDLNNEEQTLENAGVKDNDRIAAITKISVKTKFSSILEDDEASFEINLLNIEKASTIYSLVKNKFKSSDFVLMMNNQHLKSDKFMFQYHIVDVGEINYCRFYSLSALTEDEKPLKEK-IKRKLSKENASLYKAIDNFSKQESALLKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIIT 1815
            L  +EPISVC++  P+ L DSKCANF  IC K+DD +C+ LQ +CKQCPPSKITV          KY+L+N +I I TFN+V+ +LL++ENRFKLI          KK + YQ++ SRKR    SNF  D G  LKF +P + K IELHVYGN+N V++KK ICKKWP+A++ SYK+MK I  G  LDDNQ ++S I S++ EI CQ+DYS++  +ILVLRV GI+R TELVQI+K K ISDL +ILCKL +   +  FV KP K   YS L + + T E A + D  RI  + +  V+ KF SIL +DE  F I     E  S I++ +K KFKS +FVLMMNN  +KSD+F+FQY+I +  +  YCRFY            K   IK++ SK    L KA DN + +E A+++YKLSDWK+F  +  LI EL +L     +ERFV+I  +YK    + VSMELM MS+K      + + +  S + ++KWS+QILEGL  LHD GI YD LTMS+I+LD+K DIKL++I+I       K ++ N ++ APE+ K + WNIK+DVWSFGV+L EIIT
Sbjct:    5 LEFKEPISVCSQNRPYTLFDSKCANFFDICTKQDDYECDQLQASCKQCPPSKITV----------KYQLMNIMIQILTFNIVIFVLLIIENRFKLI----------KKFNTYQIIHSRKREIEFSNFIGDFGTKLKFRLPTENKVIELHVYGNDNVVNIKKHICKKWPKAQSDSYKIMKLIYKGKCLDDNQNILSFIGSHRGEILCQMDYSVNANDILVLRVAGIRRDTELVQINKGKNISDLKQILCKLFNCKGISMFV-KPSKDEKYSPLKDLDMTFEAAKLCDKVRIVVVKEKPVRIKFQSIL-NDEDPFVIEQSRTESVSAIFARLKQKFKSENFVLMMNNCIMKSDRFLFQYNIDEETQTTYCRFYEREERKRGFHSFKSLFIKQEFSK----LGKATDNITNREVAVMEYKLSDWKAFMNSSGLINELRKLDAANGNERFVQIIAIYKGLESVTVSMELMSMSVKERFATIDGKVKKASNEQVIKWSRQILEGLVCLHDNGIAYDELTMSNILLDNKDDIKLATINIDTAIHGLKFDDNNGMHLAPEIRKGKLWNIKADVWSFGVILLEIIT 556          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000003878.1 (SMESG000003878.1)

HSP 1 Score: 414.461 bits (1064), Expect = 1.657e-136
Identity = 250/531 (47.08%), Postives = 342/531 (64.41%), Query Frame = 1
Query:  406 KKIDYYQLLRSRKRITAVSNFTKDSGVNLKFLVPLK-KSIELHVYGNENNVSVKKRICKKWPEARAGSYKMMKFICNGVELDDNQYLMSCITSYKDEITCQLDYSLDIRNILVLRVNGIKRHTELVQIDKDKKISDLNKILCKLLDQSDLVTFVKKPVKAANYSDLNNEEQTLENAGVKDNDRIAAITKISVKTKFSSILEDDEASFEINLLNIEKASTIYSLVKNKFKSSDFVLMMNNQHLKSDKFMFQYHIVDVGEINYCRFYSLSALTEDEKPLKEK-IKRKLSKENASLYKAIDNFSKQESALLKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHXXXXXXXXXXXXXXXXGKLFTDHKSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPT---ANNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKL 1983
            +K + YQ++ SRKR    SNF  D G  LKF +P + K IELHVYGN+N V++KK ICKKWP+A++ SYK+MK I  G  LDDNQ ++S I S++ EI CQ+DYS++  +ILVLRV GI+R TELVQI+K K ISDL +ILCKL +   +  FV KP K   YS L + + T E A + D  RI  + +  V+ KF SIL +DE  F I     E  S I++ +K KFKS +FVLMMNN  +KSD+F+FQY+I +  +  YCRFY            K   IK++ SK    L KA DN + +E A+++YKLSDWK+F  +  LI EL +L     +ERFV+I  +YK    + VSMELM MS+K      + + +  S + ++KWS+QILEGL  LHD GI YD LTMS+I+LD+K DIKL++I+I       K ++ N ++ APE+ K + WNIK+DVWSFGV+L EIITGK F+      A ND+N  + +I   + +FP    + F+ +I  CL+++P  RISV +L
Sbjct:   53 EKFNTYQIIHSRKREIEFSNFIGDFGTKLKFRLPTENKVIELHVYGNDNVVNIKKHICKKWPKAQSDSYKIMKLIYKGKCLDDNQNILSFIGSHRGEILCQMDYSVNANDILVLRVAGIRRDTELVQINKGKNISDLKQILCKLFNCKGISMFV-KPSKDEKYSPLKDLDMTFEAAKLCDKVRIVVVKEKPVRIKFQSIL-NDEDPFVIEQSRTESVSAIFARLKQKFKSENFVLMMNNCIMKSDRFLFQYNIDEETQTTYCRFYEREERKRGFHSFKSLFIKQEFSK----LGKATDNITNREVAVMEYKLSDWKAFMNSSGLINELRKLDAANGNERFVQIIAIYKGLESVTVSMELMSMSVKERFATIDGKVKKASNEQVIKWSRQILEGLVCLHDNGIAYDELTMSNILLDNKDDIKLATINIDTAIHGLKFDDNNGMHLAPEIRKGKLWNIKADVWSFGVILLEIITGKCFNFSAKKEALNDSN--FFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHEL 575          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NEK41.703e-927.37NIMA related kinase 4 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK42.071e-927.37NIMA related kinase 4 [Source:HGNC Symbol;Acc:HGNC... [more]
MAP3K125.445e-925.00mitogen-activated protein kinase kinase kinase 12 ... [more]
MAP3K133.773e-825.73mitogen-activated protein kinase kinase kinase 13 ... [more]
LYN3.953e-825.29LYN proto-oncogene, Src family tyrosine kinase [So... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkc-21.007e-828.49Protein kinase C-like 2 [Source:UniProtKB/Swiss-P... [more]
pkc-21.036e-828.65Protein kinase C-like 2 [Source:UniProtKB/Swiss-P... [more]
pkc-21.152e-828.49Protein kinase C-like 2 [Source:UniProtKB/Swiss-P... [more]
pkc-21.454e-828.49Protein kinase C-like 2 [Source:UniProtKB/Swiss-P... [more]
src-21.493e-823.25Tyrosine protein-kinase src-2 [Source:UniProtKB/S... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnd3.241e-926.64gene:FBgn0036896 transcript:FBtr0302513[more]
wnd3.719e-926.64gene:FBgn0036896 transcript:FBtr0074964[more]
wnd3.719e-926.64gene:FBgn0036896 transcript:FBtr0074963[more]
wnd3.719e-926.64gene:FBgn0036896 transcript:FBtr0074965[more]
Egfr4.943e-926.00gene:FBgn0003731 transcript:FBtr0071654[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SRMS1.237e-927.74zgc:194282 [Source:ZFIN;Acc:ZDB-GENE-081022-95][more]
lyn2.454e-922.77LYN proto-oncogene, Src family tyrosine kinase [So... [more]
lck7.822e-922.61LCK proto-oncogene, Src family tyrosine kinase [So... [more]
lck7.822e-922.61LCK proto-oncogene, Src family tyrosine kinase [So... [more]
lck7.822e-922.61LCK proto-oncogene, Src family tyrosine kinase [So... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdcd2l1.357e-925.77programmed cell death 2-like [Source:Xenbase;Acc:X... [more]
pdcd2l2.039e-926.14programmed cell death 2-like [Source:Xenbase;Acc:X... [more]
pdcd2l2.185e-926.14programmed cell death 2-like [Source:Xenbase;Acc:X... [more]
pdcd2l2.218e-926.04programmed cell death 2-like [Source:Xenbase;Acc:X... [more]
pdcd2l2.401e-926.14programmed cell death 2-like [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nek41.442e-1026.84NIMA (never in mitosis gene a)-related expressed k... [more]
Nek42.221e-926.84NIMA (never in mitosis gene a)-related expressed k... [more]
Nek42.649e-926.84NIMA (never in mitosis gene a)-related expressed k... [more]
Map3k193.466e-922.61mitogen-activated protein kinase kinase kinase 19 ... [more]
Nek44.010e-926.84NIMA (never in mitosis gene a)-related expressed k... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P42686|SRK1_SPOLA1.484e-1026.29Tyrosine-protein kinase isoform SRK1 OS=Spongilla ... [more]
sp|Q2QAV0|TIO_ARATH2.171e-924.49Serine/threonine-protein kinase TIO OS=Arabidopsis... [more]
sp|P51957|NEK4_HUMAN9.944e-927.37Serine/threonine-protein kinase Nek4 OS=Homo sapie... [more]
sp|Q0CL79|SEPH_ASPTN1.836e-825.81Cytokinesis protein sepH OS=Aspergillus terreus (s... [more]
sp|Q9Z1J2|NEK4_MOUSE2.903e-826.84Serine/threonine-protein kinase Nek4 OS=Mus muscul... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1Q3G1P11.330e-1032.54Putative mitogen-activated protein kinase kinase k... [more]
A0A067RRE91.362e-1025.00Protein kinase domain-containing protein (Fragment... [more]
A0A1Q3G1Y91.398e-1032.54Putative mitogen-activated protein kinase kinase k... [more]
V4B9W75.238e-1028.51Protein kinase domain-containing protein (Fragment... [more]
A0A182IUM88.958e-1031.25Protein kinase domain-containing protein OS=Anophe... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1942821.429e-1122.56tyrosine-protein kinase Srms [Source:NCBI gene;Acc... [more]
lyn1.396e-923.14tyrosine-protein kinase Lyn-like [Source:NCBI gene... [more]
TSSK61.531e-930.00testis-specific serine/threonine-protein kinase 6-... [more]
stk17al1.738e-924.90serine/threonine-protein kinase 17A-like [Source:N... [more]
STK44.555e-926.03serine/threonine kinase 4 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKCD9.567e-1030.56protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
ENSPMAT00000008193.11.037e-928.40pep scaffold:Pmarinus_7.0:GL476850:102262:127365:-... [more]
ENSPMAT00000006670.11.119e-925.00pep scaffold:Pmarinus_7.0:GL482639:18:11990:1 gene... [more]
hck1.637e-922.87HCK proto-oncogene, Src family tyrosine kinase [So... [more]
ENSPMAT00000002088.12.416e-926.45pep scaffold:Pmarinus_7.0:GL478600:446:35095:-1 ge... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
STE72.540e-927.95Signal transducing MAP kinase kinase; involved in ... [more]
PHO854.384e-928.05Cyclin-dependent kinase; has ten cyclin partners; ... [more]
FRK13.259e-823.17Protein kinase of unknown cellular role; green flu... [more]
MKK21.308e-725.11MAPKK involved in the protein kinase C signaling p... [more]
MKK11.405e-726.85MAPKK involved in the protein kinase C signaling p... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO491385.901e-1130.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375751.849e-1028.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321372.828e-924.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346461.053e-822.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498224.279e-829.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000038909.16.155e-1125.00tyrosine-protein kinase SRK3 [Source:NCBI gene;Acc... [more]
nek48.035e-928.93NIMA related kinase 4 [Source:NCBI gene;Acc:101169... [more]
nek61.228e-821.43NIMA related kinase 6 [Source:NCBI gene;Acc:101173... [more]
lyn1.290e-822.77tyrosine-protein kinase Lyn [Source:NCBI gene;Acc:... [more]
map3k121.518e-828.44mitogen-activated protein kinase kinase kinase 12 ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003859.10.000e+0100.00SMESG000003859.1[more]
SMESG000003862.10.000e+055.40SMESG000003862.1[more]
SMESG000003878.14.379e-16547.88SMESG000003878.1[more]
SMESG000003878.15.301e-15649.31SMESG000003878.1[more]
SMESG000003878.11.657e-13647.08SMESG000003878.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001853 ID=SMED30001853|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2143bp
CTTACTGATTTACTGATTTACCATTCAGATTAAGATTTAGACATGATTTT
ATTTGTATTCGTTATCTATTTATGCATATTGTCAACCTTGAATGGTGAGG
AACCGATATCAGTTTGTGCGAGAGAATTTCCATTCAGATTATCCGATAGT
AAATGTGCAAATTTTAATGCAATTTGTGTGAAAAAAGATGATGCTCAGTG
CAACTTATTACAGGATGCTTGCAAACAATGCCCTCCAAGTAAAATTACAG
TAATAATTCTACAGGAAATATTGAGAATAGTAAAATATCGTTTGGTTAAT
TTTTTGATCGTAATCTTTACTTTTAATGTTGTTGTTGTCATTCTGCTTAT
GCTGGAGAATCGGTTCAAGCTTATCTCAAAATGTTGTTTTTCAGTGATCA
AAAAAAAGAAAATTGATTATTACCAACTGTTACGTAGCAGGAAAAGAATA
ACGGCAGTGTCGAATTTCACTAAAGATTCAGGGGTAAATCTTAAATTTTT
GGTGCCCTTAAAAAAATCAATAGAACTGCATGTTTATGGCAACGAAAATA
ACGTCAGTGTCAAAAAAAGGATTTGCAAGAAATGGCCAGAAGCGCGAGCT
GGTTCATACAAAATGATGAAATTTATATGTAATGGGGTGGAGCTTGATGA
CAATCAGTATCTTATGTCATGCATTACGTCATACAAAGATGAAATAACGT
GCCAGTTGGATTATTCTCTAGATATCAGAAATATTCTCGTACTTCGAGTG
AATGGTATCAAACGGCACACGGAACTCGTTCAAATTGATAAGGATAAAAA
GATTTCTGATCTGAATAAGATCTTATGCAAATTACTCGATCAATCGGATC
TTGTCACATTTGTGAAAAAACCTGTCAAGGCAGCTAATTATTCAGATTTA
AATAATGAAGAGCAGACCCTGGAGAATGCTGGCGTCAAAGACAATGACCG
CATTGCGGCTATCACAAAGATATCTGTAAAGACTAAATTCTCATCAATAC
TTGAAGATGATGAAGCTTCGTTTGAGATAAACTTATTGAATATTGAAAAG
GCTTCAACTATTTACAGTTTGGTCAAAAATAAGTTTAAATCTTCCGATTT
TGTTTTAATGATGAATAATCAACATTTGAAATCAGACAAATTTATGTTTC
AATATCATATTGTTGACGTAGGAGAAATTAATTATTGCAGATTTTATAGT
CTCAGTGCTCTGACAGAGGATGAAAAACCTTTAAAGGAAAAAATAAAAAG
AAAATTAAGTAAAGAAAATGCTTCGCTGTATAAAGCGATAGACAATTTCT
CCAAACAAGAGAGTGCTTTGCTGAAATATAAATTATCAGATTGGAAATCC
TTTAAAGAGAACCCGAATTTGATTAAGGAGCTCAGCAGATTGAAAATAGT
AAAATCTCATGAGAGATTTGTGGAAATATTTGGTCTATATAAAAGTGCGA
GTGAAATCGGCGTGTCAATGGAATTGATGGTTATGTCAATGAAAAATATT
TTAGATATCCCCGAAAATAGAAAAGAACTGGTAAGTTTTAAAAATATTGT
AAAATGGTCACAGCAGATTCTCGAGGGGCTCGCTTTTCTCCATGATCAAG
GCATTATATATGATAACCTCACAATGTCGCATATTATCCTAGATAGCAAA
TCGGACATCAAGCTATCCAGCATTAGTATTGGCAAGTTATTTACAGATCA
CAAAAGCAATGAGAAAAATGCAGTATACCGAGCCCCTGAACTATTGAAAA
ATGAACCGTGGAACATAAAATCTGACGTGTGGTCGTTTGGAGTCGTTCTG
TTTGAAATTATTACAGGTAAAGATTTTCATTTGCCGACAGCAAATAATGA
TAACAATCCCGATTGGATAGAAATATCCGGCAATGAAAGCATGTTTCCTG
AGGGGAAATATAAATGGTTCGAGGATATTATTAAGAATTGCTTAATAAAA
AATCCCATAAACAGAATATCTGTGAAGAAATTGCAAAATCTAATAAATTA
AAAATATTTCAATTAATATTTTAAGTTTATAATGTTTAAACTTTCATTTT
ATTCATGATTTTCATTTATTAGTTCCTATAACATTGGTTGAGATTCTTTC
TTTACGTCGCTTAATGTAATTGTTAATATAATTTTGTCTGGTC
back to top

protein sequence of SMED30001853-orf-1

>SMED30001853-orf-1 ID=SMED30001853-orf-1|Name=SMED30001853-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=653bp
MILFVFVIYLCILSTLNGEEPISVCAREFPFRLSDSKCANFNAICVKKDD
AQCNLLQDACKQCPPSKITVIILQEILRIVKYRLVNFLIVIFTFNVVVVI
LLMLENRFKLISKCCFSVIKKKKIDYYQLLRSRKRITAVSNFTKDSGVNL
KFLVPLKKSIELHVYGNENNVSVKKRICKKWPEARAGSYKMMKFICNGVE
LDDNQYLMSCITSYKDEITCQLDYSLDIRNILVLRVNGIKRHTELVQIDK
DKKISDLNKILCKLLDQSDLVTFVKKPVKAANYSDLNNEEQTLENAGVKD
NDRIAAITKISVKTKFSSILEDDEASFEINLLNIEKASTIYSLVKNKFKS
SDFVLMMNNQHLKSDKFMFQYHIVDVGEINYCRFYSLSALTEDEKPLKEK
IKRKLSKENASLYKAIDNFSKQESALLKYKLSDWKSFKENPNLIKELSRL
KIVKSHERFVEIFGLYKSASEIGVSMELMVMSMKNILDIPENRKELVSFK
NIVKWSQQILEGLAFLHDQGIIYDNLTMSHIILDSKSDIKLSSISIGKLF
TDHKSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTA
NNDNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKLQNL
IN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004713protein tyrosine kinase activity
GO:0004715non-membrane spanning protein tyrosine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 386..650
e-value: 5.5E-35
score: 122.7
NoneNo IPR availablePANTHERPTHR44305FAMILY NOT NAMEDcoord: 423..648
NoneNo IPR availablePANTHERPTHR44305:SF12TYROSINE-PROTEIN KINASE C03B1.5-RELATEDcoord: 423..648
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.876
NoneNo IPR availableTMHMMTMhelixcoord: 82..104
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 410..648
e-value: 1.4E-28
score: 100.0
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 398..652
score: 25.149
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 411..649