CD109 antigen

Overview
NameCD109 antigen
Smed IDSMED30001852
Length (bp)5304
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CD109 antigen (SMED30001852) t-SNE clustered cells

Violin plots show distribution of expression levels for CD109 antigen (SMED30001852) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CD109 antigen (SMED30001852) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CD109 antigen (SMED30001852) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001852

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30001852SMESG000053594.1 SMESG000047986.1 Contig3726GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001852SMESG000016163.1 Contig3726GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30001852SMESG000016163.1 dd_Smed_v4_3070_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30001852SMESG000016163.1 dd_Smed_v4_3070_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001852SMESG000016163.1 dd_Smed_v4_3070_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001852SMESG000016163.1 dd_Smed_v4_3070_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001852SMESG000016163.1 dd_Smed_v4_3070_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30001852SMESG000016163.1 dd_Smed_v4_3070_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CD109 antigen vs. Ensembl Human
Match: CD109 (CD109 molecule [Source:HGNC Symbol;Acc:HGNC:21685])

HSP 1 Score: 272.322 bits (695), Expect = 3.131e-73
Identity = 368/1601 (22.99%), Postives = 661/1601 (41.29%), Query Frame = 2
Query:  203 LPPMPSYIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRN---------DFEYIHETTTFKTEGTQIMRLEIPTRVAPPDD--YYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSLINQ--GSLAFKD------VWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVIRLSFVPTQSLTCP---TYRLRAEYLEDGNRL----------ISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTNKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEIN-GYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQNFQQPIEQDWLYNLEYIIRTYLPSPSFGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTS---KAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEIIQRATAFIDRHLINSI-DLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYN-RSIYQTVELYSNHIC-NVFGSYQCPYSPYFNVASSTVEINFLFVFAII 4888
            + P P +++ AP  IRPG      V +++     +T++  + +          + E + E  +FKT       L +P+      D  Y L V G   D   I+FSN TRL F  K  SVFIQ  K +Y   Q V+FR++ L+ +  P + T   I   +P   ++++W++  + +G I +  F L+     G+W+I+V++      +SF V EY LP+F+V +  P+  S     + G I A  T G  V+G+ ++T         +       +IN       G A+F F  +E++++++   G   + D      V +  TV +S T + R      F    D  ++F        KP++ FTA + V + DG +      RN NV         T+ +S     +SG  ++  V   + T P   T+++    LED + L           S +   LFK  S S  Y+Q+    E  +V       +  +    ++   VV+ G +V V     QNS     FS++      P A V+ YY++ DGE++SD L     +   N + +  ++ K    + V +     +P S + +  +   +    A N +   N++ E++              LYN  Y +  ++       ++       GL + +DAN T     +  +   D ++               AER    N+  + VD     + +   +P  +          +H+ +  W+W    +       F V +P   TSWV   + I  + G  +   P      + F++ + +P     GE+  + IT+FNY    TE  + +++SD++ ++  +          E  +     TL+ + + +   + FPI     G       I++ A +   S+   + I +   G+   Y  + L+DLT    ++ L   +F        + P       V  S+  +++ +GD++GP+ +     +      RM +G  E     F  NIY+L Y+ + +  + N+    L++  +  Q  L Y     G FS F       +T  +AF L   L     + D YI I +N++     ++   Q   G F   ++P  ++ S+    N S             + +TA ++ S+   +   PN + +Q +  F++      I D ++  + TYALS  G    S K    +  +   A  +G  +++  S+ K   +               W    L     A A+L    Q    E  P     + +L++ RN + GF ST D++VAL+    F+A   N E   +QV +T  S  +      +     T  N++              A G G  + QL+V   V++ V+              + FD++   K +  + + + +++C S   F+ P     +GM + +V L +G++  ++ +           ++   +  GK++ YL  + +TQ CV   A R F V+N ++D   S  +YYEP R   RS    V+L S  +C +V G   C      +   S+V   F+F F ++
Sbjct:   22 VAPGPRFLVTAPGIIRPGGNVTIGVELLEHCPSQVTVKAELLKTASNLTVSVLEAEGVFEKGSFKT-------LTLPSLPLNSADEIYELRVTGRTQDE--ILFSNSTRLSFETKRISVFIQTDKALYKPKQEVKFRIVTLFSDFKP-YKTSLNILIKDPKSNLIQQWLSQQSDLGVISKT-FQLSSHPILGDWSIQVQVNDQTYYQSFQVSEYVLPKFEVTLQTPLYCSMNSKHLNGTITAKYTYGKPVKGDVTLTFLPLSFWGKKKNITKTFKIN-------GSANFSFNDEEMKNVMDSSNGLSEYLDLSSPGPVEILTTVTESVTGISRNVSTNVFFKQHDYIIEFF-DYTTVLKPSLNFTATVKVTRADGNQLTLEERRN-NVVITVTQRNYTEYWSG---SNSGNQKMEAVQKINYTVPQSGTFKIEFPILEDSSELQLKAYFLGSKSSMAVHSLFK--SPSKTYIQLKTRDENIKVGSPFELVVSGNKRLKELSYMVVSRGQLVAVGK---QNST---MFSLTPENSWTPKACVIVYYIEDDGEIISDVLKIPVQLVFKNKIKLYWSKVKAEPSEKVSLRISVTQPDSIVGIVAVDKSVNLMNASNDITMENVVHELE--------------LYNTGYYLGMFM-------NSFAVFQECGLWVLTDANLTK----DYIDGVYDNAE--------------YAERFMEENEG-HIVD---IHDFSLGSSPHVR----------KHFPE-TWIWLDTNMGYRIYQEFEVTVPDSITSWVATGFVISEDLGLGLTTTPVELQAFQPFFIFLNLPYSVIRGEEFALEITIFNYLKDATEVKVIIEKSDKFDILMTSN---------EINATGHQQTLL-VPSEDGATVLFPIRPTHLG----EIPITVTALSPTASDAVTQMILVKAEGIEKSYSQSILLDLTDNRLQSTLKTLSFS-------FPPNT-----VTGSERVQITAIGDVLGPSINGLASLI------RMPYGCGEQNMINFAPNIYILDYLTKKKQLTDNLKEKALSFMRQGYQRELLY-QREDGSFSAFGNYDPSGSTWLSAFVLRCFL-----EADPYIDIDQNVLHRTYTWLKGHQKSNGEF---WDPGRVIHSELQGGNKSP------------VTLTAYIVTSLLGYRKYQPNID-VQESIHFLESEFSRGISDNYTLALITYALSSVG----SPKAKEALNMLTWRAEQEGGMQFWVSSESKLSDS---------------WQPRSLDIEVAAYALLSHFLQFQTSEGIP----IMRWLSRQRNSLGGFASTQDTTVALKALSEFAAL-MNTERTNIQVTVTGPSSPS-----PLAVVQPTAVNIS--------------ANGFGFAICQLNV---VYN-VKASGSSRRRRSIQNQEAFDLDVAVKENKDDLNHVDLNVCTS---FSGP---GRSGMALMEVNLLSGFMVPSEAISL------SETVKKVEYDHGKLNLYLDSVNETQFCVNIPAVRNFKVSN-TQDASVSIVDYYEPRRQAVRSYNSEVKLSSCDLCSDVQGCRPCEDGASGSHHHSSV--IFIFCFKLL 1421          
BLAST of CD109 antigen vs. Ensembl Human
Match: CD109 (CD109 molecule [Source:HGNC Symbol;Acc:HGNC:21685])

HSP 1 Score: 272.322 bits (695), Expect = 3.824e-73
Identity = 370/1604 (23.07%), Postives = 664/1604 (41.40%), Query Frame = 2
Query:  203 LPPMPSYIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRN---------DFEYIHETTTFKTEGTQIMRLEIPTRVAPPDD--YYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSLINQ--GSLAFKD------VWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVIRLSFVPTQSLTCP---TYRLRAEYLEDGNRL----------ISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTNKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEIN-GYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQNFQQPIEQDWLYNLEYIIRTYLPSPSFGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTS---KAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEIIQRATAFIDRHLINSI-DLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLV---AQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYN-RSIYQTVELYSNHIC-NVFGSYQCPYSPYFNVASSTVEINFLFVFAII 4888
            + P P +++ AP  IRPG      V +++     +T++  + +          + E + E  +FKT       L +P+      D  Y L V G   D   I+FSN TRL F  K  SVFIQ  K +Y   Q V+FR++ L+ +  P + T   I   +P   ++++W++  + +G I +  F L+     G+W+I+V++      +SF V EY LP+F+V +  P+  S     + G I A  T G  V+G+ ++T         +       +IN       G A+F F  +E++++++   G   + D      V +  TV +S T + R      F    D  ++F        KP++ FTA + V + DG +      RN NV         T+ +S     +SG  ++  V   + T P   T+++    LED + L           S +   LFK  S S  Y+Q+    E  +V       +  +    ++   VV+ G +V V     QNS     FS++      P A V+ YY++ DGE++SD L     +   N + +  ++ K    + V +     +P S + +  +   +    A N +   N++ E++              LYN  Y +  ++       ++       GL + +DAN T     +  +   D ++               AER    N+  + VD     + +   +P  +          +H+ +  W+W    +       F V +P   TSWV   + I  + G  +   P      + F++ + +P     GE+  + IT+FNY    TE  + +++SD++ ++  +          E  +     TL+ + + +   + FPI     G       I++ A +   S+   + I +   G+   Y  + L+DLT    ++ L   +F        + P       V  S+  +++ +GD++GP+ +     +      RM +G  E     F  NIY+L Y+ + +  + N+    L++  +  Q  L Y     G FS F       +T  +AF L   L     + D YI I +N++     ++   Q   G F   ++P  ++ S+    N S             + +TA ++ S+   +   PN + +Q +  F++      I D ++  + TYALS  G    S K    +  +   A  +G  +++  S+ K   +               W    L     A A+L    Q    E  P     + +L++ RN + GF ST D++VAL+    F+A   N E   +QV +T  S  +      ++F   T   L     +    +   V   A G G  + QL+V   V++ V+              + FD++   K +  + + + +++C S   F+ P     +GM + +V L +G++  ++ +           ++   +  GK++ YL  + +TQ CV   A R F V+N ++D   S  +YYEP R   RS    V+L S  +C +V G   C      +   S+V   F+F F ++
Sbjct:   22 VAPGPRFLVTAPGIIRPGGNVTIGVELLEHCPSQVTVKAELLKTASNLTVSVLEAEGVFEKGSFKT-------LTLPSLPLNSADEIYELRVTGRTQDE--ILFSNSTRLSFETKRISVFIQTDKALYKPKQEVKFRIVTLFSDFKP-YKTSLNILIKDPKSNLIQQWLSQQSDLGVISKT-FQLSSHPILGDWSIQVQVNDQTYYQSFQVSEYVLPKFEVTLQTPLYCSMNSKHLNGTITAKYTYGKPVKGDVTLTFLPLSFWGKKKNITKTFKIN-------GSANFSFNDEEMKNVMDSSNGLSEYLDLSSPGPVEILTTVTESVTGISRNVSTNVFFKQHDYIIEFF-DYTTVLKPSLNFTATVKVTRADGNQLTLEERRN-NVVITVTQRNYTEYWSG---SNSGNQKMEAVQKINYTVPQSGTFKIEFPILEDSSELQLKAYFLGSKSSMAVHSLFK--SPSKTYIQLKTRDENIKVGSPFELVVSGNKRLKELSYMVVSRGQLVAVGK---QNST---MFSLTPENSWTPKACVIVYYIEDDGEIISDVLKIPVQLVFKNKIKLYWSKVKAEPSEKVSLRISVTQPDSIVGIVAVDKSVNLMNASNDITMENVVHELE--------------LYNTGYYLGMFM-------NSFAVFQECGLWVLTDANLTK----DYIDGVYDNAE--------------YAERFMEENEG-HIVD---IHDFSLGSSPHVR----------KHFPE-TWIWLDTNMGYRIYQEFEVTVPDSITSWVATGFVISEDLGLGLTTTPVELQAFQPFFIFLNLPYSVIRGEEFALEITIFNYLKDATEVKVIIEKSDKFDILMTSN---------EINATGHQQTLL-VPSEDGATVLFPIRPTHLG----EIPITVTALSPTASDAVTQMILVKAEGIEKSYSQSILLDLTDNRLQSTLKTLSFS-------FPPNT-----VTGSERVQITAIGDVLGPSINGLASLI------RMPYGCGEQNMINFAPNIYILDYLTKKKQLTDNLKEKALSFMRQGYQRELLY-QREDGSFSAFGNYDPSGSTWLSAFVLRCFL-----EADPYIDIDQNVLHRTYTWLKGHQKSNGEF---WDPGRVIHSELQGGNKSP------------VTLTAYIVTSLLGYRKYQPNID-VQESIHFLESEFSRGISDNYTLALITYALSSVG----SPKAKEALNMLTWRAEQEGGMQFWVSSESKLSDS---------------WQPRSLDIEVAAYALLSHFLQFQTSEGIP----IMRWLSRQRNSLGGFASTQDTTVALKALSEFAAL-MNTERTNIQVTVTGPSSPS-----PVKFLIDTHNRLLLQTAELAVVQPTAVNISANGFGFAICQLNV---VYN-VKASGSSRRRRSIQNQEAFDLDVAVKENKDDLNHVDLNVCTS---FSGP---GRSGMALMEVNLLSGFMVPSEAISL------SETVKKVEYDHGKLNLYLDSVNETQFCVNIPAVRNFKVSN-TQDASVSIVDYYEPRRQAVRSYNSEVKLSSCDLCSDVQGCRPCEDGASGSHHHSSV--IFIFCFKLL 1438          
BLAST of CD109 antigen vs. Ensembl Human
Match: CD109 (CD109 molecule [Source:HGNC Symbol;Acc:HGNC:21685])

HSP 1 Score: 216.468 bits (550), Expect = 6.251e-56
Identity = 322/1446 (22.27%), Postives = 586/1446 (40.53%), Query Frame = 2
Query:  644 NPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSLINQ--GSLAFKD------VWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVIRLSFVPTQSLTCP---TYRLRAEYLEDGNRL----------ISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTNKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEIN-GYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQNFQQPIEQDWLYNLEYIIRTYLPSPSFGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTS---KAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEIIQRATAFIDRHLINSI-DLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLV---AQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYN-RSIYQTVELYSNHIC-NVFGSYQCPYSPYFNVASSTVEINFLFVFAII 4888
            +P   ++++W++  + +G I +  F L+     G+W+I+V++      +SF V EY LP+F+V +  P+  S     + G I A  T G  V+G+ ++T         +       +IN       G A+F F  +E++++++   G   + D      V +  TV +S T + R      F    D  ++F        KP++ FTA + V + DG +      RN NV         T+ +S     +SG  ++  V   + T P   T+++    LED + L           S +   LFK  S S  Y+Q+    E  +V       +  +    ++   VV+ G +V V     QNS     FS++      P A V+ YY++ DGE++SD L     +   N + +  ++ K    + V +     +P S + +  +   +    A N +   N++ E++              LYN  Y +  ++       ++       GL + +DAN T         + +D               Y  AE             E    E   +        L +   + +H+ +  W+W    +       F V +P   TSWV   + I  + G  +   P      + F++ + +P     GE+  + IT+FNY    TE  + +++SD++ ++  +          E  +     TL+ + + +   + FPI     G       I++ A +   S+   + I +   G+   Y  + L+DLT    ++ L   +F        + P       V  S+  +++ +GD++GP+ +     +      RM +G  E     F  NIY+L Y+ + +  + N+    L++  +  Q  L Y     G FS F       +T  +AF L   L     + D YI I +N++     ++   Q   G F   ++P  ++ S+    N S             + +TA ++ S+   +   PN + +Q +  F++      I D ++  + TYALS  G    S K    +  +   A  +G  +++  S+ K   +               W    L     A A+L    Q    E  P     + +L++ RN + GF ST D++VAL+    F+A   N E   +QV +T  S  +      ++F   T   L     +    +   V   A G G  + QL+V   V++ V+              + FD++   K +  + + + +++C S   F+ P     +GM + +V L +G++  ++ +           ++   +  GK++ YL  + +TQ CV   A R F V+N ++D   S  +YYEP R   RS    V+L S  +C +V G   C      +   S+V   F+F F ++
Sbjct:   93 DPKSNLIQQWLSQQSDLGVISKT-FQLSSHPILGDWSIQVQVNDQTYYQSFQVSEYVLPKFEVTLQTPLYCSMNSKHLNGTITAKYTYGKPVKGDVTLTFLPLSFWGKKKNITKTFKIN-------GSANFSFNDEEMKNVMDSSNGLSEYLDLSSPGPVEILTTVTESVTGISRNVSTNVFFKQHDYIIEFFD-YTTVLKPSLNFTATVKVTRADGNQLTLEERRN-NVVITVTQRNYTEYWSG---SNSGNQKMEAVQKINYTVPQSGTFKIEFPILEDSSELQLKAYFLGSKSSMAVHSLFK--SPSKTYIQLKTRDENIKVGSPFELVVSGNKRLKELSYMVVSRGQLVAVGK---QNST---MFSLTPENSWTPKACVIVYYIEDDGEIISDVLKIPVQLVFKNKIKLYWSKVKAEPSEKVSLRISVTQPDSIVGIVAVDKSVNLMNASNDITMENVVHELE--------------LYNTGYYLGMFM-------NSFAVFQECGLWVLTDANLT--------KDYIDG-------------VYDNAEYA-----------ERFMEENEGHIVDIHDFSLGSSPHVRKHFPE-TWIWLDTNMGYRIYQEFEVTVPDSITSWVATGFVISEDLGLGLTTTPVELQAFQPFFIFLNLPYSVIRGEEFALEITIFNYLKDATEVKVIIEKSDKFDILMTSN---------EINATGHQQTLL-VPSEDGATVLFPIRPTHLG----EIPITVTALSPTASDAVTQMILVKAEGIEKSYSQSILLDLTDNRLQSTLKTLSFS-------FPPNT-----VTGSERVQITAIGDVLGPSINGLASLI------RMPYGCGEQNMINFAPNIYILDYLTKKKQLTDNLKEKALSFMRQGYQRELLY-QREDGSFSAFGNYDPSGSTWLSAFVLRCFL-----EADPYIDIDQNVLHRTYTWLKGHQKSNGEF---WDPGRVIHSELQGGNKSP------------VTLTAYIVTSLLGYRKYQPNID-VQESIHFLESEFSRGISDNYTLALITYALSSVG----SPKAKEALNMLTWRAEQEGGMQFWVSSESKLSDS---------------WQPRSLDIEVAAYALLSHFLQFQTSEGIP----IMRWLSRQRNSLGGFASTQDTTVALKALSEFAAL-MNTERTNIQVTVTGPSSPS-----PVKFLIDTHNRLLLQTAELAVVQPTAVNISANGFGFAICQLNV---VYN-VKASGSSRRRRSIQNQEAFDLDVAVKENKDDLNHVDLNVCTS---FSGP---GRSGMALMEVNLLSGFMVPSEAISL------SETVKKVEYDHGKLNLYLDSVNETQFCVNIPAVRNFKVSN-TQDASVSIVDYYEPRRQAVRSYNSEVKLSSCDLCSDVQGCRPCEDGASGSHHHSSV--IFIFCFKLL 1361          
BLAST of CD109 antigen vs. Ensembl Human
Match: A2ML1 (alpha-2-macroglobulin like 1 [Source:HGNC Symbol;Acc:HGNC:23336])

HSP 1 Score: 129.028 bits (323), Expect = 4.344e-29
Identity = 219/1045 (20.96%), Postives = 407/1045 (38.95%), Query Frame = 2
Query: 1682 TFSISISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIID-----------EMKTYEQ-------NFQQPIEQDWLYNLEYIIRTYLPSPSF--GADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAI-FSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVH-TLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTL-SATDAEAQRRIPITAMVILSISD--KKAVSPNAEIIQRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDG-LTTACTAMAMLL-FKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEP 4735
            + S++ +  +AP   +V Y +   G VV+D + F   +   N V++G +  + L    VE+     PGS  AL  +   +     D  L + ++             ++  Y+Q       +F QP+  D +       R+ +  PSF  G D  +     GL I S+A            + VD S   P YST        A    G           G PE   + TP    + +  D   R +    WLW  + I  +G+    V +P   T W   ++   + +GF +   P +  +  + F++ + +P     GE   +  T+FNY         ++ +S +Y++   A+   +     +    K+ H  +  +  G   F     +L+   +N+              S+   + + +   GV      ++L  L  K ++A  +  ++L           +  VPDS  A V+++GDI+G      LQ +D    ++M  G  E     F   IY+L+Y+ +    +  +    + +     Q  L Y  S +G +S F E     NT  TAF              ++I+I    IQ A  ++   Q+  G +                 N+   L +A        + +TA V  ++ +  K    P   ++ +    +     ++ +L++Q +  Y  S +G        + ++  +   A   G++ Y+S    KP  T  +NA          W     +    TA A+L    + ++ ++        + +LAK  N   GF+ST D+ VAL+    ++ T     +   ++ + + S  N++ T+ IQ  N  V    T+PN  V G + L A G G + +Q  +   +        P N  +  L  +     C    S ++   L + I  S++G     +R  + M + +V++ +G+  +    +  ++   QPL++   F    ++ YL +L +     TF   +   V N+ +      Y+YY P
Sbjct:  519 SLSLTFTSRLAPDPSLVIYAIFPSGGVVADKIQFSVEMCFDNQVSLGFSPSQQLPGAEVELQLQAAPGSLCALRAVDESVLLLRPDRELSNRSVYGMFPFWYGHYPYQVAEYDQCPVSGPWDFPQPL-IDPMPQGHSSQRSIIWRPSFSEGTDLFSFFRDVGLKILSNAK---------IKKPVDCSHRSPEYST--------AMGAGG-----------GHPEAFESSTP----LHQAEDSQVRQYFPETWLWDLFPIGNSGKEAVHVTVPDAITEWKAMSFCTSQSRGFGL--SPTVGLTAFKPFFVDLTLPYSVVRGESFRLTATIFNYLKDCIRVQTDLAKSHEYQLESWADSQTSSCLCAD--DAKTHHWNITAVKLGHINFTISTKILD---SNEPCGGQKGFVPQKGRSDTLIKPVLVKPEGVLVEKTHSSL--LCPKGKVASESVSLELP----------VDIVPDSTKAYVTVLGDIMGTA----LQNLDGL--VQMPSGCGEQNMVLFAPIIYVLQYLEKAGLLTEEIRSRAVGFLEIGYQKELMYKHS-NGSYSAFGERDGNGNTWLTAFVTKCF-----GQAQKFIFIDPKNIQDALKWMAGNQLPSGCY----------------ANVGNLLHTAMKGGVDDEVSLTAYVTAALLEMGKDVDDP---MVSQGLRCLKNSATSTTNLYTQALLAYIFSLAGEMDIR---NILLKQLDQQAIISGESIYWSQ---KP--TPSSNAS--------PWSEPAAVDVELTAYALLAQLTKPSLTQKEIAKATSIVAWLAKQHNAYGGFSSTQDTVVALQALAKYATTAY---MPSEEINLVVKSTENFQRTFNIQSVNRLVFQQDTLPN--VPGMYTLEASGQGCVYVQTVLRYNILP------PTNMKTFSLSVEIGKARCEQPTSPRS---LTLTIHTSYVG-----SRSSSNMAIVEVKMLSGFSPMEGTNQLLLQ---QPLVKKVEFGTDTLNIYLDELIKNTQTYTFTISQSVLVTNL-KPATIKVYDYYLP 1441          

HSP 2 Score: 70.0922 bits (170), Expect = 4.122e-11
Identity = 50/217 (23.04%), Postives = 101/217 (46.54%), Query Frame = 2
Query:  212 MPSYIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRND-FEYIHETTTFKTEGTQIMRLEIPTRVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLS 859
            +P+Y++  P R+    + +  + +    Y  +   ++++  D  + + E +  K      +   +P      ++     V  V +N  I F  + ++    +    F+Q  KP+Y  GQ V FR++ +  N +PV    + ++  +PN   + +W+       GI ++ F LA +   G +T+ V   + K+  +F V+EY LP+F V +  P +LS
Sbjct:   20 LPNYLVTLPARLNFPSVQKVCLDLSPG-YSDVKFTVTLETKDKTQKLLEYSGLKKRHLHCISFLVPPPAGGTEEVATIRVSGVGNN--ISFEEKKKVLIQRQGNGTFVQTDKPLYTPGQQVYFRIVTMDSNFVPVNDKYSMVELQDPNSNRIAQWLE-VVPEQGIVDLSFQLAPEAMLGTYTVAV--AEGKTFGTFSVEEYVLPKFKVEVVEPKELS 230          
BLAST of CD109 antigen vs. Ensembl Human
Match: A2ML1 (alpha-2-macroglobulin like 1 [Source:HGNC Symbol;Acc:HGNC:23336])

HSP 1 Score: 127.872 bits (320), Expect = 7.190e-29
Identity = 219/1045 (20.96%), Postives = 407/1045 (38.95%), Query Frame = 2
Query: 1682 TFSISISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIID-----------EMKTYEQ-------NFQQPIEQDWLYNLEYIIRTYLPSPSF--GADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAI-FSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVH-TLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTL-SATDAEAQRRIPITAMVILSISD--KKAVSPNAEIIQRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDG-LTTACTAMAMLL-FKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEP 4735
            + S++ +  +AP   +V Y +   G VV+D + F   +   N V++G +  + L    VE+     PGS  AL  +   +     D  L + ++             ++  Y+Q       +F QP+  D +       R+ +  PSF  G D  +     GL I S+A            + VD S   P YST        A    G           G PE   + TP    + +  D   R +    WLW  + I  +G+    V +P   T W   ++   + +GF +   P +  +  + F++ + +P     GE   +  T+FNY         ++ +S +Y++   A+   +     +    K+ H  +  +  G   F     +L+   +N+              S+   + + +   GV      ++L  L  K ++A  +  ++L           +  VPDS  A V+++GDI+G      LQ +D    ++M  G  E     F   IY+L+Y+ +    +  +    + +     Q  L Y  S +G +S F E     NT  TAF              ++I+I    IQ A  ++   Q+  G +                 N+   L +A        + +TA V  ++ +  K    P   ++ +    +     ++ +L++Q +  Y  S +G        + ++  +   A   G++ Y+S    KP  T  +NA          W     +    TA A+L    + ++ ++        + +LAK  N   GF+ST D+ VAL+    ++ T     +   ++ + + S  N++ T+ IQ  N  V    T+PN  V G + L A G G + +Q  +   +        P N  +  L  +     C    S ++   L + I  S++G     +R  + M + +V++ +G+  +    +  ++   QPL++   F    ++ YL +L +     TF   +   V N+ +      Y+YY P
Sbjct:   69 SLSLTFTSRLAPDPSLVIYAIFPSGGVVADKIQFSVEMCFDNQVSLGFSPSQQLPGAEVELQLQAAPGSLCALRAVDESVLLLRPDRELSNRSVYGMFPFWYGHYPYQVAEYDQCPVSGPWDFPQPL-IDPMPQGHSSQRSIIWRPSFSEGTDLFSFFRDVGLKILSNAK---------IKKPVDCSHRSPEYST--------AMGAGG-----------GHPEAFESSTP----LHQAEDSQVRQYFPETWLWDLFPIGNSGKEAVHVTVPDAITEWKAMSFCTSQSRGFGL--SPTVGLTAFKPFFVDLTLPYSVVRGESFRLTATIFNYLKDCIRVQTDLAKSHEYQLESWADSQTSSCLCAD--DAKTHHWNITAVKLGHINFTISTKILD---SNEPCGGQKGFVPQKGRSDTLIKPVLVKPEGVLVEKTHSSL--LCPKGKVASESVSLELP----------VDIVPDSTKAYVTVLGDIMGTA----LQNLDGL--VQMPSGCGEQNMVLFAPIIYVLQYLEKAGLLTEEIRSRAVGFLEIGYQKELMYKHS-NGSYSAFGERDGNGNTWLTAFVTKCF-----GQAQKFIFIDPKNIQDALKWMAGNQLPSGCY----------------ANVGNLLHTAMKGGVDDEVSLTAYVTAALLEMGKDVDDP---MVSQGLRCLKNSATSTTNLYTQALLAYIFSLAGEMDIR---NILLKQLDQQAIISGESIYWSQ---KP--TPSSNAS--------PWSEPAAVDVELTAYALLAQLTKPSLTQKEIAKATSIVAWLAKQHNAYGGFSSTQDTVVALQALAKYATTAY---MPSEEINLVVKSTENFQRTFNIQSVNRLVFQQDTLPN--VPGMYTLEASGQGCVYVQTVLRYNILP------PTNMKTFSLSVEIGKARCEQPTSPRS---LTLTIHTSYVG-----SRSSSNMAIVEVKMLSGFSPMEGTNQLLLQ---QPLVKKVEFGTDTLNIYLDELIKNTQTYTFTISQSVLVTNL-KPATIKVYDYYLP 991          
BLAST of CD109 antigen vs. Ensembl Celegans
Match: tep-1 (TEP (ThiolEster containing Protein) [Source:UniProtKB/TrEMBL;Acc:Q7JKM0])

HSP 1 Score: 131.339 bits (329), Expect = 3.378e-30
Identity = 161/686 (23.47%), Postives = 304/686 (44.31%), Query Frame = 2
Query:  206 PPMPS-YIILAPKRIRPGQLYQTSVTIVKLLY-PTLTIRMSIK--RNDFEYIHETTTFKTEGTQIMRL-EIPTRVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKW-KSRKSFHVKEYWLPRFDVNITLP--VKLSDQGFGVYGIIQANKTSGMFVRGNASITLEI---RDPAL-------DRFTTAPLLQINRTINY-FEGKADFLFTMDELRSLINQGSLAFKDVWVNATVFDSFTELVR--TGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYC-------IDSVKTDEFSNLIVPDS-GVIRLSFVPTQSLTCPTYRLRAEYLEDGNRLIS----WSEQRLFKYYSQSGAYMQITMATEYP-RVNEYAVFQIDMSYPTNKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAY-YVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQN-----FQQPIEQDWLYNLEYIIRTYLP--SPSF---GADTNTTMNSSGLIIFSDA 2128
            P  P+ Y+++AP  +RP Q +   + ++K      + +R+ ++  RN+       +  K    Q + L E+P +   P   Y   +   T N+ +IF N   L+++ K  SVFIQ  + +Y     V++R I +  +L P  G  T I+  +P+  ++ + +  T    G+Y  +  LA++   G+W IEVE     + + SF V  Y LP+F+VNI     + ++D    V+  + A  T G  V G A ++LE+   R  A+       +       L + RT+    +G+A  +F+ DEL+            + + A+V +  TE+ R  T    TF       V+  G     FKP +T+   +++ Q D T    T+ + V V  +          S++ ++ + ++  D+ G   L+  P   + C + R+ A Y   G    +    +S   +    S + +++Q+    E    V +   F +  + P + I  QV++  NIV    + + +  +  T S   + +MAP +R++ Y  +++  EV+ D+L F       N V + +++        V+     +  SF+ L V+   +      N +    +  +++ Y+ N     F  P  + W    E I R       P +   G+D  +  +++GL++ +DA
Sbjct:   34 PVKPATYMLVAPAVVRPDQPFSVCMNLLKQATDEDMIVRIEVRTERNETIAARVISNLKPGIAQTVSLSEMPAQSLTPRQSYKLYIRGETLNAELIFENENELKYDQKALSVFIQTDRAIYRPASLVRYRAIVVKSDLKPYVGNAT-IKIFDPSRNLISQTIGVTLD-RGVYSGELQLAEETLLGDWFIEVETSNGVQDKSSFTVDTYVLPKFEVNIKTSSFITINDD-LSVF--VDAKYTYGKGVAGKAKVSLELPWHRWHAMVPTIIDENGVKKEEELMVERTVKLNRQGEAAVVFSNDELKRHKLLHEWGGGSIRIVASVTEDITEIERNATHQISTFREEVKLDVEKQGD---TFKPGLTYNVVVALKQMDDTPVKATLPKRVQVSTFYNYPYNHDTSSLQEEKETKIVEVDAHGTSVLTLQP--PINCTSARIEAHYDIGGKDNFTATPIYSSLYVEAAVSPTKSFLQLLADNEGAVDVGKSLSFSLKATQPLSTITYQVMSRSNIVVSQQMTVNS--EHATISFPATANMAPKSRLIVYAIIESSQEVLVDALDFKVEGIFQNQVALSIDKQAVEPGQNVKFKVTSDKNSFVGLLVVDQSVLLLKTGNDITREKVEQDLENYDSNNVGGGFGGP--RPW----EAIDRKKRSIWRPWWGIGGSDAQSIFSNAGLVVLTDA 701          

HSP 2 Score: 104.76 bits (260), Expect = 4.621e-22
Identity = 140/657 (21.31%), Postives = 268/657 (40.79%), Query Frame = 2
Query: 2375 WLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVK--QSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRW----VPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFD--GSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEIIQRATAFIDRHLIN-SIDLFSQIIGTYAL----SKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSA---TDRN-RELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQL 4294
            W+W       +G +   ++ P   TSWV   +AI+ E G  +    +     R F++ + +P   + GE+  + + +FNY +   +  + +K  +   Y +++     + R    + +  ++V  +     G +K ++FPIV +  G       + I A    G +     +++   G     +   ++DL + +     +F   L           L W    V  S+ A++ ++GD++GP         + +K ++M +G  E        NI ++KY+R        +    + +  + +Q  L+Y       FS F +S    +T  TAF + +     +     Y ++  N+I  A  F+ +QQ++ G F   G     D+               A D      + +TA V++SI +      N     +A  ++++HL   S + ++  +  YAL    SK    A+       I     + +       F+ +  K +  +++ A      P        +    T+ A+L +  QN   E+    +  I +L   RN + GFTST D+ +AL+   S++A   +D++  ++  L  + T S   N R    I   +Y + +L    ND V     + A GTG +  QL
Sbjct:  759 WIWSDLN-STSGEVEMEIEAPDTITSWVASTFAINEENGLGVAPTTSKLRVFRPFFIQLNLPYAVRRGEKFALLVLVFNYMEKEQDVTVTLKYDKDSGYDLLKKDGTVVRR----DEVGQQNVRIVSVAGGGTSKAVYFPIVPSSIGE----IPVHISAIASQGGDAVEMNLRVDPQGYKVDRNIPFVIDLNNNSS----DFSKNLE----------LIWPNDVVDGSQKARLDVIGDMMGPV------LNNAHKLVQMPYGCGEQNMLNLVPNILVVKYLRATNRNESQLETKAIKFIEQGIQRELTY-KRADNSFSAFGDSDKAGSTWLTAFVVRSFHHAKQ-----YAFVDPNVISRAVAFLNSQQMESGAFAERGEVHHKDMQGG------------AQDG----GVALTAFVLISILE------NGMENGKAVTYLEKHLDEVSGNAYTMAVVAYALQLAKSKQAGKAFENLKKHKIVEKSGDVK-------FASAQKKVEKLKESRAYMFQARP--------VDIETTSYAVLSYLAQNQTSES----LSIIRWLVSQRNELGGFTSTQDTVMALQALSSYAAVTYSDKHTSQVTILNGKHTHSFDINIRN--AIVLQSYQLSSL----NDAV----SINANGTGVVFAQL 1329          
BLAST of CD109 antigen vs. Ensembl Celegans
Match: tep-1 (TEP (ThiolEster containing Protein) [Source:UniProtKB/TrEMBL;Acc:Q7JKM0])

HSP 1 Score: 131.339 bits (329), Expect = 3.378e-30
Identity = 161/686 (23.47%), Postives = 304/686 (44.31%), Query Frame = 2
Query:  206 PPMPS-YIILAPKRIRPGQLYQTSVTIVKLLY-PTLTIRMSIK--RNDFEYIHETTTFKTEGTQIMRL-EIPTRVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKW-KSRKSFHVKEYWLPRFDVNITLP--VKLSDQGFGVYGIIQANKTSGMFVRGNASITLEI---RDPAL-------DRFTTAPLLQINRTINY-FEGKADFLFTMDELRSLINQGSLAFKDVWVNATVFDSFTELVR--TGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYC-------IDSVKTDEFSNLIVPDS-GVIRLSFVPTQSLTCPTYRLRAEYLEDGNRLIS----WSEQRLFKYYSQSGAYMQITMATEYP-RVNEYAVFQIDMSYPTNKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAY-YVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQN-----FQQPIEQDWLYNLEYIIRTYLP--SPSF---GADTNTTMNSSGLIIFSDA 2128
            P  P+ Y+++AP  +RP Q +   + ++K      + +R+ ++  RN+       +  K    Q + L E+P +   P   Y   +   T N+ +IF N   L+++ K  SVFIQ  + +Y     V++R I +  +L P  G  T I+  +P+  ++ + +  T    G+Y  +  LA++   G+W IEVE     + + SF V  Y LP+F+VNI     + ++D    V+  + A  T G  V G A ++LE+   R  A+       +       L + RT+    +G+A  +F+ DEL+            + + A+V +  TE+ R  T    TF       V+  G     FKP +T+   +++ Q D T    T+ + V V  +          S++ ++ + ++  D+ G   L+  P   + C + R+ A Y   G    +    +S   +    S + +++Q+    E    V +   F +  + P + I  QV++  NIV    + + +  +  T S   + +MAP +R++ Y  +++  EV+ D+L F       N V + +++        V+     +  SF+ L V+   +      N +    +  +++ Y+ N     F  P  + W    E I R       P +   G+D  +  +++GL++ +DA
Sbjct:   34 PVKPATYMLVAPAVVRPDQPFSVCMNLLKQATDEDMIVRIEVRTERNETIAARVISNLKPGIAQTVSLSEMPAQSLTPRQSYKLYIRGETLNAELIFENENELKYDQKALSVFIQTDRAIYRPASLVRYRAIVVKSDLKPYVGNAT-IKIFDPSRNLISQTIGVTLD-RGVYSGELQLAEETLLGDWFIEVETSNGVQDKSSFTVDTYVLPKFEVNIKTSSFITINDD-LSVF--VDAKYTYGKGVAGKAKVSLELPWHRWHAMVPTIIDENGVKKEEELMVERTVKLNRQGEAAVVFSNDELKRHKLLHEWGGGSIRIVASVTEDITEIERNATHQISTFREEVKLDVEKQGD---TFKPGLTYNVVVALKQMDDTPVKATLPKRVQVSTFYNYPYNHDTSSLQEEKETKIVEVDAHGTSVLTLQP--PINCTSARIEAHYDIGGKDNFTATPIYSSLYVEAAVSPTKSFLQLLADNEGAVDVGKSLSFSLKATQPLSTITYQVMSRSNIVVSQQMTVNS--EHATISFPATANMAPKSRLIVYAIIESSQEVLVDALDFKVEGIFQNQVALSIDKQAVEPGQNVKFKVTSDKNSFVGLLVVDQSVLLLKTGNDITREKVEQDLENYDSNNVGGGFGGP--RPW----EAIDRKKRSIWRPWWGIGGSDAQSIFSNAGLVVLTDA 701          

HSP 2 Score: 104.76 bits (260), Expect = 4.621e-22
Identity = 140/657 (21.31%), Postives = 268/657 (40.79%), Query Frame = 2
Query: 2375 WLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVK--QSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRW----VPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFD--GSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEIIQRATAFIDRHLIN-SIDLFSQIIGTYAL----SKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSA---TDRN-RELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQL 4294
            W+W       +G +   ++ P   TSWV   +AI+ E G  +    +     R F++ + +P   + GE+  + + +FNY +   +  + +K  +   Y +++     + R    + +  ++V  +     G +K ++FPIV +  G       + I A    G +     +++   G     +   ++DL + +     +F   L           L W    V  S+ A++ ++GD++GP         + +K ++M +G  E        NI ++KY+R        +    + +  + +Q  L+Y       FS F +S    +T  TAF + +     +     Y ++  N+I  A  F+ +QQ++ G F   G     D+               A D      + +TA V++SI +      N     +A  ++++HL   S + ++  +  YAL    SK    A+       I     + +       F+ +  K +  +++ A      P        +    T+ A+L +  QN   E+    +  I +L   RN + GFTST D+ +AL+   S++A   +D++  ++  L  + T S   N R    I   +Y + +L    ND V     + A GTG +  QL
Sbjct:  759 WIWSDLN-STSGEVEMEIEAPDTITSWVASTFAINEENGLGVAPTTSKLRVFRPFFIQLNLPYAVRRGEKFALLVLVFNYMEKEQDVTVTLKYDKDSGYDLLKKDGTVVRR----DEVGQQNVRIVSVAGGGTSKAVYFPIVPSSIGE----IPVHISAIASQGGDAVEMNLRVDPQGYKVDRNIPFVIDLNNNSS----DFSKNLE----------LIWPNDVVDGSQKARLDVIGDMMGPV------LNNAHKLVQMPYGCGEQNMLNLVPNILVVKYLRATNRNESQLETKAIKFIEQGIQRELTY-KRADNSFSAFGDSDKAGSTWLTAFVVRSFHHAKQ-----YAFVDPNVISRAVAFLNSQQMESGAFAERGEVHHKDMQGG------------AQDG----GVALTAFVLISILE------NGMENGKAVTYLEKHLDEVSGNAYTMAVVAYALQLAKSKQAGKAFENLKKHKIVEKSGDVK-------FASAQKKVEKLKESRAYMFQARP--------VDIETTSYAVLSYLAQNQTSES----LSIIRWLVSQRNELGGFTSTQDTVMALQALSSYAAVTYSDKHTSQVTILNGKHTHSFDINIRN--AIVLQSYQLSSL----NDAV----SINANGTGVVFAQL 1329          
BLAST of CD109 antigen vs. Ensembl Celegans
Match: tep-1 (TEP (ThiolEster containing Protein) [Source:UniProtKB/TrEMBL;Acc:Q7JKM0])

HSP 1 Score: 131.339 bits (329), Expect = 3.542e-30
Identity = 161/686 (23.47%), Postives = 304/686 (44.31%), Query Frame = 2
Query:  206 PPMPS-YIILAPKRIRPGQLYQTSVTIVKLLY-PTLTIRMSIK--RNDFEYIHETTTFKTEGTQIMRL-EIPTRVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKW-KSRKSFHVKEYWLPRFDVNITLP--VKLSDQGFGVYGIIQANKTSGMFVRGNASITLEI---RDPAL-------DRFTTAPLLQINRTINY-FEGKADFLFTMDELRSLINQGSLAFKDVWVNATVFDSFTELVR--TGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYC-------IDSVKTDEFSNLIVPDS-GVIRLSFVPTQSLTCPTYRLRAEYLEDGNRLIS----WSEQRLFKYYSQSGAYMQITMATEYP-RVNEYAVFQIDMSYPTNKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAY-YVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQN-----FQQPIEQDWLYNLEYIIRTYLP--SPSF---GADTNTTMNSSGLIIFSDA 2128
            P  P+ Y+++AP  +RP Q +   + ++K      + +R+ ++  RN+       +  K    Q + L E+P +   P   Y   +   T N+ +IF N   L+++ K  SVFIQ  + +Y     V++R I +  +L P  G  T I+  +P+  ++ + +  T    G+Y  +  LA++   G+W IEVE     + + SF V  Y LP+F+VNI     + ++D    V+  + A  T G  V G A ++LE+   R  A+       +       L + RT+    +G+A  +F+ DEL+            + + A+V +  TE+ R  T    TF       V+  G     FKP +T+   +++ Q D T    T+ + V V  +          S++ ++ + ++  D+ G   L+  P   + C + R+ A Y   G    +    +S   +    S + +++Q+    E    V +   F +  + P + I  QV++  NIV    + + +  +  T S   + +MAP +R++ Y  +++  EV+ D+L F       N V + +++        V+     +  SF+ L V+   +      N +    +  +++ Y+ N     F  P  + W    E I R       P +   G+D  +  +++GL++ +DA
Sbjct:   34 PVKPATYMLVAPAVVRPDQPFSVCMNLLKQATDEDMIVRIEVRTERNETIAARVISNLKPGIAQTVSLSEMPAQSLTPRQSYKLYIRGETLNAELIFENENELKYDQKALSVFIQTDRAIYRPASLVRYRAIVVKSDLKPYVGNAT-IKIFDPSRNLISQTIGVTLD-RGVYSGELQLAEETLLGDWFIEVETSNGVQDKSSFTVDTYVLPKFEVNIKTSSFITINDD-LSVF--VDAKYTYGKGVAGKAKVSLELPWHRWHAMVPTIIDENGVKKEEELMVERTVKLNRQGEAAVVFSNDELKRHKLLHEWGGGSIRIVASVTEDITEIERNATHQISTFREEVKLDVEKQGD---TFKPGLTYNVVVALKQMDDTPVKATLPKRVQVSTFYNYPYNHDTSSLQEEKETKIVEVDAHGTSVLTLQP--PINCTSARIEAHYDIGGKDNFTATPIYSSLYVEAAVSPTKSFLQLLADNEGAVDVGKSLSFSLKATQPLSTITYQVMSRSNIVVSQQMTVNS--EHATISFPATANMAPKSRLIVYAIIESSQEVLVDALDFKVEGIFQNQVALSIDKQAVEPGQNVKFKVTSDKNSFVGLLVVDQSVLLLKTGNDITREKVEQDLENYDSNNVGGGFGGP--RPW----EAIDRKKRSIWRPWWGIGGSDAQSIFSNAGLVVLTDA 701          

HSP 2 Score: 104.76 bits (260), Expect = 4.850e-22
Identity = 140/657 (21.31%), Postives = 268/657 (40.79%), Query Frame = 2
Query: 2375 WLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVK--QSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRW----VPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFD--GSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEIIQRATAFIDRHLIN-SIDLFSQIIGTYAL----SKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSA---TDRN-RELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQL 4294
            W+W       +G +   ++ P   TSWV   +AI+ E G  +    +     R F++ + +P   + GE+  + + +FNY +   +  + +K  +   Y +++     + R    + +  ++V  +     G +K ++FPIV +  G       + I A    G +     +++   G     +   ++DL + +     +F   L           L W    V  S+ A++ ++GD++GP         + +K ++M +G  E        NI ++KY+R        +    + +  + +Q  L+Y       FS F +S    +T  TAF + +     +     Y ++  N+I  A  F+ +QQ++ G F   G     D+               A D      + +TA V++SI +      N     +A  ++++HL   S + ++  +  YAL    SK    A+       I     + +       F+ +  K +  +++ A      P        +    T+ A+L +  QN   E+    +  I +L   RN + GFTST D+ +AL+   S++A   +D++  ++  L  + T S   N R    I   +Y + +L    ND V     + A GTG +  QL
Sbjct:  751 WIWSDLN-STSGEVEMEIEAPDTITSWVASTFAINEENGLGVAPTTSKLRVFRPFFIQLNLPYAVRRGEKFALLVLVFNYMEKEQDVTVTLKYDKDSGYDLLKKDGTVVRR----DEVGQQNVRIVSVAGGGTSKAVYFPIVPSSIGE----IPVHISAIASQGGDAVEMNLRVDPQGYKVDRNIPFVIDLNNNSS----DFSKNLE----------LIWPNDVVDGSQKARLDVIGDMMGPV------LNNAHKLVQMPYGCGEQNMLNLVPNILVVKYLRATNRNESQLETKAIKFIEQGIQRELTY-KRADNSFSAFGDSDKAGSTWLTAFVVRSFHHAKQ-----YAFVDPNVISRAVAFLNSQQMESGAFAERGEVHHKDMQGG------------AQDG----GVALTAFVLISILE------NGMENGKAVTYLEKHLDEVSGNAYTMAVVAYALQLAKSKQAGKAFENLKKHKIVEKSGDVK-------FASAQKKVEKLKESRAYMFQARP--------VDIETTSYAVLSYLAQNQTSES----LSIIRWLVSQRNELGGFTSTQDTVMALQALSSYAAVTYSDKHTSQVTILNGKHTHSFDINIRN--AIVLQSYQLSSL----NDAV----SINANGTGVVFAQL 1321          
BLAST of CD109 antigen vs. Ensembl Celegans
Match: tep-1 (TEP (ThiolEster containing Protein) [Source:UniProtKB/TrEMBL;Acc:Q7JKM0])

HSP 1 Score: 131.339 bits (329), Expect = 3.542e-30
Identity = 161/686 (23.47%), Postives = 304/686 (44.31%), Query Frame = 2
Query:  206 PPMPS-YIILAPKRIRPGQLYQTSVTIVKLLY-PTLTIRMSIK--RNDFEYIHETTTFKTEGTQIMRL-EIPTRVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKW-KSRKSFHVKEYWLPRFDVNITLP--VKLSDQGFGVYGIIQANKTSGMFVRGNASITLEI---RDPAL-------DRFTTAPLLQINRTINY-FEGKADFLFTMDELRSLINQGSLAFKDVWVNATVFDSFTELVR--TGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYC-------IDSVKTDEFSNLIVPDS-GVIRLSFVPTQSLTCPTYRLRAEYLEDGNRLIS----WSEQRLFKYYSQSGAYMQITMATEYP-RVNEYAVFQIDMSYPTNKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAY-YVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQN-----FQQPIEQDWLYNLEYIIRTYLP--SPSF---GADTNTTMNSSGLIIFSDA 2128
            P  P+ Y+++AP  +RP Q +   + ++K      + +R+ ++  RN+       +  K    Q + L E+P +   P   Y   +   T N+ +IF N   L+++ K  SVFIQ  + +Y     V++R I +  +L P  G  T I+  +P+  ++ + +  T    G+Y  +  LA++   G+W IEVE     + + SF V  Y LP+F+VNI     + ++D    V+  + A  T G  V G A ++LE+   R  A+       +       L + RT+    +G+A  +F+ DEL+            + + A+V +  TE+ R  T    TF       V+  G     FKP +T+   +++ Q D T    T+ + V V  +          S++ ++ + ++  D+ G   L+  P   + C + R+ A Y   G    +    +S   +    S + +++Q+    E    V +   F +  + P + I  QV++  NIV    + + +  +  T S   + +MAP +R++ Y  +++  EV+ D+L F       N V + +++        V+     +  SF+ L V+   +      N +    +  +++ Y+ N     F  P  + W    E I R       P +   G+D  +  +++GL++ +DA
Sbjct:   34 PVKPATYMLVAPAVVRPDQPFSVCMNLLKQATDEDMIVRIEVRTERNETIAARVISNLKPGIAQTVSLSEMPAQSLTPRQSYKLYIRGETLNAELIFENENELKYDQKALSVFIQTDRAIYRPASLVRYRAIVVKSDLKPYVGNAT-IKIFDPSRNLISQTIGVTLD-RGVYSGELQLAEETLLGDWFIEVETSNGVQDKSSFTVDTYVLPKFEVNIKTSSFITINDD-LSVF--VDAKYTYGKGVAGKAKVSLELPWHRWHAMVPTIIDENGVKKEEELMVERTVKLNRQGEAAVVFSNDELKRHKLLHEWGGGSIRIVASVTEDITEIERNATHQISTFREEVKLDVEKQGD---TFKPGLTYNVVVALKQMDDTPVKATLPKRVQVSTFYNYPYNHDTSSLQEEKETKIVEVDAHGTSVLTLQP--PINCTSARIEAHYDIGGKDNFTATPIYSSLYVEAAVSPTKSFLQLLADNEGAVDVGKSLSFSLKATQPLSTITYQVMSRSNIVVSQQMTVNS--EHATISFPATANMAPKSRLIVYAIIESSQEVLVDALDFKVEGIFQNQVALSIDKQAVEPGQNVKFKVTSDKNSFVGLLVVDQSVLLLKTGNDITREKVEQDLENYDSNNVGGGFGGP--RPW----EAIDRKKRSIWRPWWGIGGSDAQSIFSNAGLVVLTDA 701          

HSP 2 Score: 104.76 bits (260), Expect = 4.850e-22
Identity = 140/657 (21.31%), Postives = 268/657 (40.79%), Query Frame = 2
Query: 2375 WLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVK--QSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRW----VPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFD--GSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEIIQRATAFIDRHLIN-SIDLFSQIIGTYAL----SKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSA---TDRN-RELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQL 4294
            W+W       +G +   ++ P   TSWV   +AI+ E G  +    +     R F++ + +P   + GE+  + + +FNY +   +  + +K  +   Y +++     + R    + +  ++V  +     G +K ++FPIV +  G       + I A    G +     +++   G     +   ++DL + +     +F   L           L W    V  S+ A++ ++GD++GP         + +K ++M +G  E        NI ++KY+R        +    + +  + +Q  L+Y       FS F +S    +T  TAF + +     +     Y ++  N+I  A  F+ +QQ++ G F   G     D+               A D      + +TA V++SI +      N     +A  ++++HL   S + ++  +  YAL    SK    A+       I     + +       F+ +  K +  +++ A      P        +    T+ A+L +  QN   E+    +  I +L   RN + GFTST D+ +AL+   S++A   +D++  ++  L  + T S   N R    I   +Y + +L    ND V     + A GTG +  QL
Sbjct:  751 WIWSDLN-STSGEVEMEIEAPDTITSWVASTFAINEENGLGVAPTTSKLRVFRPFFIQLNLPYAVRRGEKFALLVLVFNYMEKEQDVTVTLKYDKDSGYDLLKKDGTVVRR----DEVGQQNVRIVSVAGGGTSKAVYFPIVPSSIGE----IPVHISAIASQGGDAVEMNLRVDPQGYKVDRNIPFVIDLNNNSS----DFSKNLE----------LIWPNDVVDGSQKARLDVIGDMMGPV------LNNAHKLVQMPYGCGEQNMLNLVPNILVVKYLRATNRNESQLETKAIKFIEQGIQRELTY-KRADNSFSAFGDSDKAGSTWLTAFVVRSFHHAKQ-----YAFVDPNVISRAVAFLNSQQMESGAFAERGEVHHKDMQGG------------AQDG----GVALTAFVLISILE------NGMENGKAVTYLEKHLDEVSGNAYTMAVVAYALQLAKSKQAGKAFENLKKHKIVEKSGDVK-------FASAQKKVEKLKESRAYMFQARP--------VDIETTSYAVLSYLAQNQTSES----LSIIRWLVSQRNELGGFTSTQDTVMALQALSSYAAVTYSDKHTSQVTILNGKHTHSFDINIRN--AIVLQSYQLSSL----NDAV----SINANGTGVVFAQL 1321          
BLAST of CD109 antigen vs. Ensembl Celegans
Match: tep-1 (TEP (ThiolEster containing Protein) [Source:UniProtKB/TrEMBL;Acc:Q7JKM0])

HSP 1 Score: 131.339 bits (329), Expect = 3.542e-30
Identity = 161/686 (23.47%), Postives = 304/686 (44.31%), Query Frame = 2
Query:  206 PPMPS-YIILAPKRIRPGQLYQTSVTIVKLLY-PTLTIRMSIK--RNDFEYIHETTTFKTEGTQIMRL-EIPTRVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKW-KSRKSFHVKEYWLPRFDVNITLP--VKLSDQGFGVYGIIQANKTSGMFVRGNASITLEI---RDPAL-------DRFTTAPLLQINRTINY-FEGKADFLFTMDELRSLINQGSLAFKDVWVNATVFDSFTELVR--TGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYC-------IDSVKTDEFSNLIVPDS-GVIRLSFVPTQSLTCPTYRLRAEYLEDGNRLIS----WSEQRLFKYYSQSGAYMQITMATEYP-RVNEYAVFQIDMSYPTNKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAY-YVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQN-----FQQPIEQDWLYNLEYIIRTYLP--SPSF---GADTNTTMNSSGLIIFSDA 2128
            P  P+ Y+++AP  +RP Q +   + ++K      + +R+ ++  RN+       +  K    Q + L E+P +   P   Y   +   T N+ +IF N   L+++ K  SVFIQ  + +Y     V++R I +  +L P  G  T I+  +P+  ++ + +  T    G+Y  +  LA++   G+W IEVE     + + SF V  Y LP+F+VNI     + ++D    V+  + A  T G  V G A ++LE+   R  A+       +       L + RT+    +G+A  +F+ DEL+            + + A+V +  TE+ R  T    TF       V+  G     FKP +T+   +++ Q D T    T+ + V V  +          S++ ++ + ++  D+ G   L+  P   + C + R+ A Y   G    +    +S   +    S + +++Q+    E    V +   F +  + P + I  QV++  NIV    + + +  +  T S   + +MAP +R++ Y  +++  EV+ D+L F       N V + +++        V+     +  SF+ L V+   +      N +    +  +++ Y+ N     F  P  + W    E I R       P +   G+D  +  +++GL++ +DA
Sbjct:   34 PVKPATYMLVAPAVVRPDQPFSVCMNLLKQATDEDMIVRIEVRTERNETIAARVISNLKPGIAQTVSLSEMPAQSLTPRQSYKLYIRGETLNAELIFENENELKYDQKALSVFIQTDRAIYRPASLVRYRAIVVKSDLKPYVGNAT-IKIFDPSRNLISQTIGVTLD-RGVYSGELQLAEETLLGDWFIEVETSNGVQDKSSFTVDTYVLPKFEVNIKTSSFITINDD-LSVF--VDAKYTYGKGVAGKAKVSLELPWHRWHAMVPTIIDENGVKKEEELMVERTVKLNRQGEAAVVFSNDELKRHKLLHEWGGGSIRIVASVTEDITEIERNATHQISTFREEVKLDVEKQGD---TFKPGLTYNVVVALKQMDDTPVKATLPKRVQVSTFYNYPYNHDTSSLQEEKETKIVEVDAHGTSVLTLQP--PINCTSARIEAHYDIGGKDNFTATPIYSSLYVEAAVSPTKSFLQLLADNEGAVDVGKSLSFSLKATQPLSTITYQVMSRSNIVVSQQMTVNS--EHATISFPATANMAPKSRLIVYAIIESSQEVLVDALDFKVEGIFQNQVALSIDKQAVEPGQNVKFKVTSDKNSFVGLLVVDQSVLLLKTGNDITREKVEQDLENYDSNNVGGGFGGP--RPW----EAIDRKKRSIWRPWWGIGGSDAQSIFSNAGLVVLTDA 701          

HSP 2 Score: 104.76 bits (260), Expect = 4.850e-22
Identity = 140/657 (21.31%), Postives = 268/657 (40.79%), Query Frame = 2
Query: 2375 WLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVK--QSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRW----VPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFD--GSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEIIQRATAFIDRHLIN-SIDLFSQIIGTYAL----SKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSA---TDRN-RELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQL 4294
            W+W       +G +   ++ P   TSWV   +AI+ E G  +    +     R F++ + +P   + GE+  + + +FNY +   +  + +K  +   Y +++     + R    + +  ++V  +     G +K ++FPIV +  G       + I A    G +     +++   G     +   ++DL + +     +F   L           L W    V  S+ A++ ++GD++GP         + +K ++M +G  E        NI ++KY+R        +    + +  + +Q  L+Y       FS F +S    +T  TAF + +     +     Y ++  N+I  A  F+ +QQ++ G F   G     D+               A D      + +TA V++SI +      N     +A  ++++HL   S + ++  +  YAL    SK    A+       I     + +       F+ +  K +  +++ A      P        +    T+ A+L +  QN   E+    +  I +L   RN + GFTST D+ +AL+   S++A   +D++  ++  L  + T S   N R    I   +Y + +L    ND V     + A GTG +  QL
Sbjct:  751 WIWSDLN-STSGEVEMEIEAPDTITSWVASTFAINEENGLGVAPTTSKLRVFRPFFIQLNLPYAVRRGEKFALLVLVFNYMEKEQDVTVTLKYDKDSGYDLLKKDGTVVRR----DEVGQQNVRIVSVAGGGTSKAVYFPIVPSSIGE----IPVHISAIASQGGDAVEMNLRVDPQGYKVDRNIPFVIDLNNNSS----DFSKNLE----------LIWPNDVVDGSQKARLDVIGDMMGPV------LNNAHKLVQMPYGCGEQNMLNLVPNILVVKYLRATNRNESQLETKAIKFIEQGIQRELTY-KRADNSFSAFGDSDKAGSTWLTAFVVRSFHHAKQ-----YAFVDPNVISRAVAFLNSQQMESGAFAERGEVHHKDMQGG------------AQDG----GVALTAFVLISILE------NGMENGKAVTYLEKHLDEVSGNAYTMAVVAYALQLAKSKQAGKAFENLKKHKIVEKSGDVK-------FASAQKKVEKLKESRAYMFQARP--------VDIETTSYAVLSYLAQNQTSES----LSIIRWLVSQRNELGGFTSTQDTVMALQALSSYAAVTYSDKHTSQVTILNGKHTHSFDINIRN--AIVLQSYQLSSL----NDAV----SINANGTGVVFAQL 1321          
BLAST of CD109 antigen vs. Ensembl Fly
Match: Mcr (gene:FBgn0267488 transcript:FBtr0079543)

HSP 1 Score: 473.781 bits (1218), Expect = 1.619e-138
Identity = 380/1347 (28.21%), Postives = 636/1347 (47.22%), Query Frame = 2
Query: 1007 INYFEGKADFLFTMDELRSLINQGSLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRN-------------------------VNVKAYCIDSVKTDEFSNLIVPDSGVIRLSFVPTQSLTCPTYRLRAEYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTNKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQNFQQPIEQDWLY---NLEYIIRTYLPSPSFGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLA--TAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPN-----AEIIQRATAFIDRH---LINSIDLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYNRSIYQTVELYSNHICNVFGSYQCPYSPYFNVA-SSTVEINFLFVFAIIVASLLDQLHLFSNL 4930
            + YF G  DF + + EL  L+   +LA  +V + ATV + F + + +G++   +Y+    V FLG   + FKP M FT +L+V   DG+     + R                          ++ ++  I  VK D  ++L + D    R      Q++     RL+A +++     I  +E  L  +YS    ++++T +TE P V EY +F I  ++   +    +++ G I+  D   +   +KT   ++ +S +MAPVA +V + +   G+VV+DSLTF  N  + NN  + +N  K    + VE+  +GEPGS++ L+ +    Y+  A N L    II +M  +++      +  W     N + ++  Y P+ SFG D N T   SGLI+F+D    +    +TCN T+   + L        +CY   ++CDG   C +  DE+ C     N T         F+ + RH+ +  WLWK   I P+GR  F V++P     W++ A+++   KGF ++ +   + G++ F++ VE+PE C+ GEQ+G+R+T+FNY     EA++ +  S  Y+ V V E GI R+++P T S       +YL A     ++ P+V    GN D    +++   T +G++   R + +  +G+  Y H + L+DL+++A +  Y   + + Q+   P +    +V  S  A++S+VGD+VGP   F    V+    L +   + E   F F  N+Y + Y+R     +  +  N   + N   Q  LS F    G FS FR   N  ++    T++ L      +  +W+ +I+I   +I+    ++   Q   G F   FE   + D K   TN             + I +T+ V+++++  K +S       A   QRA A+I+R+   L +    F   I  YAL    +         +   +   AR  G   Y+ + ++ PQ   +         PRL +  D L    TA A+L++  +  +   DP     + +L   R +  G+ ST D+S AL+    ++   R RE+  L VE+  SS+G   +T  I  +N        IP+   WG   + A+G G  ++Q+ V+  V D  + +          P   F ++ +A F G+N S +    C +W+  N       +GM V DV +PTGY     +L  YV S     LR AR+   KI FY   L     CV F  +R++PVAN+SR      Y+YY P R+N SI+  +  Y  +IC V GS QCPY   +N+   +++ ++ LF F++ +  L  + HL  N+
Sbjct:  479 LRYFNGTFDFKWPLRELELLV--PNLANSEVLITATVGEKFYDEIISGYSVARVYNSSLRVVFLGDSPQVFKPAMPFTTYLAVEYHDGSPIDPNLLRQGLMEVSGFVESRNGGRRDWPAQRLPMSQQSDGIWEVKIDIRNDLNLDDRPQARDFLNGVQNM-----RLQANFVDPRGERIQ-TELLLVSHYSPRNQHIKVTTSTEKPVVGEYIIFHIRTNFYLEEFNYLIMSKGVILVNDRETITEGIKT--IAVVLSSEMAPVATIVVWKINQQGQVVADSLTFPVNGISRNNFTVYINNRKARTGEKVEVAIFGEPGSYVGLSGIDSAFYTMQAGNELTYAKIITKMSNFDEQTNGTYKHIWYSHEGNPDELV--YFPASSFGVDANRTFEYSGLIVFTDG--YVPRRQDTCNRTLGFGECL------SGRCYRLEKQCDGLFDCDDGTDEINC--HARNDTELLNYRKYRFNRVLRHY-ENVWLWKDVNIGPHGRYIFNVEVPDRPAYWMVSAFSVSPSKGFGMMNKALEYVGVQPFFINVEMPEACRQGEQVGIRVTVFNYMITPIEAIVVLHDSPDYKFVHVEEDGIVRSYNPRT-SFGEHQFFIYLEAQGTTVVYVPVVPQRLGNVD----VTLHVATLLGTDTITRTLHVESDGLPQYRHQSVLLDLSNRAYVLEY-MHVNVTQTPEIPYQVDRYFVYGSNKARISVVGDVVGPI--FPTMPVNASSLLSLPMESGEQNAFSFAANLYTIMYMRLINQRNKTLEKNAFYHMNIGYQRQLS-FMRPDGSFSLFRSDWNNSDSSVWLTSYCLRVFQEASFYEWENFIWIDATIIEKNMRWLLQHQTPQGSF---FEVTWLPDRKMNRTNFD-----------KNITLTSHVLITLATVKDISGTLGSRVALATQRALAYIERNMDFLRHQAQPFDVAITAYALQLCNSPI----AEEVFAILRRQARTIGDFMYWGNQEI-PQPPRKLENQKWFSLPRLPYEYDSLNIETTAYALLVYVARREFFV-DP----IVRWLNSQRLNDGGWASTQDTSAALKALVEYTVRSRLREVSSLTVEIEASSQGGKTQTLYIDDTNLAKLQSIEIPD--AWGTIKVQAKGAGYAILQMHVQYNV-DIEKFQ-------TKPPVPAFGLHTKAIFHGRNQSHISYVACQNWINQNE---SERSGMAVLDVAIPTGYWIQQQKLDTYVLSNRVRNLRRARYLERKIVFYFDYLDHEDICVNFTIERWYPVANMSRYLPVRIYDYYAPERFNESIFDALPTYLLNICEVCGSSQCPYCSIYNMGWRASMSMSLLF-FSVFIYLLRSRTHLVLNM 1755          

HSP 2 Score: 147.517 bits (371), Expect = 6.589e-35
Identity = 91/250 (36.40%), Postives = 144/250 (57.60%), Query Frame = 2
Query:  215 PSYIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRNDFEYIHETTTFKTEG---TQIMRLEIPTRVAPPDDYYLEVVGSVTDN-SAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIR 952
            P+Y I+A + +RPG +YQ SV+I++  YP +T+  SI  +  +   ++   K EG   T +MR+  PT V     Y L V G   +    + F N TRL+F+ +  ++F+Q  KP+Y QG+TV+FR IP+   L   F     +  ++PN  I+KRW++  +++G +  +++ L+DQ T G WTI V  +  +    F V+EY+  RF+VN+T+P         +YG + AN TSG+ VRGN +I   IR
Sbjct:  130 PTYFIVASRMVRPGLIYQVSVSILQAQYP-ITVHASIACDGVQISGDSKDVK-EGIPETLLMRIP-PTSVT--GSYKLRVEGFYQNVFGGLAFLNETRLDFSQRSMTIFVQTDKPLYMQGETVRFRTIPITTELKG-FDNPVDVYMLDPNRHILKRWLSRQSNLGSV-SLEYKLSDQPTFGEWTIRVIAQGQQEESHFTVEEYYQTRFEVNVTMPAYFFTTDPFIYGRVMANFTSGLPVRGNLTIKATIR 372          
BLAST of CD109 antigen vs. Ensembl Fly
Match: Tep2 (gene:FBgn0041182 transcript:FBtr0079513)

HSP 1 Score: 186.422 bits (472), Expect = 6.402e-47
Identity = 342/1572 (21.76%), Postives = 618/1572 (39.31%), Query Frame = 2
Query:  221 YIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRNDFEYIHETTTFKTEGTQIMRLEIPTRVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMP--VFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELE-KWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSLINQGSLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRP--FKPNMTFTAFLSVYQPDGTKTVTTINRNVNV---KAYCI---DSVKTDEFSNLIVPDSGVIRLSFVPTQSLTCPTYRLRAEYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQI----DMSYPTNKIFV-QVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYY-VKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQNFQQPIEQDWLYNLEYIIRTYLPSPSFGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRV--DLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQ-YRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYE--PEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAE-IIQRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMIN--PRLEWPNDGLTTACTAMAMLLFKEQNIWKENDP--NNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKL-----QVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPR---NPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGK-----IHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYNRSIYQTVELYSNHICNVFGSYQC 4816
            Y ++ P  +R    Y   V++ K   P+  I++S+    +    +        TQ +  E+P       +Y L   G     S ++F N T+L +  K+ SVF+Q  K  Y     VQFR++ L  N  P  +   I+ I        I  + ++      G++  +  L++Q   G W I V ++   +  KSF V +Y LP+F+V +  P  +      +   I+A  T G  V+G A++++E R         A   +  +TI+  +GK    F +        Q       + + A V +  T   +   A   ++    +++      RP  F+ N +F   + V   DG+  VT   +NV +   K+Y      S KT       V ++G+   + V         YR+ A +    N + S S+   F+    S   ++I + T+ PR+ E   F +    D+ Y     FV  +VA GN++  D + + +  KT T   + +  M P A +  YY V  D +    ++ F    +N  +V+   N       + V++    +  SF+ L  +   +    + N L   +I + +  Y+ +        W+         Y   P           +SGL+  ++ANY     YNT           P Y     + Y+            N +D L      AN  P   N ++  + + +++ D  W+W++   +  G   F +   +P   TSWV+  ++++   G ++ + P+     + F++   +P   + GE + + + +FNY D   +A + +  SDQ Y   +     + +A D      +     V + A   K + F I    +  N    T+ I A + +  +  ++++K+   GVT + +    ++L  + +++         QS     P E     VP S+  + S+VGD++GPT    LQ +D    +RM +G  E     F  NI +LKY+        +V      +     Q  L+Y     G +S F +S    +T  TA+ + +           Y  I   +I    +F+ ++Q + G F                          D   Q  + +T+ V+L+  +   + P  +  I++A  ++      + D +S  I   AL      A   +   +I  + + AR +    ++S +      TE T     + +  PR    ND   T+   +A+L         E DP    +  I +L   RN   GF+ST D+ + L+    F+        YK       +++  SS G  + T  +   N  V     +P      +F   A+GTG  ++QL    R   A + K P     P+  D P Q                +LI+D+C  ++         ++ M V ++ LP+G+V  +  L +      Q + R  R          + ++ +  P    C+   A +   VA   +    S Y+YY+  R     YQ      + +C++     C
Sbjct:   23 YSVVGPGTLRSNSKYNVVVSVHKADGPS-QIKVSLNGPSYNETKQIE-LPPMSTQNVEFEVPKLAT--GNYNLSAEGV----SGVVFKNSTKLNYADKKPSVFVQTDKATYKPADLVQFRILFLDENTRPAKIEKPISVIIIDGAQNRI--KQLSDVKLTKGVFSGELQLSEQPVLGTWKISVSVDGDNRETKSFEVDKYVLPKFEVIVDTPKAVVIADKVIKATIRAKYTYGKPVKGKATVSME-RSYGYFGDLNANGNKQEKTID-VDGKGHVEFDIIHWA----QRGQYLPPIKLFAVVTEELTGNKQNATATVVLHQQRYSIE---PYERPEHFEANKSFIYQVVVKNVDGS-PVTNSAKNVKIGFDKSYSYFHEPSPKTRINFEAPVNENGIATFN-VRLPDSDSRYYRIFASFDGSENTIGSISK---FEPTPMSREPLKIQVNTKKPRLGEQVSFDVVSIEDLPY-----FVYTIVARGNVILSDYVDVPDGQKTYTVKFTPTFSMVPKATIYVYYVVNNDLQFEEKTIDFEKEFSNSIDVSAPTNAKPS---EEVKLRIKTDADSFVGLLGVDQSVLLLKSGNDLSQDDIFNSLNIYQTS------TPWM-------NGYGRYPG---------QTSGLVTLTNANYP----YNT---------EFPDYVEDDPEIYAFE----------NNLDALPPMPAIANFPPDTGNTVQPVE-IRKNFAD-VWIWQSIG-RSVGEEEFTLTKKIPDTITSWVVTGFSLNPTSGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYLDKTLDADVVMDNSDQEYEFTEATNEVLEKAIDEVRRVKR-----VTIPANSGKSVSFMI----RPKNVGFTTLKITATSALAGDAIHQKLKVEPEGVTLFENRAVFINLKDQPEMS---------QSLDADIPNE----VVPQSEFIEFSVVGDLLGPT----LQNLDNL--VRMPYGCGEQNMVNFVPNILVLKYLEVTGRKLPSVESKARKFLEIGYQRELTY-KHDDGSYSAFGKSDASGSTWLTAYVMRSFHQAG-----TYTDIDPKVITAGLDFLVSKQKESGEF-------------------PEVGKLFDNANQNPLALTSFVLLAFFENHELIPKYQSAIKKAVRYVAEEADKTDDQYSLAIAAVALQ----LAKHPQSEKVIAKLESVARKENDRMWWSKA------TESTGEDGRVFHWKPR---SNDVEITSYVLLALL---------EKDPAEKALPIIKWLISQRNSNGGFSSTQDTVIGLQALTKFA--------YKTGSGSGTMDIEFSSAGESKNTIKVNPENSLVLQTHDLPKSTRKVDF--TAKGTGSAMVQLSY--RYNLAEKEKKPSFKVTPTVKDTPNQ----------------LLIVDVCAEYVPLEDADKDKDSNMAVMEIALPSGFVGDSTSLGKI-----QAVDRVKRVETKNSDSTVVVYFDSLTPGDVRCLPLEASKAHAVAK-QKPASVSLYDYYDTERKATEYYQV----KSSLCDICEGADC 1401          
BLAST of CD109 antigen vs. Ensembl Fly
Match: Tep2 (gene:FBgn0041182 transcript:FBtr0079510)

HSP 1 Score: 178.718 bits (452), Expect = 1.412e-44
Identity = 338/1575 (21.46%), Postives = 615/1575 (39.05%), Query Frame = 2
Query:  221 YIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRNDFEYIHETTTFKTEGTQIMRLEIPTRVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMP--VFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELE-KWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSLINQGSLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRP--FKPNMTFTAFLSVYQPDGTKTVTTINRNVNV---KAYCI---DSVKTDEFSNLIVPDSGVIRLSFVPTQSLTCPTYRLRAEYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQI----DMSYPTNKIFV-QVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYY-VKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQNFQQPIEQDWLYNLEYIIRTYLPSPSFGADTNTTMNSSGLIIFSDANYTMVNFYNT---CNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRV--DLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQ-YRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYE--PEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAE-IIQRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMIN--PRLEWPNDGLTTACTAMAMLLFKEQNIWKENDP--NNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKL-----QVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPR---NPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGK-----IHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYNRSIYQTVELYSNHICNVFGSYQC 4816
            Y ++ P  +R    Y   V++ K   P+  I++S+    +    +        TQ +  E+P       +Y L   G     S ++F N T+L +  K+ SVF+Q  K  Y     VQFR++ L  N  P  +   I+ I        I  + ++      G++  +  L++Q   G W I V ++   +  KSF V +Y LP+F+V +  P  +      +   I+A  T G  V+G A++++E R         A   +  +TI+  +GK    F +        Q       + + A V +  T   +   A   ++    +++      RP  F+ N +F   + V   DG+  VT   +NV +   K+Y      S KT       V ++G+   + V         YR+ A +    N + S S+   F+    S   ++I + T+ PR+ E   F +    D+ Y     FV  +VA GN++  D + + +  KT T   + +  M P A +  YY V  D +    ++ F    +N  +V+   N       + V++    +  SF+ L  +   +    + N L   +I + +  Y+ +        W+         Y   P           +SGL+  ++ANY     YNT       V +    P  +    +   R +  D  +     +++    E     TP+   + + F              +T++ +  G   F +   +P   TSWV+  ++++   G ++ + P+     + F++   +P   + GE + + + +FNY D   +A + +  SDQ Y   +     + +A D      +     V + A   K + F I    +  N    T+ I A + +  +  ++++K+   GVT + +    ++L  + +++         QS     P E     VP S+  + S+VGD++GPT    LQ +D    +RM +G  E     F  NI +LKY+        +V      +     Q  L+Y     G +S F +S    +T  TA+ + +           Y  I   +I    +F+ ++Q + G F                          D   Q  + +T+ V+L+  +   + P  +  I++A  ++      + D +S  I   AL      A   +   +I  + + AR +    ++S +      TE T     + +  PR    ND   T+   +A+L         E DP    +  I +L   RN   GF+ST D+ + L+    F+        YK       +++  SS G  + T  +   N  V     +P      +F   A+GTG  ++QL    R   A + K P     P+  D P Q                +LI+D+C  ++         ++ M V ++ LP+G+V  +  L +      Q + R  R          + ++ +  P    C+   A +   VA   +    S Y+YY+  R     YQ      + +C++     C
Sbjct:   23 YSVVGPGTLRSNSKYNVVVSVHKADGPS-QIKVSLNGPSYNETKQIE-LPPMSTQNVEFEVPKLAT--GNYNLSAEGV----SGVVFKNSTKLNYADKKPSVFVQTDKATYKPADLVQFRILFLDENTRPAKIEKPISVIIIDGAQNRI--KQLSDVKLTKGVFSGELQLSEQPVLGTWKISVSVDGDNRETKSFEVDKYVLPKFEVIVDTPKAVVIADKVIKATIRAKYTYGKPVKGKATVSME-RSYGYFGDLNANGNKQEKTID-VDGKGHVEFDIIHWA----QRGQYLPPIKLFAVVTEELTGNKQNATATVVLHQQRYSIE---PYERPEHFEANKSFIYQVVVKNVDGS-PVTNSAKNVKIGFDKSYSYFHEPSPKTRINFEAPVNENGIATFN-VRLPDSDSRYYRIFASFDGSENTIGSISK---FEPTPMSREPLKIQVNTKKPRLGEQVSFDVVSIEDLPY-----FVYTIVARGNVILSDYVDVPDGQKTYTVKFTPTFSMVPKATIYVYYVVNNDLQFEEKTIDFEKEFSNSIDVSAPTNAKPS---EEVKLRIKTDADSFVGLLGVDQSVLLLKSGNDLSQDDIFNSLNIYQTS------TPWM-------NGYGRYPG---------QTSGLVTLTNANYP----YNTGPLVMSYVFEGSRHPWITRPRYRVGIRGDSGDRISFLSQSLNDRNLKEILLKQTPQRTTIRKEFP-------------ETWFFENVGEEEFTLTKKIPDTITSWVVTGFSLNPTSGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYLDKTLDADVVMDNSDQEYEFTEATNEVLEKAIDEVRRVKR-----VTIPANSGKSVSFMI----RPKNVGFTTLKITATSALAGDAIHQKLKVEPEGVTLFENRAVFINLKDQPEMS---------QSLDADIPNE----VVPQSEFIEFSVVGDLLGPT----LQNLDNL--VRMPYGCGEQNMVNFVPNILVLKYLEVTGRKLPSVESKARKFLEIGYQRELTY-KHDDGSYSAFGKSDASGSTWLTAYVMRSFHQAG-----TYTDIDPKVITAGLDFLVSKQKESGEF-------------------PEVGKLFDNANQNPLALTSFVLLAFFENHELIPKYQSAIKKAVRYVAEEADKTDDQYSLAIAAVALQ----LAKHPQSEKVIAKLESVARKENDRMWWSKA------TESTGEDGRVFHWKPR---SNDVEITSYVLLALL---------EKDPAEKALPIIKWLISQRNSNGGFSSTQDTVIGLQALTKFA--------YKTGSGSGTMDIEFSSAGESKNTIKVNPENSLVLQTHDLPKSTRKVDF--TAKGTGSAMVQLSY--RYNLAEKEKKPSFKVTPTVKDTPNQ----------------LLIVDVCAEYVPLEDADKDKDSNMAVMEIALPSGFVGDSTSLGKI-----QAVDRVKRVETKNSDSTVVVYFDSLTPGDVRCLPLEASKAHAVAK-QKPASVSLYDYYDTERKATEYYQV----KSSLCDICEGADC 1413          
BLAST of CD109 antigen vs. Ensembl Fly
Match: Tep1 (gene:FBgn0041183 transcript:FBtr0080811)

HSP 1 Score: 146.747 bits (369), Expect = 7.900e-35
Identity = 324/1567 (20.68%), Postives = 588/1567 (37.52%), Query Frame = 2
Query:  221 YIILAPKRIRPGQLYQTSVTI----------VKLLYPTLTIRMSIKRNDFEYIHETTTFKTEGTQIMRLEIPTRVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMP-VFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELE-KWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSLINQGSLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVIRLSF---VPTQSL----TCPTYRLRAEYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTNKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYVKTDGEVVSDSLTF-----FSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLAL-NVLHYDLYSRGADNILRDYNIIDEMKTYEQNFQQPIEQDWLYNLEYIIRTYLPSPSFGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDML-YRHWNDGAWLWKTYW-IKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSD-QYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVG-DIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDIL--DSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPN-AEIIQRATAFIDRHLINSIDLFSQIIGTYALSKS-GTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFS-ATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKL-PQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYNRSIYQTVELYSNHICNVFGSYQC 4816
            Y +LAPK +R    Y   V I          V L  P+L        N  +Y+      ++  ++ +R +IP       DY L+V+GS      I F N T+L F P    ++IQ  K  Y  G  +QFRV+ L  N  P V      I+  + +  ++K W +      G+Y  +  L+D+   GNWT+   ++ + K      V +Y +P+F+V +     ++     +   I+A  T    V+G+   T+E         +T   L I+  +N      +F  +    R L            + A V +  T++   G AY  ++     ++ L      F P          Y+P  +    T+ RN++  +  +DS K   F+ L    S     S    + T+ +    TC +  + + +          + + + +Y  +    + I + T+ P++ +     I          + VVA GNIV      M+   K++      +  + P A +  +Y+  DG ++SD  T      F N   +   N  + R      D V +     P SF+ L  V    L  R  +++ RD  I++ + TY                                      S+ L+I ++AN   +N Y                S+ G  CY+     + T   I        P   + P P   +      +   R      WL+     +  NG    +  +P   TSWVI  +++  + G ++   P+     + F++   +P   + GE + + + +FNY     +A + +  SD QY  ++     +++      +  K     +++ A   + I F I     G      T+ I A +    +  ++ +K+  +GV  Y +   L+           N +   R+S   PE+ ++    D+ I     V  ++ G + + +L+ +D    + +  G  E   F F  +I  L Y++        +      Y     Q  L+Y     G FS + +     +T  TA+ + +          +YI I +N++    +F+ ++Q      DG F+ + ++  +S   P                 + +T+ V+L+  + +   P    +I RA  F+   +  S + +   I   ALS +   +AY      ++  +   A   G  K+++ SD K + +E                        T+  +L   E NI  E  P     + +L   RN   GF S+ D+ V +     +   +  + E   ++       + + R T   +F   T      +P +    E  L+A+G GR  +QL     V  A +   P           +F +    K S K    LI+ ICG++    +        M +  V+LP+GYV  + E    +E+ S       +    ++H Y  KL P  + C+T  A     VAN+ +      Y+YY   R     Y         +C++    +C
Sbjct:   23 YSVLAPKTLRSNSAYNVVVAIHNTTRTTEVSVSLTGPSL--------NSRKYVD----VQSMSSKSVRFDIPKLTE--GDYELKVMGS----GGIEFQNSTKLSFAPDLNWLYIQSDKATYKPGDKIQFRVLFLDKNTRPAVIDKPIKIEIRDGDQNLIKSWKD-IKPAKGVYSGELQLSDRPVLGNWTVTATVQDEGKVTNVLVVDKYVVPKFEVVVLTAKNVAASAGYIRATIKARYTFKKPVKGHVVATIE-------GSSTEQSLPIDGEVN-----VEFPISATAKRLL-----------KITAIVTEELTDIKHNGTAYVTVHQHRHKLEDL------FWPTH--------YRPGVSSEFKTVVRNLD-GSPVMDSSKMVNFNVLCCQVSKNFSASLQNSIATEHIMLPETCQSCLVTSTFD---------TAENIERYIYKLNKPLMIAINTKKPQLRKLLKINIISDTYLPYFILTVVARGNIVLSLFQEMKEKKKSQEIEFEPTFALVPQATIFVHYI-IDGVLMSDEKTVDIERDFENTIEILTTNEALPR------DEVSLKVKTNPHSFVGLLGVDQSVLLLRSGNDLNRDL-ILNNLATY--------------------------------------STDLVILTNAN---INIYR---------------SSGG--CYTNPGYTNCTGSLIGRTMFKNEPTKNSGPVPIVGSTRAQASLPPVRKLFPETWLFSNITDVGANGEYIIKETVPDTLTSWVITGFSLSPQSGLAVTRNPSRIRVFQPFFITTNLPYSVKRGEVIAIPVIVFNYLGMDVKAKVLMDNSDGQYEFIETTNKNVSQYL--RGVRRKKT---LWIPANTGRGISFMIRPKKVG----LTTLKITAISKYAGDRLHQILKVEADGVQKYVNKAVLI-----------NVQRLNRRSLAPPEKTIIIEKADNVIEGSETVEFEVCGTSQAPQLEHLDDL--VHLPCGCGEQNMFNFVPSILALSYLKAKNRQDQEIENKAKRYVETGYQIELNY-KRNDGSFSAWGQHDALGSTWLTAYVIRSFHQAA-----KYIDIDKNVLVAGLDFLVSRQST----DGKFKELGMVIHNSHGSP-----------------LALTSFVLLTFFENEEYMPKYKHVIDRAVEFVVTEVHQSNEPYDLAIAALALSLARNRNAYK-----VLDKLDKLATRRGDHKWWTGSD-KCKSSE---------------------VETTSYVLLALLEHNISDEPKP----IVDWLISKRNSNGGFVSSQDTVVGIMALTKYELQSHASTEAIDIEFWHLNEDKKHVRVTKENEFKVQT----HQLPENT--NEVKLLAKGQGRAQVQLTYRYNV--ATKEARP-----------SFKLTTTVKKSHKGR--LILGICGTYTPIAASERNKTTNMALMQVQLPSGYVC-DIEPFADIEAISDVKRVETKNEDTEVHIYFEKLSPGDRKCLTLEAIYTHAVANL-KPSWVRLYDYYATERSATEFYHV----DTSLCDICHGNEC 1350          
BLAST of CD109 antigen vs. Ensembl Fly
Match: Tep2 (gene:FBgn0041182 transcript:FBtr0335487)

HSP 1 Score: 124.79 bits (312), Expect = 5.056e-28
Identity = 180/837 (21.51%), Postives = 326/837 (38.95%), Query Frame = 2
Query: 2375 WLWKTYWIKPNGRINFRV--DLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQ-YRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYE--PEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAE-IIQRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMIN--PRLEWPNDGLTTACTAMAMLLFKEQNIWKENDP--NNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKL-----QVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPR---NPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGK-----IHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYNRSIYQTVELYSNHICNVFGSYQC 4816
            W+W T      G   F +   +P   TSWV+  ++++   G ++ + P+     + F++   +P   + GE + + + +FNY D   +A + +  SDQ Y   +     + +A D      +     V + A   K + F I    +  N    T+ I A + +  +  ++++K+   GVT + +    ++L  + +++         QS     P E     VP S+  + S+VGD++GPT    LQ +D    +RM +G  E     F  NI +LKY+        +V      +     Q  L+Y     G +S F +S    +T  TA+ + +           Y  I   +I    +F+ ++Q + G F                          D   Q  + +T+ V+L+  +   + P  +  I++A  ++      + D +S  I   AL      A   +   +I  + + AR +    ++S +      TE T     + +  PR    ND   T+   +A+L         E DP    +  I +L   RN   GF+ST D+ + L+    F+        YK       +++  SS G  + T  +   N  V     +P      +F   A+GTG  ++QL    R   A + K P     P+  D P Q                +LI+D+C  ++         ++ M V ++ LP+G+V  +  L +      Q + R  R          + ++ +  P    C+   A +   VA   +    S Y+YY+  R     YQ      + +C++     C
Sbjct:  670 WMWTTSDNGSVGEEEFTLTKKIPDTITSWVVTGFSLNPTSGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYLDKTLDADVVMDNSDQEYEFTEATNEVLEKAIDEVRRVKR-----VTIPANSGKSVSFMI----RPKNVGFTTLKITATSALAGDAIHQKLKVEPEGVTLFENRAVFINLKDQPEMS---------QSLDADIPNE----VVPQSEFIEFSVVGDLLGPT----LQNLDNL--VRMPYGCGEQNMVNFVPNILVLKYLEVTGRKLPSVESKARKFLEIGYQRELTY-KHDDGSYSAFGKSDASGSTWLTAYVMRSFHQAG-----TYTDIDPKVITAGLDFLVSKQKESGEF-------------------PEVGKLFDNANQNPLALTSFVLLAFFENHELIPKYQSAIKKAVRYVAEEADKTDDQYSLAIAAVALQ----LAKHPQSEKVIAKLESVARKENDRMWWSKA------TESTGEDGRVFHWKPR---SNDVEITSYVLLALL---------EKDPAEKALPIIKWLISQRNSNGGFSSTQDTVIGLQALTKFA--------YKTGSGSGTMDIEFSSAGESKNTIKVNPENSLVLQTHDLPKSTRKVDF--TAKGTGSAMVQLSY--RYNLAEKEKKPSFKVTPTVKDTPNQ----------------LLIVDVCAEYVPLEDADKDKDSNMAVMEIALPSGFVGDSTSLGKI-----QAVDRVKRVETKNSDSTVVVYFDSLTPGDVRCLPLEASKAHAVAK-QKPASVSLYDYYDTERKATEYYQV----KSSLCDICEGADC 1393          

HSP 2 Score: 75.0998 bits (183), Expect = 6.307e-13
Identity = 65/247 (26.32%), Postives = 113/247 (45.75%), Query Frame = 2
Query:  221 YIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRNDFEYIHETTTFKTE--GTQIMRLEIPTRVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMP--VFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELE-KWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLE 946
            Y ++ P  +R    Y   V++ K   P+  I++S+    +   +ET   +     TQ +  E+P       +Y L   G     S ++F N T+L +  K+ SVF+Q  K  Y     VQFR++ L  N  P  +   I+ I        I  + ++      G++  +  L++Q   G W I V ++   +  KSF V +Y LP+F+V +  P  +      +   I+A  T G  V+G A++++E
Sbjct:   23 YSVVGPGTLRSNSKYNVVVSVHKADGPS-QIKVSLNGPSY---NETKQIELPPMSTQNVEFEVPKLAT--GNYNLSAEGV----SGVVFKNSTKLNYADKKPSVFVQTDKATYKPADLVQFRILFLDENTRPAKIEKPISVIIIDGAQNRI--KQLSDVKLTKGVFSGELQLSEQPVLGTWKISVSVDGDNRETKSFEVDKYVLPKFEVIVDTPKAVVIADKVIKATIRAKYTYGKPVKGKATVSME 257          
BLAST of CD109 antigen vs. Ensembl Zebrafish
Match: cpamd8 (C3 and PZP like alpha-2-macroglobulin domain containing 8 [Source:ZFIN;Acc:ZDB-GENE-050208-428])

HSP 1 Score: 134.035 bits (336), Expect = 1.011e-30
Identity = 163/793 (20.55%), Postives = 307/793 (38.71%), Query Frame = 2
Query:  434 YLEVVGSVTDN-SAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSL-INQGSLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSG--VIRLSFVPTQS----LTCPTYRLRA-----EYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTN-KIFVQVVAGGNIV-----YVDTIVMQNSVKTRTFSISI----------------------------SRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYE--QNFQQPIEQD--WLYNLEYIIRTYLPSP---SFGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKP-NGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEV 2647
            +L+V G+   N    IF N T +  + K  +VFIQ  KPVY   Q V   V  + P+L P    + A   ++P G  +  W +  +   GI  M FPL+DQ   G W + VE++     KSF V++Y +PRF++ I  P  + D        ++A  T G  V G  ++ + +      R      +  +  I   +G A F   + ++  + +        ++WV     D   + +      T ++     +K+     + FKP + +   + V  PDG+         V+V+     + K + +++ +V  +G     +  +PT +    L      +       +YL +   + SW        YS S  ++Q+   +    + + A   +  + P N  +  ++ + GNIV     + ++   +    T TF  +I                            +  MAP++R++ YYV+ +GE V+DSL         N +++ ++  + +    + +    E GS + +  +   +Y       L    +  ++  ++    F  P ++   W   L    R     P       D       +GL++ +D    MV+  +  +  +   +A+P +        +      GT                     + +N  R F           W+W  + +   NG     +D+P   T+WV  A  +  EKG  +  R A     + F++   +P     GEQ  V +T++NY    +E  ++V
Sbjct:   11 HLKVWGNCQLNEGGYIFQNHTTVTIDSKGTTVFIQTDKPVYKPQQKVLINVYAVTPDLKPTSEKLEAY-IVDPRGSHIVHWKDLKSICCGIVNMSFPLSDQPVFGEWLVFVEMQGHTYNKSFEVQKYVMPRFELIIVPPPYIRDLNSCEQVTVKARYTFGKPVSGKLTVNMTVNGVGYYRHEVGHPVVKSMEI---KGSASFSLCVKDMMPIEVTDHFRGAVNMWVTVNSVDGGQQTMFDD--STPVHKQLIDIKYSKDTRKQFKPGLPYKGMIEVTYPDGSPA-----EGVHVRVKAELTPKDNVYTSELVSKNGKATFEIPSIPTAAQYVWLESKVTAIDGKPAGDQYLPNYLSITSW--------YSPSKCHIQLLSPSAPLMIGQEAEIFLKSTCPCNFTLHYEIASRGNIVQSGQRHANSTTHREKRATITFDTNIHTTAKPQQDSDSSQAEMDSCVSVLHFNVTPPMAPLSRLLVYYVRENGEGVTDSLQLPVQSRFENEISVSLSTNESMPGSPISLKVKAESGSCVCVASVDKSMYLLKPGFQLTPEKVFKDLAEFDVSDAFGVPKDEGHFWWPGLSSRRRRSSVFPWHWDITKDARFAFTETGLVVMTD----MVSLNHRQSGGMYTDEAVPAFQPHTSTLVAAMHSRSGT---------------------RAENRRRTF-------FPETWIWHCFNVSSLNGEAELHLDIPDSITTWVTEAIGLSAEKGLGLA-RTAELRTFKPFFIDFTLPYSIVRGEQTKVPLTVYNYLPTCSEVHVKV 751          

HSP 2 Score: 111.309 bits (277), Expect = 8.275e-24
Identity = 148/613 (24.14%), Postives = 259/613 (42.25%), Query Frame = 2
Query: 3029 VPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYI-PENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEI-IQRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSG----KISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTM---SSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDAVR---------LKNPRNPSSVDLPFQTFDINCRAKFSGKNSSIL------------------------IMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLP-QTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPG 4738
            VP S+ A  +++GD++GPT    L  +D  K LR+  G  E     F  N+++LKY+++    S+ V     +Y  +  Q  L+Y     G +S F E  +  +   TAF L +      A    +I+I PE L    +  I NQ+      +GSF  +  + +K L   I             +I +TA V++++ +    +    + + +A AF++ +  ++ D ++  +  YAL+    S Y+     +++ M  T      +    +  +D D    +++  +   +     +           TA  +L +        +  + +  + +L++ RN + GF+ST D+ VAL+    ++        Y   V +T+   S+  +++ET+ +Q+ N  +     IP+    G FV  A+G G  LMQ+DV   V D V          LK PR    + LP  +  I+ R +    N S L                         +++C  WL   S      + M V +V L +G+ A  + L R +      L RY      K+ FY  ++P Q  TCV F A R + V   +   +   Y+YYEP 
Sbjct: 1024 VPGSERATAAMIGDVMGPT----LNNLD--KLLRLPFGCGEQNMIHFAPNVFVLKYLQKTHQLSLEVEAEATDYLLQGYQRQLTY-KRQDGSYSAFGERDSSGSMWLTAFVLKSF-----AQSRGFIFIDPEELRAAKSWLISNQKD-----EGSFPAMGRILNKDLQGGI-----------HGKISLTAYVVVALMETGITTEEENVAVAKAKAFLESNTYSADDPYTTALSAYALTLL-RSPYAPLALRRLNHMAITQDGFTHWSLTGRTETDEDTFMGFSDGLSQSVVSAEVEM-----------TAYGLLTYTLLG----DVASALPVVKWLSQQRNALGGFSSTQDTCVALQALSEYAILS-----YVGGVNLTISLASTNLDFQETFELQWDNKKILQKAVIPS-IPTGLFV-SAKGEGCCLMQIDVSYNVPDPVAKPAFQLKVDLKEPRQEQHI-LP-SSRHISPRTRSRADNRSELTRKRRAPVDDEDPAGHQDHLDYRVTLEVCTRWLHVGS------SNMAVLEVPLLSGFRADIESLERLLLDKRVGLKRY-EVDGRKVLFYFDEIPSQCMTCVAFNAVREYIVGKTAPVPV-KVYDYYEPA 1575          
BLAST of CD109 antigen vs. Ensembl Zebrafish
Match: cd109 (CD109 molecule [Source:ZFIN;Acc:ZDB-GENE-120215-253])

HSP 1 Score: 106.686 bits (265), Expect = 2.098e-22
Identity = 156/649 (24.04%), Postives = 266/649 (40.99%), Query Frame = 2
Query: 2375 WLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNF--IYNQQIKGGIFDGSF-EPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILS-ISDKKAVSPNAEIIQRATAFIDRHLINSIDL-FSQIIGTYALSKSGTSAYSGKISTMITTIMNNARY-DGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLV-AQGTGRLLMQLDV 4300
            W+W    +  +    F + +P   TSW   A  +    G  I   PA  +  R F+M +++P     GE L + + LFNY D   E ++ V +S  +  V           D    S  +V  ++ L+      + FPI    K        IS+ A +   S+   + + +   G+   + T  L       +  +    +  + +F  P +     VP+S+ A VS VGDI+GP+    +  +D+   + M +G  E     F  N Y+L+Y++  +          ++Y  +  +  LSY     G FS F +S    +T  +AF L   L   +     +I I E L+   T F  + +Q+      DGSF EP      + + T +   L  +       + +TA V+++ + D K  S + + +  A +F+   L   I   +S  +  YALS + +SA      + +TT++N A   DG   + S              G+++ +    W          A  +L      +  E        + +L++ RNH+ G+ ST D+ +AL    S  AT  + E   L + +   S      T+ I  SNY +     +P +   G  + V A+GTG  L QL V
Sbjct:  728 WIWLDANVSDSASAVFSLTVPDSLTSWAAFAIIMSENLGLGI-SAPAELTVFRDFFMSLDLPAFLIRGELLLLEVNLFNYMDVDLEVIVVVAESGMFEFVST---------DSADFSVANVRKVLVLSQN-FTMLLFPI----KATTLGEIPISVKATSVYSSDWLYKTVLVKPEGLQQSF-TQTLF-----LEFLLQQHTLSRKMTFSFPADV----VPNSQRASVSAVGDILGPS----IGNLDSL--IEMPYGCGEQNMIHFAPNTYVLQYLKSTKQAEEQTRRKAMSYMMEAYERELSY-QRVDGSFSAFGDSDESGSTWLSAFVLRCFLQARD-----FISI-EPLVMERTAFWLVAHQES-----DGSFREP-----GQVIHTELQGGLDGS-------VSLTAYVLIALLEDAKYESTHKDSVSLALSFLTSRLAQGISSNYSLSLVAYALSLAKSSA----APSALTTLLNRALVIDGVPTWRS-------------PGSVLYD---SWQPRSADIEIAAYVLLTMHSLRLMDE----GFALMKWLSQQRNHLGGYGSTQDTVMALHAL-SVYATFSSAESMDLTIRVNEGS--GTVATFSIDKSNYLLQQSHDLPIESKDGVDIEVEAEGTGFALFQLTV 1294          

HSP 2 Score: 105.916 bits (263), Expect = 2.893e-22
Identity = 162/674 (24.04%), Postives = 275/674 (40.80%), Query Frame = 2
Query:  218 SYIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRNDFEYIHETTTFKTEGTQIMRLEIPTRVAPP---DD------YYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKL--SDQGFGV------YGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSLINQGS---------LAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTA---------------------FLSVYQ--------------PDGTKTV-----TTINRNVN---VKAYCIDSVKTDEFS--------NLIVPDSGVIRLSFVPTQSLTCPTYRLRAEYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTNKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYVKTDGEVVSDSL--TFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQNFQQ 2002
            SY+I   + +R G     SVT++      +T R++  +         +T     ++++ L       PP   DD      Y L V G     + ++FSN T + F+P+  S+FIQ  K  Y  GQTV+FRV+ + P+  P  G  T I   +P G ++++W+    S  G+   +  ++     G+W I   +      ++F V  Y LPRF+V + +P  L   D   G       YG   +      FV G   I +        R+    ++         EG A+  F M +  +  N  S         + F DV VN T  +S T L+    A   I ++   ++FL       KP+MTFTA                     +L+V Q              P G + +     T+   N +   +  + ++S     F+        N+ +P +    +SF    S +  T  L A + +    L     Q    Y S S +Y+Q+   +E P+V     F ++ S+   KI   V +   +V   T      V++ +FS++     AP A V+ YY   DGE+V+D+L  +F   + N  +V    +R +     ++ ++   EPGS L + V+     +   DN L +  +++E  +Y +    
Sbjct:   30 SYLISVSEVLRCGVPTTLSVTVLSDYPINVTARLTHGKTSVA--QTQSTVPAGSSRLLSL-------PPVFYDDMTYWYPYQLNVEG--FSGTHLVFSNSTSMVFSPRCMSIFIQTDKNYYQPGQTVKFRVVSVTPDGKPYSGR-TDIFIRDPRGNMIRQWL-AVDSFLGVISKELNISQNPPLGSWKITAGVNDVIHERAFTVDYYVLPRFEVKLDVPSVLYCEDTLMGTVTAKYFYGKPVSGFMDVRFVHGFNGIEM--------RYDHTEMI---------EGSAEITFDMKDFSTRFNDYSYSYYDGYRPIEFIDVNVNIT--ESATGLMYNSSARVSIVTEKYKLEFL-QYPHIVKPSMTFTAKLKLSLYDQRPLSAEDQIESVYLAVTQHKLSPWTWMWSDGGPLGPRMMNNTPSTSFPPNSDGGPLGPHMMNSTPPTSFTPIYDLPVQNIELPVTADGLMSFQIHLSDSVATLDLEARFKDTVQHL-----QLYRSYSSPSKSYIQLHRDSE-PQVGRSLNFTLESSFNLTKIHYLVTSRAGVVDAGT------VQSSSFSLNTDHLWAPQACVMVYYTLPDGEIVNDALHVSFTKVLRNTVSVRWSQDRAEPAESVSLSVS-VSEPGSVLGILVVDKATLNSAEDNGLSEKTVLEEFLSYSREMTH 657          
BLAST of CD109 antigen vs. Ensembl Zebrafish
Match: cpamd8 (C3 and PZP like alpha-2-macroglobulin domain containing 8 [Source:ZFIN;Acc:ZDB-GENE-050208-428])

HSP 1 Score: 94.7449 bits (234), Expect = 2.919e-19
Identity = 89/360 (24.72%), Postives = 156/360 (43.33%), Query Frame = 2
Query:  218 SYIILAPKRIRPGQLYQTSVTIVKLLYPT-LTIRMSIKRNDFEYIHETTTFKTEGTQIMRLEIPTRVAPPDDYYLEVVGSVTDN-SAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQ-----TVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTA-PLLQINRTINYFEGKADFLFTMDELRSLINQGSLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGT 1273
             Y+I AP   R G     SVT+  ++  T + +++S+K     + H T   + +GT  +++++P+ +      +L+V G+   N    IF N T +  + K  +VFIQ  KPVY   Q     T +     LY  L      IT +   +P G  +  W +  +   GI  M FPL+DQ   G W + VE++     KSF V++Y +PRF++ I  P  + D        ++A  T G  V G  ++ + +      R     P+++ + + +        +   D  R  +N        +WV     D   + +      T ++     +K+     + FKP + +   + V  PDG+
Sbjct:   77 GYLIAAPSVFRAGVEEAVSVTLFNMVEDTRVQLQLSVKGEIVAHSHGTV--RDKGT--IKIKVPSDLR--GQAHLKVWGNCQLNEGGYIFQNHTTVTIDSKGTTVFIQTDKPVYKPQQKDLSKTNKQECDYLYHKLF----KITTLFTQDPRGSHIVHWKDLKSICCGIVNMSFPLSDQPVFGEWLVFVEMQGHTYNKSFEVQKYVMPRFELIIVPPPYIRDLNSCEQVTVKARYTFGKPVSGKLTVNMTVNGVGYYRHEVGHPVIKGSASFSLCVKDMMPIEVTDHFRGAVN--------MWVTVNSVDGGQQTMFDD--STPVHKQLIDIKYSKDTRKQFKPGLPYKGMIEVTYPDGS 416          
BLAST of CD109 antigen vs. Ensembl Zebrafish
Match: c4 (complement component 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5697])

HSP 1 Score: 84.7297 bits (208), Expect = 9.547e-16
Identity = 160/783 (20.43%), Postives = 295/783 (37.68%), Query Frame = 2
Query:  482 SNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKS---FHVKEYWLPRFDVNI--TLPVK-LSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSL---INQGSLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDS------GVIRLSF-VPTQSLTCPTYRLRAEYLEDGNRLISWSEQRLFKYY--SQSGAYMQITMATEYPRVNEYAVFQIDMSYPTNK-----IFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYV---KTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDT-VEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQNFQQPIEQDWLYNLEYIIRTYLPSPSFGADTNTTMNSSGL-IIFSDANYTMVNFYNTCN-ETVDKSQALPCY-------------------------STTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPK-----------------NMLRNFDMLY-RHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNY 2614
            + +  +  + K   +F+Q  KP+Y+ G+ V++R+  L   ++P+   +  +Q  N  G IV    N    +  I +    + +    G W I     K+    +   F VKEY LP F+V I  + P   L  + F     I A  T G  V G A +   + D   ++     L    + I   +G A       +L++    I QG +    +++  +V D  + ++    + +        V  L      F P   F+   +   PDG       NR  N+K     ++  D  S  I+ +       G + +SF +P Q+           + E G++++  S+ ++      ++  +Y+ + +  ++ +  E    ++    P         +  V + G IV +  +         T ++ ++ DM P  R+VAYY     +   VV+DS+  + ++ ++    I +N   ++   T  E+     P + +AL  +   +Y     N L    + D M +Y+                        S   G D++  +  +GL  I + A  T     + CN +T ++ +  P Y                         S     C  R +R   +  C     E  C E       + K                  ++ N D++Y R++   +W+W        G I   V  P   T+W + A  I   KGF I E P   +  + F++ V +P   +  EQL V+  ++NY
Sbjct:  115 ARKANIYLSTKRGYIFVQTDKPIYNPGENVKYRIFILDNYMLPIQDEL-HVQITNSKGLIV---YNRVLIINQILDKTITIPEVEQTGKWKIITSFHKFPESTTTVEFEVKEYVLPTFEVKIEASQPYHILMSESFPFN--ISARYTYGKGVNGIAYVRFGLVD---EKHNKIYLPGTEKQITVEDGTAGTAVLTKDLKTASQNITQGYIEGYYIYIAVSVLDKASGMLEEAESSSVKIVTSPYVVDLSKTKTYFTPGGVFSVLATATYPDG-------NRAPNLKFTA--TITIDGSSEQILQNESWGNEMGDVAMSFQIPPQAKNLAI----TVFAEGGDQVVIRSDNKMTASAITAEEQSYLSLEVEKQFLQAGEDLKARLRDITPEGAAKPTFFYFMVWSKGQIVQMGRV---PRTAFTTVNVKVNVDMVPSFRLVAYYFTGSASKESVVADSV--WVDVKDVCKGKIEINPLAEIKPATQFEVTVETNPKTKVALVAVDSAVYILNK-NKLSLQKMFDYMNSYD---------------------LACSVGGGEDSSAVLQRAGLTFICNCALKTPTALEHKCNKKTTNRVRRAPDYVAKYNAVVNSFKNQDRKCCLDGVRPSKMQTSCVDRLKRVKESESCRKAFKE--CCEAADERRKREKFEKRKTSLGRVVGDSFDEIVINEDLIYIRNYFPQSWMWTVIESDNKGLIRHEVVAPDSITTWEVQAVGISPTKGFCIAE-PKPLTVFKDFFLSVNLPYSVKRNEQLQVKAVVYNY 845          
BLAST of CD109 antigen vs. Ensembl Zebrafish
Match: c4 (complement component 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5697])

HSP 1 Score: 84.7297 bits (208), Expect = 1.134e-15
Identity = 152/756 (20.11%), Postives = 287/756 (37.96%), Query Frame = 2
Query:  482 SNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKS---FHVKEYWLPRFDVNI--TLPVK-LSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSL---INQGSLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDS------GVIRLSF-VPTQSLTCPTYRLRAEYLEDGNRLISWSEQRLFKYY--SQSGAYMQITMATEYPRVNEYAVFQIDMSYPTNK-----IFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYV---KTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDT-VEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQNFQQPIEQDWLYNLEYIIRTYLPSPSFGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPK-----------------NMLRNFDMLY-RHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNY 2614
            + +  +  + K   +F+Q  KP+Y+ G+ V++R+  L   ++P+   +  +Q  N  G IV    N    +  I +    + +    G W I     K+    +   F VKEY LP F+V I  + P   L  + F     I A  T G  V G A +   + D   ++     L    + I   +G A       +L++    I QG +    +++  +V D  + ++    + +        V  L      F P   F+   +   PDG       NR  N+K     ++  D  S  I+ +       G + +SF +P Q+           + E G++++  S+ ++      ++  +Y+ + +  ++ +  E    ++    P         +  V + G IV +  +         T ++ ++ DM P  R+VAYY     +   VV+DS+  + ++ ++    I +N   ++   T  E+     P + +AL  +   +Y    + +    +  + +  Y     Q     W +   Y + +     S   +  TT        +      +VN +   +         P  S     C  R +R   +  C     E  C E       + K                  ++ N D++Y R++   +W+W        G I   V  P   T+W + A  I   KGF I E P   +  + F++ V +P   +  EQL V+  ++NY
Sbjct:  115 ARKANIYLSTKRGYIFVQTDKPIYNPGENVKYRIFILDNYMLPIQDEL-HVQITNSKGLIV---YNRVLIINQILDKTITIPEVEQTGKWKIITSFHKFPESTTTVEFEVKEYVLPTFEVKIEASQPYHILMSESFPFN--ISARYTYGKGVNGIAYVRFGLVD---EKHNKIYLPGTEKQITVEDGTAGTAVLTKDLKTASQNITQGYIEGYYIYIAVSVLDKASGMLEEAESSSVKIVTSPYVVDLSKTKTYFTPGGVFSVLATATYPDG-------NRAPNLKFTA--TITIDGSSEQILQNESWGNEMGDVAMSFQIPPQAKNLAI----TVFAEGGDQVVIRSDNKMTASAITAEEQSYLSLEVEKQFLQAGEDLKARLRDITPEGAAKPTFFYFMVWSKGQIVQMGRV---PRTAFTTVNVKVNVDMVPSFRLVAYYFTGSASKESVVADSV--WVDVKDVCKGKIEINPLAEIKPATQFEVTVETNPKTKVALVAVDSAVYILNKNKLSLQKSFCEYLVCYASAILQ-----WTF---YCLMSLQCDVSHKCNKKTTNRVRRAPDYVAKYNAVVNSFKNQDRKCCLDGVRP--SKMQTSCVDRLKRVKESESCRKAFKE--CCEAADERRKREKFEKRKTSLGRVVGDSFDEIVINEDLIYIRNYFPQSWMWTVIESDNKGLIRHEVVAPDSITTWEVQAVGISPTKGFCIAE-PKPLTVFKDFFLSVNLPYSVKRNEQLQVKAVVYNY 830          
BLAST of CD109 antigen vs. Ensembl Xenopus
Match: c4a (complement component 4A (Rodgers blood group) [Source:NCBI gene;Acc:100135012])

HSP 1 Score: 98.9821 bits (245), Expect = 6.866e-20
Identity = 218/1025 (21.27%), Postives = 387/1025 (37.76%), Query Frame = 2
Query: 2060 SPSFGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYS---------------------------RAERCDGTN------QCINWVDELGCPET-----------TANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAY-TFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKI-AKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTI---------NTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNL-LAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSI-SDKKAVSPNAEIIQRATAFIDRHLINSIDL----FSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLF-----YSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPR----------NPSSVDL--------------------PFQTFDINCRAK----FSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYNRSIYQTVELYSNHICNVFGSYQCPYSPYF 4834
            SP  G D    +  +GL   S A Y+ +N    C     K +A+   + T ++ YS                           RA R   T+       C  + + L    T           T N     ++     D+  R +   +WLW+T  +  NG I+  V +P   T+W I A  +  EKGF I E P      + F++ + VP   +  EQ+ +R  L+NY D   E  + ++Q++           I      E+  +    T+   +A    F+  PI         +N  +S+ A  T + S+   + +KI   G +     + ++D T              RQS    EE     +PD    + + +  D    T +  L      K +R+ +G AE         +Y L+Y+  D T   N+           N      +ILQ     F  T G +  +    +  +T  TAF +  L L  N      YI +    I+ + +++   Q   G F    E + ++    L        S  DAE    + ITA V +++     A+S +   ++ + +    +L   +D+    +S  + TYAL+          +++  + + +NA      K  S +   P      N   L   P    P   L    T+  +L+     + + N  +  +  T+L++ +N+  GF ST D+ +AL         +F   D   E+    +E   S +   R+   +Q    ++G            +F +   G G+ ++ +    R+++ ++++N              +SVD                     P    D+  R++    F+ +    L+ ++C  W   +S ++   +GM + D+ + +G   + D+L++  ES  Q +  Y  + PG++  Y  K+P T+ CVTF A +   V+ V +      Y++YEP               N  C VF  Y  P  P F
Sbjct:  620 SPGGGKDFINVLTDAGLAFVSSAGYSQINELG-CRVHQRKKRAIDFQALTQQKAYSYPTTELQRCCQHGMMLPPRKMSRVCTQRAARVPDTSCRGVFLACCEYAENLRKQMTLEKRKTQGFGRTQNVDEFDEDFADESDIQMRSFFPESWLWRTVKVY-NGLISENVYVPDSITTWEIQAVGMSPEKGFCIAE-PLKVKVFKDFHIYLRVPYSVKRFEQMELRPILYNYNDKDLEVKVYMEQTED----------ICSPGSGESKPHIKQVTVAANSALPVPFVVVPI-------GKSNPVVSVVALATSLVSDAVKKSMKIVKEGASVLEEKSYIIDPTDIT-----------RQSIDFEEELPSNIIPDGDFHSSIKVTMDSPMNTINNSLGADGISKLIRVPYGCAEQTMISTSPGVYALRYL--DHTEKWNLLPPDRKDQGLENMRQGYLRILQ-----FKKTDGSYGAWVSRAS--STWLTAFVVKVLSLCRN------YIDVNVEDIRRSVHYLTTMQTDKGAFQ---EKLTVIHQDML-----GGASTIDAE----VSITAYVTVALYHSLDALSEDNVAVKSSISKAVDYLRTKLDIVKHPYSLALTTYALT----------LTSKDSILKDNA----NNKLMSQAQGDP------NKKELYFGP----PGTALAVETTSYVLLI----TLLRGNIRDAEKMYTWLSEQQNYGGGFRSTQDTVMALEALSEYWIRTFKQDDNTLEIEVNSLEKQHSQKFRLRKEDSLQEELRSMGT-----------KFNVKVSGKGKGILTV---MRMYNIIQMQNTSCTELGMDVTVTDASVDAGPDDQDDYDYDEEMADEPRDPIVWHDLRHRSRREVTFAKEKEVKLLYEVC-LWKK-SSKVHL--SGMAIVDITMLSGIQPVIDDLKKLAESSEQYISHY-EYQPGRLLLYFDKVPDTRDCVTFEAVQTVKVS-VLQPASAVLYDFYEP---------------NIKCTVF--YGAPSKPNF 1521          
BLAST of CD109 antigen vs. Ensembl Xenopus
Match: tubal3.1 (tubulin alpha like 3, gene 1 [Source:Xenbase;Acc:XB-GENE-490055])

HSP 1 Score: 97.0561 bits (240), Expect = 2.442e-19
Identity = 113/485 (23.30%), Postives = 203/485 (41.86%), Query Frame = 2
Query:  410 RVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKS-RKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSLINQGSLAFKDVWVNATVFDSFTELVRTGWAYTFIYS-----DDTAVKFLGGLVRPFKPNMTFTAF--LSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVIRLSFVPTQSLTCPTYRLRAEYLE----DGNRLISWS----EQRLFKYYSQSGAYMQI-----TMATE-YPRVNEYAVFQID-MSYPTNKIFVQVVAGGN----IVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYVKTDGEVVSDSLTF 1783
            ++  P+  YL ++    D  ++ F++R  +   P +  VF+Q  KP+Y  GQ VQFR++ L  N  PV          +P G  + +W+N     G   E  F L+ + T G +++ VE EK      SF V+EY LP+++V + LP  L+  G  V   +    T G               P L R       + +   N  +G+ D +      R+ +N       DV VN  VF    ++ R G+    I S     D T V+  G      K  +   +F  L  +   G      + R++ ++   +                G    S + T S    + R++A Y       G+R ++ S     + +  +YS+S ++++I     T+  +   +VN + +   + +    N +F  +V   +    +VY+      N +    F + +  +++P A+++ Y V   GEV++DS+T 
Sbjct:   93 KLDAPEVAYLTLL---VDGDSLHFTSRRSVLIKPVQNLVFVQTDKPIYKPGQKVQFRIVSLDENFYPV-------SEKDPQGNRISQWLNVELKKGLTQEF-FQLSPEPTLGTYSLIVEREKGAPVTHSFSVEEYVLPKYEVQVKLPATLTILGQEVPVTVCGRYTYG--------------KPVLGRINVRVCRKFSDRYNLCQGEEDGVCEEISQRADLNG---CISDV-VNTKVF----QMRRAGYEMKIIASAKITEDGTGVELTGEGSSEIKSTLATVSFRHLDSHYKKGIPLYGQVGRSLGLETVVVYVGNDGTNFTYTTGQDGTAEFS-IDTSSFQLSSVRIKASYKTGDYCSGHRWLTASYEEDTRHVNHFYSRSKSFLKIQPIHRTLECQIVEKVNVHYILTPEGVGEARNAVFHYLVGSHSLCSPLVYLHLFHHWNFL----FDLPVGTNVSPSAKILVYLVLESGEVIADSITL 539          
BLAST of CD109 antigen vs. Ensembl Xenopus
Match: tubal3.1 (tubulin alpha like 3, gene 1 [Source:Xenbase;Acc:XB-GENE-490055])

HSP 1 Score: 92.8189 bits (229), Expect = 3.957e-18
Identity = 122/493 (24.75%), Postives = 207/493 (41.99%), Query Frame = 2
Query:  410 RVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKS-RKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSLINQGSLAFKDVWVNATVFDSFTELVRTGWAYTFIYS-----DDTAVKFLGGLVRPFKPNMTFTAFL---SVYQPD----GTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVIRLSF---VPTQSLT-----CPTYR-LRAEYLEDGNRLISWSEQRLFKYYSQSGAYMQI-----TMATE-YPRVNEYAVFQID-MSYPTNKIF-VQVVAGGNIVY-----VDTIVMQNSVKTRTFSISISRDMAPVARVVAYYVKTDGEVVSDSLTF 1783
            ++  P+  YL ++    D  ++ F++R  +   P +  VF+Q  KP+Y  GQ VQFR++ L  N  PV          +P G  + +W+N     G   E  F L+ + T G +++ VE EK      SF V+EY LP+++V + LP  L+  G  V   +    T G               P L R       + +   N  +G+ D +      R+ +N       DV VN  VF    ++ R G+    I S     D T V+  G      K  +   +F    S Y+      G   V  +  +     Y      T EFS     D+ ++ L +   +  + L+     C  +R L A Y ED         + +  +YS+S ++++I     T+  +   +VN + +   + +    N +F   V+A G IV      +  I  Q +     F + +  +++P A+++ Y V   GEV++DS+T 
Sbjct:    4 KLDAPEVAYLTLL---VDGDSLHFTSRRSVLIKPVQNLVFVQTDKPIYKPGQKVQFRIVSLDENFYPV-------SEKDPQGNRISQWLNVELKKGLTQEF-FQLSPEPTLGTYSLIVEREKGAPVTHSFSVEEYVLPKYEVQVKLPATLTILGQEVPVTVCGRYTYG--------------KPVLGRINVRVCRKFSDRYNLCQGEEDGVCEEISQRADLNG---CISDV-VNTKVF----QMRRAGYEMKIIASAKITEDGTGVELTGEGSSEIKSTLATVSFRHLDSHYKKGIPLYGQTVVVYVGNDGTNFTYTTGQDGTAEFS----IDTRIMVLLWFFSIKHKKLSSTGDYCSGHRWLTASYEED--------TRHVNHFYSRSKSFLKIQPIHRTLECQIVEKVNVHYILTPEGVGEARNAVFHYLVMAKGGIVENGKHTLALIPNQEAQGNFLFDLPVGTNVSPSAKILVYLVLESGEVIADSITL 451          
BLAST of CD109 antigen vs. Ensembl Xenopus
Match: bcl9l (B cell CLL/lymphoma 9 like [Source:Xenbase;Acc:XB-GENE-921499])

HSP 1 Score: 92.0485 bits (227), Expect = 8.441e-18
Identity = 156/747 (20.88%), Postives = 298/747 (39.89%), Query Frame = 2
Query: 2519 FSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTS---KAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEIIQRATAFIDRHLINSI-DLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSAT-DRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPL---LRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEP 4735
                + F++ + +P     GEQ  + + +FNY    TE  + +++SD +         I  AF   + S +SV     + + E K +FFPI    K  +     I++ A + + S+   +++++   GV   +    L+DL     K+     NF        + P+      V  S+ A +++VGD +G      L        ++M +G  E     F  NI++++Y+ R +  + +V    +++     Q  L Y     G FS F       +T  +AF L   L         +I +   ++     ++   Q K G F   +EP  ++ S+                    I +TA ++ ++ +   +    + I  AT +++  +   I D ++  + TYALS  G S    K +  +  +   A  +GQ +++  S    Q+   T+                     +A A+L +  QN   E     M  + +L++ R+H+ GF+ST D+ +AL+   SF++    N+++  + V+   S   N   T+ I  +N  +     +          + A+GTG  ++Q            LKN        +P +   I+ +  F   +   L+                   GM +  V+L +G+  + + +         P+   ++   +  GKI+ YL  L QT+ C+   A R F V   +++      +YY+P
Sbjct:  471 LEAFQPFFLSLNLPSYVIRGEQFVLEVIVFNYLQKETEVSVTLEKSDAFE--------IQLAFVNASESQQSVS----VPSQEGKIVFFPI----KPIHLGEIPITVKAISALASDAVTQKLQVKAEGVQQSHSQTLLLDLMGNKPKSISQTLNFT-------FPPD-----VVSGSEKAFITVVGDHLG------LSIRSIKSLIQMPYGCGEQNMIRFAPNIFIMEYLSRTKQLNEDVAHKLISFIKNGYQRQLVY-QREDGSFSAFGNKDPFGSTWLSAFVLQCFLKARP-----FILVDPVVLHNTLTWLLKHQRKNGEF---WEPGTVIYSQI------------QGGHHSAITLTAYIMAALIEYPGL--KVKNIPSATDYLESQMDEIISDNYTLSLVTYALSLVGRS----KATEGLDLLNMRAEQEGQLRFWRSSISSCQHPCSTD------------------IVISAYALLSYVVQNRIAEG----MAVMKWLSQQRSHLGGFSSTQDTIIALQAMSSFASVYTINKQILAITVD---SHPLNSTATFQIDSNNRILLQTKQLAVQ-QQMNLTVHAEGTGFAILQFHT------IYNLKN-------SVPGRYKSISSQDAFDLVHLYFLL------------------TGMVLMQVDLLSGFSLVPEGI---------PMKYPIKKVDYNEGKINIYLDSLNQTEVCIDIPATRDFKVG-YTQEAFVHVIDYYDP 1089          

HSP 2 Score: 83.9593 bits (206), Expect = 2.383e-15
Identity = 65/239 (27.20%), Postives = 120/239 (50.21%), Query Frame = 2
Query:  203 LPPMPSYIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRNDFEYIHETTTFKTEGTQIMRLEIPTRVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFV 919
            L  +P ++I +P  IRPG      + +++   P + +   +++++   +   + FK  G  I+ L +P   +    Y L V G   +N  +IF N+T LEF  K FSVFI+ +   Y  GQ V+ R++    ++ P   T+  I  ++P G ++++W+     +G + +  + L+D    G+WTI+V+L        F +    LPRF+V +   +  S +   + G +  N T+ +FV
Sbjct:   48 LHKIPIFLITSPMDIRPGVNLTLGIEMLQESPPLVKVVAQLQKDEHTLLEGESFFK-RGNNILTLCLPLN-SVNGKYELNVKGYSEEN--LIFFNKTSLEFKSKGFSVFIETNSVFYKPGQEVKIRILAFSFHMKPYKSTVD-IYILDPQGNLIEQWLEEEMELGVVSQSLY-LSDNPPLGDWTIKVKLHH---HLYFSIIYLVLPRFEVLLNTTLYHSIKNPHLEGTV-TNVTTSVFV 276          
BLAST of CD109 antigen vs. Ensembl Xenopus
Match: bcl9l (B cell CLL/lymphoma 9 like [Source:Xenbase;Acc:XB-GENE-921499])

HSP 1 Score: 87.0409 bits (214), Expect = 2.418e-16
Identity = 112/557 (20.11%), Postives = 227/557 (40.75%), Query Frame = 2
Query: 2393 WIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTIN-TLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEIIQRATAFIDRHLINSI-DLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTST 4057
            +++    +   + +P + T+W+  AY I    GF ++  P      + F++ + +P     GEQ  + + +FNY    TE  + +++SD +         I  AF   + S +SV     + + E K +FFPI    K  +     I++ A + + S+   +++++   GV   +    L+DL      ++     Q     + P+      V  S+ A +++VGD +G      L        ++M +G  E     F  NI++++Y+ R +  + +   + +L Y  +++      +    G FS F       +T  +AF L   L         +I +   ++     ++   Q K G F   +EP  ++ S+                    I +TA ++ ++ +   +      ++    +++  +   I D ++  + TYALS  G S    K +  +  +   A  +GQ +++  S    Q+   T+                     +A A+L +  QN   E     M  + +L++ R+H+ GF+ST
Sbjct:  488 FLRSTTHMTLDLKVPDVITTWITSAYVISENFGFGMLAPPEQLEAFQPFFLSLNLPSYVIRGEQFVLEVIVFNYLQKETEVSVTLEKSDAFE--------IQLAFVNASESQQSVS----VPSQEGKIVFFPI----KPIHLGEIPITVKAISALASDAVTQKLQVKAEGVQQSHSQTLLLDLMGNKPKSIS----QTLNFTFPPD-----VVSGSEKAFITVVGDHLG------LSIRSIKSLIQMPYGCGEQNMIRFAPNIFIMEYLSRTKQLNEDPYFSFSLGYQRQLV------YQREDGSFSAFGNKDPFGSTWLSAFVLQCFLKARP-----FILVDPVVLHNTLTWLLKHQRKNGEF---WEPGTVIYSQI------------QGGHHSAITLTAYIMAALIEYPGLK-----VKNIPYYLESQMDEIISDNYTLSLVTYALSLVGRS----KATEGLDLLNMRAEQEGQLRFWRSSISSCQHPCSTD------------------IVISAYALLSYVVQNRIAE----GMAVMKWLSQQRSHLGGFSST 956          

HSP 2 Score: 76.2554 bits (186), Expect = 4.656e-13
Identity = 51/188 (27.13%), Postives = 98/188 (52.13%), Query Frame = 2
Query:  212 MPSYIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRNDFEYIHETTTFKTEGTQIMRL-EIPTRVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELE 772
            +P ++I +P  IRPG      + +++   P + +   +++++   +   + FK  G   + L ++P   +    Y L V G   +N  +IF N+T LEF  K FSVFI+ +   Y  GQ V+ R++    ++ P   T+  I  ++P G ++++W+     +G + +  + L+D    G+WTI+V+L 
Sbjct:   23 LPIFLITSPMDIRPGVNLTLGIEMLQESPPLVKVVAQLQKDEHTLLEGESFFKRGGFGTLVLPQLPLN-SVNGKYELNVKGYSEEN--LIFFNKTSLEFKSKGFSVFIETNSVFYKPGQEVKIRILAFSFHMKPYKSTVD-IYILDPQGNLIEQWLEEEMELGVVSQSLY-LSDNPPLGDWTIKVKLH 205          
BLAST of CD109 antigen vs. Ensembl Mouse
Match: Cd109 (CD109 antigen [Source:MGI Symbol;Acc:MGI:2445221])

HSP 1 Score: 147.902 bits (372), Expect = 6.400e-35
Identity = 196/839 (23.36%), Postives = 351/839 (41.84%), Query Frame = 2
Query: 2375 WLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGL-RMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSF-EPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEIIQRATAFIDRHLINSI-DLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRL--EWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWG----EFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPL---LRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYNRSIYQT-VELYSNHICNVFGSYQCPYSPYFNVASST 4852
            W+W   ++       F V +P   TSWV  A+ I  + GF +   PA     + F++ + +P     GE+  + +++ NY     + ++ +++SD + ++      +T      TI  K+V     +       + FPI    K  +     I++ A +   S+   + I +   G+   Y  + L+DLT      V + +  +R SF  P + ++     S+  +++ +GDI+G +       ++    L RM +G  E     F  NIY+L Y+ + +  ++N+    L+Y  +  Q  L Y     G FS F +  +  +T  +AF L   L   EAD+  YI I ++++     ++ N   K   F+G F EP  ++ S+                 +  + +TA ++ S+   K   PN + +Q +  F++      I D ++  I +YALS  G    S K    +  +M  +  +G  +++  S                  P L   W    +     A A+L     ++        +  + +L + RN + GF ST D+ VAL+    FSA           +++T++  G  R    I F      NL  +  + +         + A G+G  + QL+V+  V  +   K  R+  + ++    FD++     +  + S L +++C S LG          GM + +V L +G+ A +D +         PL   L+   +  GK++ YL  + ++Q CV     R + V+N+ RD   S  +YYEP R     Y T V+L S           C  SP  N  S T
Sbjct:  696 WIWLDAYMGSKIYEEFEVTVPDSITSWVASAFVISEDLGFGLTTVPAELQAFQPFFLFLNLPYSVIRGEEFALEVSIVNYLKDTIKVVILIEESDSFDIL------MTSNDTNGTIYRKTVQ----VPRDNGVTLVFPI----KPTHLGEIPITVTAASPTASDAVTQTIVVKPEGIEKSYSKSVLLDLTDS---NVESKQQSMRFSF--PPDTVI----GSERVQITAIGDILGSS-------INGLSSLIRMPYGCGEQNMIYFAPNIYILDYLTKQKQLTVNLKEKALSYMRQGYQRELLY-QREDGSFSAFGDIDSSGSTWLSAFVLRCFL---EADY--YIDIDQDVLHRTYTWL-NAHKK---FNGEFWEPGRVIHSEL------------QGGTKSPVTLTAYIVTSVLGYKKYQPNID-VQDSIKFLEFEFSRGISDNYTLAIISYALSTVG----SPKAEEALNLLMQRSEKEGDTQFWLSS-----------------GPALSGSWQPRSVDIEIAAYALLAHTLHHV-----SEGIPVMRWLIQQRNSLGGFVSTQDTVVALKALSEFSALVHKE---NTDIQLTVTGPGIPR---SIHF-RIDSQNLFLLHQEELHALDPITVNVSAHGSGFAICQLNVDYNVKGSGSSKRRRSTENQEV----FDLDVIVN-NEDDISHLNLNVCTSHLG------SERTGMVLMEVNLLSGFSASSDSI---------PLSETLKKVEYDNGKLNLYLDSVNESQFCVNIPTVRDYKVSNI-RDGSVSVMDYYEPRRQAVRSYNTQVKLSS-----------CYLSPDTNCKSHT 1416          

HSP 2 Score: 140.969 bits (354), Expect = 6.808e-33
Identity = 140/551 (25.41%), Postives = 239/551 (43.38%), Query Frame = 2
Query:  209 PMPSYIILAPKRIRPGQLYQTSVTIVKLLYPTLTIR---MSIKRNDFEYIHETTTFKTEGTQIMRLEIPTRVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSLIN--------QGSLAFKD------VWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTK-----------TVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVIRLSFVPTQSLTCPTYRLRAEYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTNKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYVKTDGEVVSDSL 1777
            P   +++ AP  IRPG      V +++   P + ++     I  N    I E       G     L +P       D   E+  +    + I+FSNRTRL F  K  SV IQ  K  Y   Q V+FRV+ L  +L P + T   I   +P   ++++W +    +G +    F L+     G+W+I+V++   +  +SF V EY LP+F+V +  P+  S +   + G + A  T G  V+G+ S+T         +       +IN       G A+F F   E++ ++N        +GS    D        + ATV +S T + R      F    D  ++         KP++ FTA + V + DG +           TV T  +N + ++     +   +  N  +P +G+I++ F P  S++    +L+A +L DG   ++        + S S  Y+Q+    EY +V       +  +     +   V++ G       +V      +RTFS++     AP A ++AYY+  DGE+++D L
Sbjct:   23 PGSRFLVTAPGIIRPGANVTIGVDLLENSPPQVLVKAQVFKIASNKSRSILEAEGVFHRG-HFKTLVLPALPLSSADKIYELHINGQSENEIVFSNRTRLTFESKSISVLIQTDKAFYKPKQEVKFRVLTLCSDLKP-YRTSVDIFIKDPKSNVIQQWFSQKGDLG-VVSKTFQLSSNPIFGDWSIQVQVNDQQYYQSFQVLEYVLPKFEVTVQTPLYCSLKSKQLNGSVIAKYTYGKPVKGSLSLTFLPLSFWGKKKNITKSFEIN-------GFANFSFDNYEMKKVMNLKPLTDVSEGSYENVDPSFPGPAEIIATVTESLTGISRMASTNVFFKQHDYIIEIF-DYTTVLKPSLNFTATVKVSRSDGNQLTPEEIENDLVTVVTQRKNNHPESQRDQEMDYIQTVNYTIPQNGIIKIEF-PVMSISG-ELQLKAYFL-DGTSSVTVHSM----FTSPSKTYIQLKTRDEYIKVGSPFDLMVSGNRQFKDLSYMVISKGQ------LVAAGKQSSRTFSLTPEASWAPKACIIAYYIAEDGEIINDIL 549          
BLAST of CD109 antigen vs. Ensembl Mouse
Match: A2ml1 (alpha-2-macroglobulin like 1 [Source:MGI Symbol;Acc:MGI:3039594])

HSP 1 Score: 112.849 bits (281), Expect = 3.020e-24
Identity = 225/1068 (21.07%), Postives = 418/1068 (39.14%), Query Frame = 2
Query:  437 LEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKS-RKSFHVKEYWLPRFDVNITLP--VKLSDQGFGVYGIIQANKTSGMFVRGNASITL--EIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSLINQGSLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPF-KPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVIRLSFVPTQSLTCPTYRLRAEYLEDGN-RLISWSEQRLF-------KYYSQSGAYMQITMATEYPRVNEYAVFQI----------DMSYPTNKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYD--LYSRGADNI----------LRDYNIIDEMKTYEQNFQQPI--EQDWLYNLEYIIRTYLPSPS-FGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRR-FYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAK-----VSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPID 3505
            L  V  +   + +  S R  +    +E + F+Q   PV+  G TV FRV+ L   L PV      I   +P   ++ +W+N TT    I ++ F L  +   G++TI ++ +   +    F V    LP+F+V +T P  + ++D  F +  +  A  T G  V+G A I +  E+  PA        + +   T+   +G A  +      +  +++  L F  + VN  V +S T +  +     FI S    V F    + PF +  +T+   L    P+ T  V  +   + +    + +  TDE        +G  R S + T  +      L+A Y+   +    SW             ++YSQ+ ++ +I +  +    ++  +F +          + S  T    V V  G +      + +Q      +F ISI+ D+AP A +  Y +   GE+V+D++         N V+I  +R KDL      ++    P SF AL  +     L + G +            +  Y         +    +P   ++D  YN  Y    Y P+ + +  D +  +++ GL IF++ +Y        C+ + +    L  +    ++          ++   + VD +   +     T +      NF    R W     +W    +  +G  N    +P   T W   A+ ++   GF I   P +   I + F++ V  P      EQ  + +T+FNY     E  ++++ S+ Y     A     R  D E            L AGE K   + I+    G       +++ A +     C N   K       +      LV+     + A  +F I  + +  +  ++ L  +P + +       V+IVGDI+G      +Q +++   L+M +G  E    +   ++Y+L Y++     +  +        +   Q+ LS F +  G +  F +S    +T  +A +   +  + E     YI+I E + +    ++  +Q   G F    + +D
Sbjct:   92 LAFVALLVQGNTLKISERRSVAIAAEENATFVQTDTPVHKPGDTVHFRVVTLNIWLKPVDDLYPLITVQDPQSNVIFQWINVTT-FRNITQLSFQLTPEPILGDYTIVIKTQSGTTVMDHFTVNRDVLPKFEVELTAPETITIADSQFQM--VTCAKYTYGQPVQGKAQIKVCRELFSPAHCESNENEICE-QFTVQLKDGCASHIINTKVFQ--LDRSGL-FMTLNVNEVVTESGTGVQMSKTHSVFITSVLGTVSFEN--MDPFYRRGITYFGTLKFSGPNNTPLVDKL-LQLELDGKPVGNYTTDE--------NGEARFS-INTSEIFGAQISLKAVYVRPRSCHRSSWLSPEYLDAYFSASRFYSQTSSFTKIILEPKQLPCDQEKMFSVLYSLNPEAYKEASDVTFFYLVMVRGGISRSGQKQVRVQAWNGNFSFPISINADLAPSADLFVYTLHPSGEIVADNVRLQIEKCFKNKVSINFSRDKDLPGSNTSVHLQAAPDSFCALRAVDKSALLLNHGQEMTPESVYFTLPYIHQYGYFYNGLNLDDQQAEPCIPQKDLFYNGLY----YTPTGNIWDGDLSNLLSNMGLKIFTNLHYRKP---EVCS-SQENQPLLRTFDHPNERIMMYGGGAPPSSAFHDSVDSISHAKVAIKETVR-----TNFP---RTW-----IWNLVSVDSSGTANVSFLVPDTITQWEASAFCVNGNAGFGI--SPKVSLQISQPFFVEVTSPFSVVRSEQSDMVVTVFNYLTTCVEISVQLEASENYE----ASINTQRNTDSEV-----------LQAGEQKTYVWTIIPKTLG----KVNVTVVATSKQSRACPNDASKEQDVHWKDTVVKTMLVEAEGIEKEATQSFLICPKGT--KASKQTLLELPSNVVEGSVRSFVTIVGDILG----VAMQNLESL--LQMPYGCGEQNIAQLASDVYILDYLKATDQLTEELKSKAQRLLSNGYQNHLS-FKNYDGSYDVFCQSNQEGSTWLSALSFKTVEKMKE-----YIFIEETVPKQTLIWLVKKQKSNGCFRRDEKHVD 1084          
BLAST of CD109 antigen vs. Ensembl Mouse
Match: Pzp (PZP, alpha-2-macroglobulin like [Source:MGI Symbol;Acc:MGI:87854])

HSP 1 Score: 101.679 bits (252), Expect = 7.829e-21
Identity = 208/1064 (19.55%), Postives = 410/1064 (38.53%), Query Frame = 2
Query: 1682 TFSISISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRD---YNIIDEMKTYEQNFQQPIEQDW--LYNLEYIIR---TYLPSPSFGA-DTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEY-------GITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNF--RESRNRP-NTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEIIQRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMET----ITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPF--------QTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYNRSIYQTVELYS 4780
            +  I +   MAP A+++ Y +  + E+V+D+  F       N VN+     + L      +     P S  AL  +   +     +  L     YN++         F  P+ +D     + E I      Y P  S G  D ++   S G+ IF+++      F   C E     Q  P       Q  + A    G++        +G P    + + +   ++   + + +++ +  W+W    +  +G     V +P   T W   A+ +    G  +    ++    + F++ + +P     GE   ++ T+ NY  +  +  ++++ S  +  V V  +       G  R      ++ KS+  + +    EA  +  P +    GN  T     +   T + S      + +   G+      N L  L  +      N+ ++L  +  E   R          A  S++GDI+G      +Q +     L+M +G  E     F  NIY+L Y+   +  +  +    +NY     Q  L+Y   + G +S F      N P NT  TAF L        A    +I+I +  I  A N++  +Q + G F  S   ++      +   ++ +   T A  +  +P+T           AV      ++ A A I +       ++++ +  YA + +G  A   K S ++ ++  +A  +  + ++     +P   ++  A +    PR       + TA   +A L  +     ++   +++ T    + +++K +N   GF+ST D+ VAL+    + A    R   + +V +T+ S G + +T+ +   N  +     +P+  + G +V    G+G + +Q  ++  +      K P       LP         +TF I     ++G+                     RP + M + DV++ +G++ +   +++  +   QP ++        +  Y+ KL       +F  ++  PV N+ +      Y+YYE   +      TVE YS
Sbjct:  524 SLPIQVEPGMAPEAQLLIYAILPNEELVADAQNFEIEKCFANKVNLSFPSAQSLPASDTHLKVKAAPLSLCALTAVDQSVLLLKPEAKLSPQSIYNLLPGKTVQGAFFGVPVYKDHENCISGEDITHNGIVYTPKHSLGDNDAHSIFQSVGINIFTNSKIHKPRF---CQEF----QHYPAMGGVAPQALAVAASGPGSS-----FRAMGVPMMGLDYSDEINQVVEVRETVRKYFPE-TWIWDLVPLDVSGDGELAVKVPDTITEWKASAFCLSGTTGLGLSSTISL-QAFQPFFLELTLPYSVVRGEAFTLKATVLNYMSHCIQIRVDLEISPDFLAVPVGGHENSHCICGNERKTVSWAVTPKSLGEVNFTATAEA--LQSPELC---GNKLTEVPALVHKDTVVKS------VIVEPEGIEKEQTYNTL--LCPQDTELQDNWSLELPPNVVEGSAR----------ATHSVLGDILGSA----MQNLQNL--LQMPYGCGEQNMVLFVPNIYVLNYLNETQQLTEAIKSKAINYLISGYQRQLNY-QHSDGSYSTFGNHGGGNTPGNTWLTAFVLKAF-----AQAQSHIFIEKTHITNAFNWLSMKQKENGCFQQSGYLLNNAMKGGVDDEVTLSAYITIALLEMPLPVT---------HSAVRNALFCLETAWASISQS--QESHVYTKALLAYAFALAGNKA---KRSELLESLNKDAVKEEDSLHWQ----RPGDVQKVKALSFY-QPRAPSAEVEM-TAYVLLAYLTSESSRPTRDLSSSDLSTASKIVKWISKQQNSHGGFSSTQDTVVALQALSKYGAATFTRS--QKEVLVTIESSGTFSKTFHVNSGNRLLLQEVRLPD--LPGNYVTKGSGSGCVYLQTSLKYNILPVADGKAPFALQVNTLPLNFDKAGDHRTFQIRINVSYTGE---------------------RPSSNMVIVDVKMVSGFIPMKPSVKKLQD---QPNIQRTEVNTNHVLIYIEKLTNQTLGFSFAVEQDIPVKNL-KPAPIKVYDYYETDEF------TVEEYS 1483          

HSP 2 Score: 65.0846 bits (157), Expect = 1.079e-9
Identity = 37/111 (33.33%), Postives = 60/111 (54.05%), Query Frame = 2
Query:  515 EFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKS-RKSFHVKEYWLPRFDVNITL 844
            E  VF+Q  KP+Y  GQ V+FRV+ +  +  P+  T   +    P    + +W N     GG++++ FPL+ +   G + + V+ +  K    SF VKEY LP+F+V I +
Sbjct:  124 ESPVFVQTDKPIYKPGQIVKFRVVSVDISFRPLNETFPVVYIETPKRNRIFQWQN-IHLAGGLHQLSFPLSVEPALGIYKVVVQKDSGKKIEHSFEVKEYVLPKFEVIIKM 233          
BLAST of CD109 antigen vs. Ensembl Mouse
Match: Gm7298 (predicted gene 7298 [Source:MGI Symbol;Acc:MGI:3648717])

HSP 1 Score: 84.3445 bits (207), Expect = 1.220e-15
Identity = 166/795 (20.88%), Postives = 308/795 (38.74%), Query Frame = 2
Query: 2432 LPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPET-------ISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNF--RESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQ-------IKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEIIQRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTE------QTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGN---LTTIPNDF---VWGEFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYE 4732
            +P   T W  GA  +  + G  +    A     + F++ V  P     GE   ++ T+ NY     +  ++++ S  +  V V +Y  +     +        ++ KS+  + +  + EA+    P         +T    ++  +  +    E   IKI               + T  + L   + +I  + S   P       V DS  A  S++GD++ P         +T   L M +G  E     F  NIY+LKY+      +  +    L +     Q  L+Y     G +S F  +      NT  TAF L +      A    +I+I E+ I  +  ++  QQ         G +F+ + +   + D   L   I+  L  +   A   +   A+  L +S K          +R  +F+          +++ +  YA +  G      K   ++ ++   A  +  + ++     KP+ +E      Q ++  + +N            A   +A L   +     E+   +M TI +L + +N   GF+ST D+ VAL     + A   +R      V  T+ S G++ + + ++ SN  +     L  IP D+   V GE  + AQ T R  + L+              + PS+  L  QT  + C     G NS  + ++I  S+ G     +RP + M + DV++ +G++ L   +++ +ES +   +R        +  YL ++       +F   + F V N+ +  +   Y+YYE
Sbjct:  760 VPDTITEWKAGALCLSNDTGLGL-SSVAPLQVFQDFFVEVSFPYSVVRGEAFMLKATVMNYLPTSMQMSVQLQDSPDFTAVPVGDYQDSYCLSAKERYTSSWLVTPKSLGNVNFSVSAEAQQSPEPCGSEVATVPETGRKDTVVKFLIV----EPEGIKI---------------EHTFSSLLCASDAEISEKLSLVLPP----TVVKDSARAHFSVMGDVLSPA------IKNTQNLLHMPYGCGEQNMVLFAPNIYVLKYLNETHQLTQTIKTKALGFLRAGYQRELNY-KHKDGSYSAFGDQNGEREGNTWLTAFVLKSF-----AQARAFIFIDESHITHSLTWLSQQQKDNGCFQSSGSLFNNAMKG-GVDDEMTLSAYITMALLESSLPATHPVVSKALSCLELSWKTIEQ------ERNASFV----------YTKALMAYAFALVGNQ---DKRDEILKSLDEEAIKENNSIHWKRPQ-KPRKSEHHLYKPQASSAEVEMN------------AYVVLARLT-AQPAPSPEDLTLSMSTIMWLTEQQNSNGGFSSTQDTVVALDALSKYKAVTFSRSQKTTLV--TIQSSGSFSQKFQVENSNRLLLQQVALPDIPGDYTMSVSGEGCVYAQTTLRYNIHLE--------------KQPSAFALRVQTVPLTCNDP-KGHNSFQISLEI--SYTG-----SRPASNMVIADVKMLSGFIPLKPTVKK-LESLAP--VRRTEVSSNNVLLYLDQVNSHTLAFSFIIQQDFLVRNL-QPAMVKVYDYYE 1456          

HSP 2 Score: 72.0182 bits (175), Expect = 8.084e-12
Identity = 73/245 (29.80%), Postives = 117/245 (47.76%), Query Frame = 2
Query:  251 PGQLY-QTSVTIVKLLY---PTLTIRMSI-----KRNDF-EYIHETTTFKTEGTQIMRLEIPTRVAPPDDYYLEV-VGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKW-KSRKSFHVKEYWLPRFDVNITLP--VKLSDQGFGVYGIIQANKTSGMFVRGNASITL 943
            P QLY +T   I   LY    T+TI  S+     +RN F E + +   F     Q +   IP   +  ++ +L V +   T N    FS +  +    KE  VF+Q  KPVY  GQ+V+FRV+ +  NL P+          +P    + +W +  T   G+ ++ F LA +  +G + I ++ +   K + SF+V E+ LPRFDV + +P  + ++D+   V     A  T G  V G   I++
Sbjct:   36 PSQLYTETPEKICLHLYHLNETVTITASLVSQWGRRNLFNELVVDKDLF-----QCVSFIIPRFSSSDEEQFLYVDIKGPTHN----FSKKEAVLVRNKESVVFVQTDKPVYKPGQSVKFRVVSMDKNLRPLNELFPLAYIEDPKKNRIMQWKDIKTE-NGLKQISFSLAAEPIQGPYKIVLQKQSGVKEKHSFNVMEFVLPRFDVALKVPNAISVNDEVLSVTAC--AKYTYGKPVPGYVEISV 268          
BLAST of CD109 antigen vs. Ensembl Mouse
Match: Mug2 (murinoglobulin 2 [Source:MGI Symbol;Acc:MGI:99836])

HSP 1 Score: 75.8702 bits (185), Expect = 4.850e-13
Identity = 88/319 (27.59%), Postives = 143/319 (44.83%), Query Frame = 2
Query:  251 PGQLY-QTSVTIVKLLY---PTLTIRMSI-----KRNDF-EYIHETTTFKTEGTQIMRLEIPTRVAPPDD--YYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKW-KSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSLINQGSLAFKDVWVNATVFDSFTELVRTGWAYTFI 1168
            P QLY +T   I   LY    T+T+  S+     +RN F E + +   F     Q +   IPT  +P ++   Y+++ G   +     FS R  +    KE  VF+Q  KPVY  GQ+V+FRV+ +   L P+   +      +P    + +W +  T   G+ +M F LA +  +G + I V  +   K   SF V E+ LPRF+V++ +P  +S     +   +    T G  V G   I+       +   T A   ++N  ++   G +     + EL+S   + +   +   VNATV +  T L   G+  T I
Sbjct:   36 PSQLYTETPEKICLHLYHLNETVTVTASLVSQTGRRNLFDELVVDKDLF-----QCVSFIIPTLNSPDEEEFLYVDIKGPTHE-----FSKRNAVLVKNKESVVFVQTDKPVYKPGQSVKFRVVSMDKTLRPLNELLPLAYIEDPKKNRIMQWRDIKTE-NGLKQMSFSLAAEPIQGPYKIVVHKQSGVKEEHSFTVMEFVLPRFNVDLKVPNAISVNDEVLQVTVCGKYTYGKPVPGQVKIS-------ICHETEAGCKEVNSKLDN-NGCSTQEVNITELQS--KKRNYEVQLFHVNATVTEEGTGLEFNGYGTTKI 333          

HSP 2 Score: 53.1434 bits (126), Expect = 4.295e-6
Identity = 53/189 (28.04%), Postives = 89/189 (47.09%), Query Frame = 2
Query: 4004 TITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGN---LTTIPNDF---VWGEFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRR 4552
            TI +L K +N   GF+ST D+ VAL     + A   +R      V  T+ S G++ + + ++ SN  +     L  IP D+   V GE  + AQ T R  M L+ +   F A+R+             QT  + C     G NS  + ++I  S+ G     +RP + M + DV++ +G++ L   +++
Sbjct: 1211 TIMWLTKQQNSNGGFSSTQDTVVALDALSKYGAVTFSRRQKTSLV--TIQSTGSFSQKFQVENSNCLLLQQVPLPDIPGDYTISVSGEGCVYAQTTLRYNMHLEKQQSAF-ALRV-------------QTVPLTCNNP-KGHNSFQISLEI--SYTG-----SRPASNMVIADVKMLSGFIPLKPTVKK 1375          
BLAST of CD109 antigen vs. UniProt/SwissProt
Match: sp|Q6YHK3|CD109_HUMAN (CD109 antigen OS=Homo sapiens OX=9606 GN=CD109 PE=1 SV=2)

HSP 1 Score: 272.322 bits (695), Expect = 1.836e-72
Identity = 370/1604 (23.07%), Postives = 664/1604 (41.40%), Query Frame = 2
Query:  203 LPPMPSYIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRN---------DFEYIHETTTFKTEGTQIMRLEIPTRVAPPDD--YYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSLINQ--GSLAFKD------VWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVIRLSFVPTQSLTCP---TYRLRAEYLEDGNRL----------ISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTNKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEIN-GYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQNFQQPIEQDWLYNLEYIIRTYLPSPSFGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTS---KAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEIIQRATAFIDRHLINSI-DLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLV---AQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYN-RSIYQTVELYSNHIC-NVFGSYQCPYSPYFNVASSTVEINFLFVFAII 4888
            + P P +++ AP  IRPG      V +++     +T++  + +          + E + E  +FKT       L +P+      D  Y L V G   D   I+FSN TRL F  K  SVFIQ  K +Y   Q V+FR++ L+ +  P + T   I   +P   ++++W++  + +G I +  F L+     G+W+I+V++      +SF V EY LP+F+V +  P+  S     + G I A  T G  V+G+ ++T         +       +IN       G A+F F  +E++++++   G   + D      V +  TV +S T + R      F    D  ++F        KP++ FTA + V + DG +      RN NV         T+ +S     +SG  ++  V   + T P   T+++    LED + L           S +   LFK  S S  Y+Q+    E  +V       +  +    ++   VV+ G +V V     QNS     FS++      P A V+ YY++ DGE++SD L     +   N + +  ++ K    + V +     +P S + +  +   +    A N +   N++ E++              LYN  Y +  ++       ++       GL + +DAN T     +  +   D ++               AER    N+  + VD     + +   +P  +          +H+ +  W+W    +       F V +P   TSWV   + I  + G  +   P      + F++ + +P     GE+  + IT+FNY    TE  + +++SD++ ++  +          E  +     TL+ + + +   + FPI     G       I++ A +   S+   + I +   G+   Y  + L+DLT    ++ L   +F        + P       V  S+  +++ +GD++GP+ +     +      RM +G  E     F  NIY+L Y+ + +  + N+    L++  +  Q  L Y     G FS F       +T  +AF L   L     + D YI I +N++     ++   Q   G F   ++P  ++ S+    N S             + +TA ++ S+   +   PN + +Q +  F++      I D ++  + TYALS  G    S K    +  +   A  +G  +++  S+ K   +               W    L     A A+L    Q    E  P     + +L++ RN + GF ST D++VAL+    F+A   N E   +QV +T  S  +      ++F   T   L     +    +   V   A G G  + QL+V   V++ V+              + FD++   K +  + + + +++C S   F+ P     +GM + +V L +G++  ++ +           ++   +  GK++ YL  + +TQ CV   A R F V+N ++D   S  +YYEP R   RS    V+L S  +C +V G   C      +   S+V   F+F F ++
Sbjct:   22 VAPGPRFLVTAPGIIRPGGNVTIGVELLEHCPSQVTVKAELLKTASNLTVSVLEAEGVFEKGSFKT-------LTLPSLPLNSADEIYELRVTGRTQDE--ILFSNSTRLSFETKRISVFIQTDKALYKPKQEVKFRIVTLFSDFKP-YKTSLNILIKDPKSNLIQQWLSQQSDLGVISKT-FQLSSHPILGDWSIQVQVNDQTYYQSFQVSEYVLPKFEVTLQTPLYCSMNSKHLNGTITAKYTYGKPVKGDVTLTFLPLSFWGKKKNITKTFKIN-------GSANFSFNDEEMKNVMDSSNGLSEYLDLSSPGPVEILTTVTESVTGISRNVSTNVFFKQHDYIIEFF-DYTTVLKPSLNFTATVKVTRADGNQLTLEERRN-NVVITVTQRNYTEYWSG---SNSGNQKMEAVQKINYTVPQSGTFKIEFPILEDSSELQLKAYFLGSKSSMAVHSLFK--SPSKTYIQLKTRDENIKVGSPFELVVSGNKRLKELSYMVVSRGQLVAVGK---QNST---MFSLTPENSWTPKACVIVYYIEDDGEIISDVLKIPVQLVFKNKIKLYWSKVKAEPSEKVSLRISVTQPDSIVGIVAVDKSVNLMNASNDITMENVVHELE--------------LYNTGYYLGMFM-------NSFAVFQECGLWVLTDANLTK----DYIDGVYDNAE--------------YAERFMEENEG-HIVD---IHDFSLGSSPHVR----------KHFPE-TWIWLDTNMGYRIYQEFEVTVPDSITSWVATGFVISEDLGLGLTTTPVELQAFQPFFIFLNLPYSVIRGEEFALEITIFNYLKDATEVKVIIEKSDKFDILMTSN---------EINATGHQQTLL-VPSEDGATVLFPIRPTHLG----EIPITVTALSPTASDAVTQMILVKAEGIEKSYSQSILLDLTDNRLQSTLKTLSFS-------FPPNT-----VTGSERVQITAIGDVLGPSINGLASLI------RMPYGCGEQNMINFAPNIYILDYLTKKKQLTDNLKEKALSFMRQGYQRELLY-QREDGSFSAFGNYDPSGSTWLSAFVLRCFL-----EADPYIDIDQNVLHRTYTWLKGHQKSNGEF---WDPGRVIHSELQGGNKSP------------VTLTAYIVTSLLGYRKYQPNID-VQESIHFLESEFSRGISDNYTLALITYALSSVG----SPKAKEALNMLTWRAEQEGGMQFWVSSESKLSDS---------------WQPRSLDIEVAAYALLSHFLQFQTSEGIP----IMRWLSRQRNSLGGFASTQDTTVALKALSEFAAL-MNTERTNIQVTVTGPSSPS-----PVKFLIDTHNRLLLQTAELAVVQPTAVNISANGFGFAICQLNV---VYN-VKASGSSRRRRSIQNQEAFDLDVAVKENKDDLNHVDLNVCTS---FSGP---GRSGMALMEVNLLSGFMVPSEAISL------SETVKKVEYDHGKLNLYLDSVNETQFCVNIPAVRNFKVSN-TQDASVSIVDYYEPRRQAVRSYNSEVKLSSCDLCSDVQGCRPCEDGASGSHHHSSV--IFIFCFKLL 1438          
BLAST of CD109 antigen vs. UniProt/SwissProt
Match: sp|Q8R422|CD109_MOUSE (CD109 antigen OS=Mus musculus OX=10090 GN=Cd109 PE=1 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 6.796e-32
Identity = 140/551 (25.41%), Postives = 239/551 (43.38%), Query Frame = 2
Query:  209 PMPSYIILAPKRIRPGQLYQTSVTIVKLLYPTLTIR---MSIKRNDFEYIHETTTFKTEGTQIMRLEIPTRVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSLIN--------QGSLAFKD------VWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTK-----------TVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVIRLSFVPTQSLTCPTYRLRAEYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTNKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYVKTDGEVVSDSL 1777
            P   +++ AP  IRPG      V +++   P + ++     I  N    I E       G     L +P       D   E+  +    + I+FSNRTRL F  K  SV IQ  K  Y   Q V+FRV+ L  +L P + T   I   +P   ++++W +    +G +    F L+     G+W+I+V++   +  +SF V EY LP+F+V +  P+  S +   + G + A  T G  V+G+ S+T         +       +IN       G A+F F   E++ ++N        +GS    D        + ATV +S T + R      F    D  ++         KP++ FTA + V + DG +           TV T  +N + ++     +   +  N  +P +G+I++ F P  S++    +L+A +L DG   ++        + S S  Y+Q+    EY +V       +  +     +   V++ G       +V      +RTFS++     AP A ++AYY+  DGE+++D L
Sbjct:   23 PGSRFLVTAPGIIRPGANVTIGVDLLENSPPQVLVKAQVFKIASNKSRSILEAEGVFHRG-HFKTLVLPALPLSSADKIYELHINGQSENEIVFSNRTRLTFESKSISVLIQTDKAFYKPKQEVKFRVLTLCSDLKP-YRTSVDIFIKDPKSNVIQQWFSQKGDLG-VVSKTFQLSSNPIFGDWSIQVQVNDQQYYQSFQVLEYVLPKFEVTVQTPLYCSLKSKQLNGSVIAKYTYGKPVKGSLSLTFLPLSFWGKKKNITKSFEIN-------GFANFSFDNYEMKKVMNLKPLTDVSEGSYENVDPSFPGPAEIIATVTESLTGISRMASTNVFFKQHDYIIEIF-DYTTVLKPSLNFTATVKVSRSDGNQLTPEEIENDLVTVVTQRKNNHPESQRDQEMDYIQTVNYTIPQNGIIKIEF-PVMSISG-ELQLKAYFL-DGTSSVTVHSM----FTSPSKTYIQLKTRDEYIKVGSPFDLMVSGNRQFKDLSYMVISKGQ------LVAAGKQSSRTFSLTPEASWAPKACIIAYYIAEDGEIINDIL 549          

HSP 2 Score: 134.806 bits (338), Expect = 4.021e-30
Identity = 179/788 (22.72%), Postives = 332/788 (42.13%), Query Frame = 2
Query: 2375 WLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGL-RMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSF-EPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEIIQRATAFIDRHLINSI-DLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRL--EWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWG----EFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPL---LRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRD 4702
            W+W   ++       F V +P   TSWV  A+ I  + GF +   PA     + F++ + +P     GE+  + +++ NY     + ++ +++SD + ++      +T      TI  K+V     +       + FPI    K  +     I++ A +   S+   + I +   G+   Y  + L+DLT      V + +  +R SF  P + ++     S+  +++ +GDI+G +       ++    L RM +G  E     F  NIY+L Y+ + +  ++N+    L+Y  +  Q  L Y     G FS F +  +  +T  +AF L   L   EAD+  YI I ++++     ++ N   K   F+G F EP  ++ S+                 +  + +TA ++ S+   K   PN + +Q +  F++      I D ++  I +YALS  G    S K    +  +M  +  +G  +++  S                  P L   W    +     A A+L     ++        +  + +L + RN + GF ST D+ VAL+    FSA           +++T++  G  R    I F      NL  +  + +         + A G+G  + QL+V+  V  +   K  R+  + ++    FD++     +  + S L +++C S LG          GM + +V L +G+ A +D +         PL   L+   +  GK++ YL  + ++Q CV     R + V+N+ RD
Sbjct:  696 WIWLDAYMGSKIYEEFEVTVPDSITSWVASAFVISEDLGFGLTTVPAELQAFQPFFLFLNLPYSVIRGEEFALEVSIVNYLKDTIKVVILIEESDSFDIL------MTSNDTNGTIYRKTVQ----VPRDNGVTLVFPI----KPTHLGEIPITVTAASPTASDAVTQTIVVKPEGIEKSYSKSVLLDLTDS---NVESKQQSMRFSF--PPDTVI----GSERVQITAIGDILGSS-------INGLSSLIRMPYGCGEQNMIYFAPNIYILDYLTKQKQLTVNLKEKALSYMRQGYQRELLY-QREDGSFSAFGDIDSSGSTWLSAFVLRCFL---EADY--YIDIDQDVLHRTYTWL-NAHKK---FNGEFWEPGRVIHSEL------------QGGTKSPVTLTAYIVTSVLGYKKYQPNID-VQDSIKFLEFEFSRGISDNYTLAIISYALSTVG----SPKAEEALNLLMQRSEKEGDTQFWLSS-----------------GPALSGSWQPRSVDIEIAAYALLAHTLHHV-----SEGIPVMRWLIQQRNSLGGFVSTQDTVVALKALSEFSALVHKE---NTDIQLTVTGPGIPR---SIHF-RIDSQNLFLLHQEELHALDPITVNVSAHGSGFAICQLNVDYNVKGSGSSKRRRSTENQEV----FDLDVIVN-NEDDISHLNLNVCTSHLG------SERTGMVLMEVNLLSGFSASSDSI---------PLSETLKKVEYDNGKLNLYLDSVNESQFCVNIPTVRDYKVSNI-RD 1376          
BLAST of CD109 antigen vs. UniProt/SwissProt
Match: sp|P06238|A2MG_RAT (Alpha-2-macroglobulin OS=Rattus norvegicus OX=10116 GN=A2m PE=2 SV=2)

HSP 1 Score: 135.191 bits (339), Expect = 2.909e-30
Identity = 228/1098 (20.77%), Postives = 426/1098 (38.80%), Query Frame = 2
Query:  479 FSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKS-RKSFHVKEYWLPRFDVNITLPVKLS----DQGFGVYGIIQANKTSGMFVRGNASITL--EIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSLINQGSLAFK------DVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVIRLSFVPTQSLTCPTYRLRAEYLEDGNRLISW---SEQRL------FKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTNKIFVQ----------VVAGGNIVYVDTIVM---QNSVKTR-TFSISISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLAL-----NVLHYDLYSRGADNILRDYNIIDEMKTYEQNFQQPIEQ--DWLYNLEYIIRTYLPSP---SFGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAI-FSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLV-------DLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNF--RESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVI 3604
            F  R+ +    KE  VF Q  KP+Y  GQTV+FRV+ L  +  P+   I  +   +P    + +W N     GG+ ++ FPL+ + T+G++ + +  E  ++    F V+E+ LP+F+V +T+P  ++    +    V GI     T G  V G  ++ +  +  +P+ + F    +    +     +G+  F         L+   S   K       + V+A + +  T +  TG   T I    T + F+  +   F+  + F   + +    GT         +  +   I + + + + N      G+ R S + T  +   +  +RA+Y +D N    +   +E+ +      +  +S S +++ +    +  R ++    ++   Y  N   +Q          ++A G IV   T V+   Q  ++   +  IS+  D+APVAR+V Y +  +GEVV D+  +       N V++       L      ++    P S   L     +VL     +  + +++ D   + ++  + Q   Q  E     +   +  I   L SP   +   D    +   GL +F+++N   +     C E +  ++ +P       Q +  A                   E++ +PT              R +    W+W    +   G     V +P   T W  GA+ +  + G  +   P + F   + F++ + +P     GE   ++ T+ NY        ++++ S  +               PE    +S H +       A +   P     K   + N T+S  A       C N    +   G  +    + LV       ++T  + L     ++    +   P +     V +S  A V+++GDI+G          +T   L+M +G  E     F  NIY+L Y+   +  +  +    + Y N   Q  L+Y     G +S F  +  RN  NT  TAF L +      A   +YI+I E  I  A  ++  QQ   G F  S   ++      +   ++ +   T A  +  +P+T  V+
Sbjct:  117 FRRRSTVLVKKKESLVFAQTDKPIYKPGQTVRFRVVSLDESFHPLNELIPLLYIQDPKNNRIAQWQNFNLE-GGLKQLSFPLSSEPTQGSYKVVIRTESGRTVEHPFSVEEFVLPKFEVRVTVPETITILEEEMNVSVCGIY----TYGKPVPGRVTVNICRKYSNPS-NCFGEESVAFCEKLSQQLDGRGCF-------SQLVKTKSFQLKRQEYEMQLDVHAKIQEEGTGVEETGKGLTKITRTITKLSFV-NVDSHFRQGIPFVGQVLLVDGRGTP--------IPYETIFIGADEANLYINTTTDKHGLARFS-INTDDIMGTSLTVRAKY-KDSNACYGFRWLTEENVEAWHTAYAVFSPSRSFLHLESLPDKLRCDQ--TLEVQAHYILNGEAMQELKELVFYYLMMAKGGIVRAGTHVLPLKQGQMRGHFSILISMETDLAPVARLVLYAILPNGEVVGDTAKYEIENCLANKVDLVFRPNSGLPATRALLSVMASPQSLCGLRAVDQSVLLMKPETELSASLIYDLLPVKDLTGFPQGADQREEDTNGCVKQNDTYINGILYSPVQNTNEEDMYGFLKDMGLKVFTNSN---IRKPKVC-ERLRDNKGIPAAYHLVSQSHMDAFL-----------------ESSESPTET-----------RRSYFPETWIWDLVVVDSAGVAEVEVTVPDTITEWKAGAFCLSNDTGLGL--SPVVQFQAFQPFFVELTMPYSVIRGEAFTLKATVLNYLPTCIRVAVQLEASPDFLAA------------PEEKEQRS-HCICMNQRHTASWAVIP-----KSLGNVNFTVSAEALNS-KELCGNEVPVVPEQGKKDTIIKSLLVEPEGLENEVTFNSLLCPMGAEVSELIALKLPSD----VVEESARASVTVLGDILGSA------MQNTQDLLKMPYGCGEQNMVLFAPNIYVLDYLNETQQLTQEIKTKAIAYLNTGYQRQLNY-KHRDGSYSTFGDKPGRNHANTWLTAFVLKSF-----AQARKYIFIDEVHITQALLWLSQQQKDNGCFRSSGSLLNNAMKGGVEDEVTLSAYITIALLEMSLPVTHPVV 1119          
BLAST of CD109 antigen vs. UniProt/SwissProt
Match: sp|A8K2U0|A2ML1_HUMAN (Alpha-2-macroglobulin-like protein 1 OS=Homo sapiens OX=9606 GN=A2ML1 PE=1 SV=3)

HSP 1 Score: 129.028 bits (323), Expect = 2.086e-28
Identity = 219/1045 (20.96%), Postives = 407/1045 (38.95%), Query Frame = 2
Query: 1682 TFSISISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIID-----------EMKTYEQ-------NFQQPIEQDWLYNLEYIIRTYLPSPSF--GADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAI-FSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVH-TLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTL-SATDAEAQRRIPITAMVILSISD--KKAVSPNAEIIQRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDG-LTTACTAMAMLL-FKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEP 4735
            + S++ +  +AP   +V Y +   G VV+D + F   +   N V++G +  + L    VE+     PGS  AL  +   +     D  L + ++             ++  Y+Q       +F QP+  D +       R+ +  PSF  G D  +     GL I S+A            + VD S   P YST        A    G           G PE   + TP    + +  D   R +    WLW  + I  +G+    V +P   T W   ++   + +GF +   P +  +  + F++ + +P     GE   +  T+FNY         ++ +S +Y++   A+   +     +    K+ H  +  +  G   F     +L+   +N+              S+   + + +   GV      ++L  L  K ++A  +  ++L           +  VPDS  A V+++GDI+G      LQ +D    ++M  G  E     F   IY+L+Y+ +    +  +    + +     Q  L Y  S +G +S F E     NT  TAF              ++I+I    IQ A  ++   Q+  G +                 N+   L +A        + +TA V  ++ +  K    P   ++ +    +     ++ +L++Q +  Y  S +G        + ++  +   A   G++ Y+S    KP  T  +NA          W     +    TA A+L    + ++ ++        + +LAK  N   GF+ST D+ VAL+    ++ T     +   ++ + + S  N++ T+ IQ  N  V    T+PN  V G + L A G G + +Q  +   +        P N  +  L  +     C    S ++   L + I  S++G     +R  + M + +V++ +G+  +    +  ++   QPL++   F    ++ YL +L +     TF   +   V N+ +      Y+YY P
Sbjct:  519 SLSLTFTSRLAPDPSLVIYAIFPSGGVVADKIQFSVEMCFDNQVSLGFSPSQQLPGAEVELQLQAAPGSLCALRAVDESVLLLRPDRELSNRSVYGMFPFWYGHYPYQVAEYDQCPVSGPWDFPQPL-IDPMPQGHSSQRSIIWRPSFSEGTDLFSFFRDVGLKILSNAK---------IKKPVDCSHRSPEYST--------AMGAGG-----------GHPEAFESSTP----LHQAEDSQVRQYFPETWLWDLFPIGNSGKEAVHVTVPDAITEWKAMSFCTSQSRGFGL--SPTVGLTAFKPFFVDLTLPYSVVRGESFRLTATIFNYLKDCIRVQTDLAKSHEYQLESWADSQTSSCLCAD--DAKTHHWNITAVKLGHINFTISTKILD---SNEPCGGQKGFVPQKGRSDTLIKPVLVKPEGVLVEKTHSSL--LCPKGKVASESVSLELP----------VDIVPDSTKAYVTVLGDIMGTA----LQNLDGL--VQMPSGCGEQNMVLFAPIIYVLQYLEKAGLLTEEIRSRAVGFLEIGYQKELMYKHS-NGSYSAFGERDGNGNTWLTAFVTKCF-----GQAQKFIFIDPKNIQDALKWMAGNQLPSGCY----------------ANVGNLLHTAMKGGVDDEVSLTAYVTAALLEMGKDVDDP---MVSQGLRCLKNSATSTTNLYTQALLAYIFSLAGEMDIR---NILLKQLDQQAIISGESIYWSQ---KP--TPSSNAS--------PWSEPAAVDVELTAYALLAQLTKPSLTQKEIAKATSIVAWLAKQHNAYGGFSSTQDTVVALQALAKYATTAY---MPSEEINLVVKSTENFQRTFNIQSVNRLVFQQDTLPN--VPGMYTLEASGQGCVYVQTVLRYNILP------PTNMKTFSLSVEIGKARCEQPTSPRS---LTLTIHTSYVG-----SRSSSNMAIVEVKMLSGFSPMEGTNQLLLQ---QPLVKKVEFGTDTLNIYLDELIKNTQTYTFTISQSVLVTNL-KPATIKVYDYYLP 1441          

HSP 2 Score: 70.0922 bits (170), Expect = 1.979e-10
Identity = 50/217 (23.04%), Postives = 101/217 (46.54%), Query Frame = 2
Query:  212 MPSYIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRND-FEYIHETTTFKTEGTQIMRLEIPTRVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLS 859
            +P+Y++  P R+    + +  + +    Y  +   ++++  D  + + E +  K      +   +P      ++     V  V +N  I F  + ++    +    F+Q  KP+Y  GQ V FR++ +  N +PV    + ++  +PN   + +W+       GI ++ F LA +   G +T+ V   + K+  +F V+EY LP+F V +  P +LS
Sbjct:   20 LPNYLVTLPARLNFPSVQKVCLDLSPG-YSDVKFTVTLETKDKTQKLLEYSGLKKRHLHCISFLVPPPAGGTEEVATIRVSGVGNN--ISFEEKKKVLIQRQGNGTFVQTDKPLYTPGQQVYFRIVTMDSNFVPVNDKYSMVELQDPNSNRIAQWLE-VVPEQGIVDLSFQLAPEAMLGTYTVAV--AEGKTFGTFSVEEYVLPKFKVEVVEPKELS 230          
BLAST of CD109 antigen vs. UniProt/SwissProt
Match: sp|Q8IZJ3|CPMD8_HUMAN (C3 and PZP-like alpha-2-macroglobulin domain-containing protein 8 OS=Homo sapiens OX=9606 GN=CPAMD8 PE=1 SV=2)

HSP 1 Score: 124.405 bits (311), Expect = 7.072e-27
Identity = 159/705 (22.55%), Postives = 276/705 (39.15%), Query Frame = 2
Query:  206 PPMPSYIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRNDFEYIHETTTFKTEGTQIMRLEIPTRVAPPDDYYLEVVG-SVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTA-PLLQINRTINYFEGKADF-LFTMDELRSLINQGSLAFKDVWVNAT--------VFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVI--RLSFVPTQS---------LTCPTYRLRAEYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTN-KIFVQVVAGGNIVYVDT----IVMQNS------------------------------VKTRTFSISISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQNFQQPIEQD----WLYNLEYIIR---TYLPSP-SFGADTNTTMNSSGLIIFSD 2125
            P  P Y+I AP   R G     SVTI       +T++  +       +        +GT  ++L++PT +       L+V G         +F N+T +  + +  SVFIQ  KPVY     V   +  + PNL PV   + A   ++P G  +  W +      GI  M FPL+DQ   G W I VE++     KSF V++Y LP+F++ I  P  + D      G ++A  T G  V G   I + +            P+L+  + +    G  DF +   D + + + +       +W   T         FD  T + R        YS DT         + FKP + +   + +  PDG+         V V+     + K + +++ +V   G++   +  +PT +         +      + A+YL     L SW        YS S  Y+Q+   +   +V E A F +  + P N  ++ +V A GNIV           Q S                              V   +  ++++  M P+ R++ +YV+ +GE V+DSL F       N V++  +  +    + V++      GS + +  +   +Y   +   L    +  E++ Y+ +    + ++    W   L    R   +  P P     D+      +GL++ +D
Sbjct:   28 PQAPGYLIAAPSVFRAGVEEVISVTIFNSPR-EVTVQAQLVAQGEPVVQSQGAILDKGT--IKLKVPTGLR--GQALLKVWGRGWQAEEGPLFHNQTSVTVDGRGASVFIQTDKPVYRPQHRVLISIFTVSPNLRPVNEKLEAY-ILDPRGSRMIEWRHLKPFCCGITNMSFPLSDQPVLGEWFIFVEMQGHAYNKSFEVQKYVLPKFELLIDPPRYIQDLDACETGTVRARYTFGKPVAGALMINMTVNGVGYYSHEVGRPVLRTTKIL----GSRDFDICVRDMIPADVPEHFRGRVSIWAMVTSVDGSQQVAFDDSTPVQRQ--LVDIRYSKDTR--------KQFKPGLAYVGKVELSYPDGSPA-----EGVTVQIKAELTPKDNIYTSEVVSQRGLVGFEIPSIPTSAQHVWLETKVMALNGKPVGAQYLPSYLSLGSW--------YSPSQCYLQLQPPSHPLQVGEEAYFSVKSTCPCNFTLYYEVAARGNIVLSGQQPAHTTQQRSKRAAPALEKPIRLTHLSETEPPPAPEAEVDVCVTSLHLAVTPSMVPLGRLLVFYVRENGEGVADSLQFAVETFFENQVSVTYSANETQPGEVVDLRIRAARGSCVCVAAVDKSVYLLRSGFRLTPAQVFQELEDYDVSDSFGVSREDGPFWWAGLTAQRRRRSSVFPWPWGITKDSGFAFTETGLVVMTD 699          

HSP 2 Score: 80.1073 bits (196), Expect = 1.977e-13
Identity = 109/442 (24.66%), Postives = 191/442 (43.21%), Query Frame = 2
Query: 3029 VPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEIIQRATAFIDRHLINS-----IDLFSQIIGTYALSKSGTSAYSGKISTMIT-TIMNNARYDGQAKYFSDSDVKPQYTEQTNAGT-LMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTM---SSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDAV 4324
            +P S+ A  SI+GD++GPT             LR+  G  E     F  N+++LKY+++ +  S  V   T +Y  +  Q  L+Y     G +S F E     +   TAF L +      A    +I++    +  A ++I  QQ      DGSF  +  + +K +   I  T           +P+TA V++++ +    S      +R +    RH + S     +D +S  + TYAL+   + A    +  + +  IM +        ++S S+     +   + GT L  + R+           TA A+L +        +    +  + +L++ RN + GF+ST D+ VAL+    ++        Y   + +T+   S+  +++ET+ +  +N  V     IP+    G FV  A+G G  LMQ+DV   V D V
Sbjct: 1112 IPGSERATASIIGDVMGPT------LNHLNNLLRLPFGCGEQNMIHFAPNVFVLKYLQKTQQLSPEVERETTDYLVQGYQRQLTY-KRQDGSYSAFGERDASGSMWLTAFVLKSF-----AQARSFIFVDPRELAAAKSWIIQQQQA----DGSFLAVGRVLNKDIQGGIHGT-----------VPLTAYVVVALLETGTASEE----ERGSTDKARHFLESAAPLAMDPYSCALTTYALTLLRSPAAPEALRKLRSLAIMRDG-----VTHWSLSN-----SWDVDKGTFLSFSDRVSQSVVSAEVEMTAYALLTYTLLG----DVAAALPVVKWLSQQRNALGGFSSTQDTCVALQALAEYAILS-----YAGGINLTVSLASTNLDYQETFELHRTNQKVLQTAAIPS-LPTGLFV-SAKGDGCCLMQIDVTYNVPDPV 1501          
BLAST of CD109 antigen vs. TrEMBL
Match: A0A5K4FB41 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 1466.06 bits (3794), Expect = 0.000e+0
Identity = 722/1587 (45.49%), Postives = 1017/1587 (64.08%), Query Frame = 2
Query:  182 QRKESYKLPPMPSYIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRNDFEYIHETTTFKTEGTQIMRLEIPTRVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSLINQG----SLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVIRLSFVPTQSLTCPTYRLRAEYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTNKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQNFQQPIEQDWLYNLEYIIRTYLPSPSFGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYN----------------QQIKGGIFDGSFEPIDILDSKFLPT-NISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNA-------EIIQRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYNRSIYQTVELYSNHICNVFGSYQCPYSPYFNVASSTVE 4858
            Q++E YKL P+ SY+ILAP RIR  +L Q SV+I +LLY  LTIR++IK N  E I     FK+ GT+IM+L++P   A    Y+L V GS+  N++I+FSN T+L F+ +  S+FI +SKP+YHQ Q V+FRVIP+ P+L P +G++ +I  I+ +G + KRW+NP T++GGI E+ FPL+DQV EG W I    E++ + K+F VKEYW P +DVN+TLP++++D   G+YG+I AN TSG  V+GNA++ +++R    DR+T  P  +  R +   +G  DFL  M E+R  I+      SLA  ++WVN T F+ + +  RTGWA+T +YS +  +KFLGG+VRPFKPNM FT +L VY  DG+    + NR V +  YC+D+    + + L + D GVIR ++ P+    C TYRL A Y+++ +R++S  +QRLF   S SGAY+Q++ +T  P+VNEY V  +  +YPT+KI   VV+ GNI+  D + M N+V +RTFSI++SR M P++ +VAY++K + E+VSDSLTF++N T+LNNV + VNRGKDLN DT+EI GY +PGS++A +V+H DLY+ G  + LR+Y+I+DE+ TYEQ+ Q P+   W  + + I R YLP+ S GADTN+TMNSSGLIIF+DAN+T  NFY+TCNET + ++ALPCYS TG+ CYSR+ERCDG NQC  W+DE+ CPE      P+P  ++  FD+L R WNDGAWLW + ++K +G+I FRVDLPKM+  WV GA+++D E G +++++P +FSG RRFYM VE+PEE  +GEQ+GVR  LFN W+YW EAL+EVK S   R++QV   G   A+ PE   NK+V +L YL AG +++I+ P+     G    N + +ICAY+FIGSNCE   I + MNGVTNYYHT + +DLTS + L V NFKI + Q F  PE R+ R+VP S+ A +S+VGD +GP  S K  + DT   LR+   +AEN+FFE GYN+ LL Y+        +V  N L YC+ ILQ   SYF+   G F+NFR+  +  + L TA ALW+LL   +  W+R IY+ +N      N++                  Q I      GS+   +I+D +F P  N +      D E  RRIP TAMVI+++   +   P+         I+  A  F+ RH++N  DLFSQ+IGTYAL  +  +    KIS  +  I    R  G   Y+++  + P   E   AG  + NPRLE PNDG    C+++  LL  E   W       ++ + +LA  RNHV+GF STFDS  A+     F+  D NR LY++ ++  +SS   W     I   NY+    TT P D VWG+  +  +GTGR+L+QLD E  V      K P+NP   +  +++F+I C   F  +N+SI+IM  CG W+G       P++GM VF++ LPTG++ LND+LRRYV S   P LRYAR     +HF+   +   +TC+ F A+RY+PVAN+++ H CSAYEYYEPGRYN S+Y  V LY+N+ICNV GS+ CPY P +N++   ++
Sbjct:   19 QKQEGYKLDPLTSYVILAPNRIRANELVQISVSIFELLYEQLTIRLAIKVNSTEIISSREVFKSTGTRIMQLKVPN-YARTGTYWLHVEGSIVSNASILFSNLTKLTFSEQSESIFIHVSKPIYHQSQIVRFRVIPMLPDLTPAYGSLVSIDVIDASGNLFKRWLNPMTNIGGIIELDFPLSDQVHEGVWLIRANHERFSAEKTFQVKEYWRPLWDVNVTLPLRITDNQLGLYGLISANYTSGKAVKGNATVLIQLRKSGADRWTNPPRAEFRRYLLALDGIGDFLLPMSEIRQAISSSTIDSSLANTEIWVNVTYFNWWEKTHRTGWAFTKVYSSNPLIKFLGGMVRPFKPNMYFTVYLVVYMADGSMVKYSGNRKVTLSFYCLDNTFEKQIT-LPISDDGVIRYTYRPSGD-GCITYRLEARYIDETDRILSNDQQRLFAVNSYSGAYLQLSTSTFSPKVNEYMVIHVQTNYPTDKIHYVVVSNGNILATDQLRMPNAVTSRTFSIAVSRYMFPISHIVAYFIKDNSEIVSDSLTFYANYTHLNNVQMQVNRGKDLNQDTLEIRGYAKPGSYIAFSVMHADLYAIGGASFLREYDIVDELMTYEQHSQAPLVHTWYEDFKDIKRIYLPTSSNGADTNSTMNSSGLIIFTDANFTKANFYHTCNETENPARALPCYSLTGRDCYSRSERCDGINQCATWIDEMDCPENETK-NPQPLRLINTFDILNRQWNDGAWLWHSTFVKADGQIQFRVDLPKMNADWVAGAFSVDSELGLALMQQPYLFSGTRRFYMTVELPEEAVWGEQIGVRACLFNNWNYWIEALVEVKPSPDLRIIQVGLEGRVSAYAPEVSINKAVQSLAYLEAGTSRYIYMPVSPKLPG----NTSFTICAYSFIGSNCETHTIYVRMNGVTNYYHTASFLDLTSSSTLFVNNFKIIVPQKFTIPERRLHRFVPGSQKAILSVVGDFIGPALSEKFHYADTQNILRLPFASAENVFFELGYNMNLLLYLHGAGHLPYSVLENGLIYCSVILQKGFSYFNPKIGAFANFRDRLDETDPLVTAIALWSLLLTRQTQWNRLIYVDDNTFVSIINYLKQTQQFNTYDNDNHNNNNQTIVDIRLSGSWNITNIIDRRFSPMINQTKWPDLIDQECHRRIPSTAMVIIALRSTERTLPSGVGADKAERIVSEAVKFLSRHILNIDDLFSQMIGTYALKVAVDATSQHKISHALKRI-QAFRQKGDYVYYANYRIPPPKWELDQAGRRIENPRLEMPNDGYGVLCSSIYFLLKHELGEWSFRSSEALDMVHWLASERNHVAGFASTFDSLFAMHALRKFALADTNRALYRMAIDEKISSMSTWTNRIYIDTHNYSTVTHTTFPPDNVWGDITMKLEGTGRVLLQLDAEVNVEYKEMQKMPKNPLDTEQVYRSFEIECTPGFLSRNNSIMIMTACGRWVGTTGIEPLPQSGMAVFEIGLPTGFIVLNDDLRRYVNSLMVPNLRYARANSRYVHFFFDTITPDKTCIQFTAERYYPVANITQQHRCSAYEYYEPGRYNNSLYNVVSLYTNNICNVCGSFACPYCPDYNLSKKRIQ 1596          
BLAST of CD109 antigen vs. TrEMBL
Match: A0A4Z2DU20 (Alpha-2-macroglobulin OS=Schistosoma japonicum OX=6182 GN=EWB00_005644 PE=4 SV=1)

HSP 1 Score: 1463.36 bits (3787), Expect = 0.000e+0
Identity = 727/1599 (45.47%), Postives = 1025/1599 (64.10%), Query Frame = 2
Query:  182 QRKESYKLPPMPSYIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRNDFEYIHETTTFKTEGTQIMRLEIPTRVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSLINQG----SLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVIRLSFVPTQSLTCPTYRLRAEYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTNKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQNFQQPIEQDWLYNLEYIIRTYLPSPSFGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFI-YNQQI---KGGI---------FDGSFEPIDILDSKFLP-TNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNA-------EIIQRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYNRSIYQTVELYSNHICNVFGSYQCPYSPYFNVASSTVEINFLFVFAIIVASLL 4903
            Q++E YKL PM SY+ILAP RIR  +L Q SV+I +LLY  LTIR++IK N  E I     FK+ GT+IM+L++P   A    Y+L V GS+  N++I+FSN T+L F+ +  S+FI +SKP+YHQ Q V+FRVIP+ P+L P +G++ +I  ++ +G + KRW+NP T++GGI E+ FPL+DQV EG W I    E++ + K+F VKEYW P +DVN+TLP++++D   G YG+I AN TSG  V+GNA++ +++R    DR+T  P  +  R +   +G  DF   M E+R  I+      SLA  ++WVN T F+ + +  RTGWA+T +YS +  +KFLGG+VRPFKPNM FT ++ VY  DG+    + NR V +  YC+D+   ++ + L + D GVI  ++ P+    C TYRL A Y+++ +R++S  +QRLF   S SG Y+Q++ +T  P+VNEY V  +  +YPT+KI   VV+ GNI+  D + M N+V +RTFSI++SR M PV+ +VAY++K + E+VSDSLTF++N TNLNNV + VNRGKDLN DT+EI GY +PGS++A +V+H DLY+ G  + LR+Y+I+DE+ +YEQ+ Q P+   W  +   I R YLP  S GADTN+TMNSSGLIIF+DAN+T  NFY+TCNET + ++ALPCYS TG+ CYSR+ERCDG NQC  W+DE+ CPE  A   P+P  ++  FD+L R WNDGAWLW + ++K +G+I FRVDLPKM+  WV GA+++D E G +++ +P +FSG RRFYM VE+PEE  +GEQ+GVR  LFN W+YW EAL+EVK S   R +QV   G   A+ PE   NKSV +L YL AG +++I+ P+     G    N + +ICAY+FIGSNCE   I + MNGVTNY+HT + +DLTS + L V NFKI + Q F  PE R+ R+VP S+ A +S+VGD +GP  S K Q+ DT   LR+++ +AEN+FFE GYN+ LL Y+        +V  N L YC+ +LQ   SYF+   G FSNFR+  +  + L TA ALW+LL   +  W+R IY+ ++      N++   QQ    +GG            GS+   +++D +F P  N +      D E  RRIP TAMVI+++   +   P+         I+  A  F+ RH++N  DLFSQ+IGTYAL  +  +    KIS  +  I    R+ G   Y+++  + P   E   AG  + NPRLE PNDG    C+++  LL  E   W       ++ + +LA  RNHV+GF STFDS  A+     F+  D NR LY++ V+  +SS   W     I   NY+    TT P + VWG+  +  +GTGR+L+QL VE  V      K PRNP   +   ++F+I C   F  +N+SI+IM  CG W+G       P++GM VF++ LPTG++ LND+LRRYV S   P LRYAR     +HFY   +    TCV F A+RY+PVAN+++ H CSAYEYYEPGRYN S+Y  V LY+N+ICNV GS+ CPY P +N+++  V+++   + +I +  L+
Sbjct:   19 QKQEGYKLDPMTSYVILAPNRIRANELVQISVSIFELLYEQLTIRLAIKVNSTEIISSREVFKSTGTRIMQLKVPN-YARTGTYWLHVEGSIVSNASILFSNLTKLTFSEQSESIFIHVSKPIYHQSQIVRFRVIPMLPDLTPAYGSLVSIDVLDASGNLFKRWLNPMTNIGGIIELDFPLSDQVHEGVWLIRANHERFSAEKTFQVKEYWRPLWDVNVTLPLRITDNQLGFYGLISANYTSGKAVKGNATVLIQLRKSGPDRWTNPPRAEFRRYLLALDGIGDFFIRMSEIRQAISSSTTDSSLANTEIWVNVTYFNWWEKSHRTGWAFTKVYSSNPLIKFLGGMVRPFKPNMYFTVYMVVYMADGSMVKYSGNRKVTLSFYCLDNTFENQIT-LPISDDGVIHYTYRPSGE-GCITYRLEARYIDETDRILSNDQQRLFAVNSYSGVYLQLSTSTLLPKVNEYMVIHVQTNYPTDKIHYVVVSSGNILATDQLRMPNAVTSRTFSIAVSRFMFPVSHIVAYFIKDNSEIVSDSLTFYTNYTNLNNVQMQVNRGKDLNQDTLEIRGYAKPGSYMAFSVIHADLYAIGGASFLREYDIVDELMSYEQHSQAPLVHTWYDDFRDIKRVYLPISSNGADTNSTMNSSGLIIFTDANFTKANFYHTCNETENPARALPCYSLTGRDCYSRSERCDGINQCATWIDEMDCPE-NATKNPQPLRLINTFDILNRQWNDGAWLWHSTFVKADGQIQFRVDLPKMNADWVAGAFSVDSELGLALMAQPYLFSGTRRFYMTVELPEEAVWGEQIGVRACLFNNWNYWVEALVEVKASPDIRFIQVGLEGRVSAYAPEVSINKSVQSLAYLEAGTSRYIYMPVSPKLPG----NTSFTICAYSFIGSNCETHTIYVRMNGVTNYFHTASFLDLTSSSTLFVNNFKIIVPQKFTIPERRLQRFVPGSQKAILSVVGDFIGPALSEKFQYADTQNILRLTYASAENVFFELGYNMNLLLYLHGAGHLPYSVLENGLIYCSVVLQKGFSYFNPKIGAFSNFRDRLDETDPLVTAIALWSLLLTRQTQWNRLIYVDDDTFVRIINYLKITQQFSSYEGGTDSQSTIDVRLSGSWNITNVVDRRFSPIINKTKWPDPIDQECHRRIPSTAMVIIALRSTERTLPSGVGADKTEGIVSEAVRFLSRHILNIDDLFSQMIGTYALKVAVDATSQHKISQALKRI-EAFRHKGDYVYYANYRIPPPKWELDQAGRRIENPRLEMPNDGYGVLCSSIYFLLKHELGEWSFRSSEALDMVHWLASERNHVAGFASTFDSLFAMHALRKFALADTNRALYRMAVDEKISSMNTWANRIYIDTHNYSTVTHTTFPPEDVWGDITMKLEGTGRVLLQLGVEVNVEYKEMQKMPRNPLDTEQILRSFEIECTPGFLSRNNSIMIMTACGRWVGTTGVEPLPQSGMAVFEIGLPTGFIVLNDDLRRYVNSLMVPNLRYARANNRFVHFYFDTITPDTTCVQFTAERYYPVANITQQHRCSAYEYYEPGRYNNSLYNVVSLYTNNICNVCGSFACPYCPDYNLSNKRVQLSISVICSIFIIRLI 1608          
BLAST of CD109 antigen vs. TrEMBL
Match: A0A4V3SF51 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004976 PE=4 SV=1)

HSP 1 Score: 1425.61 bits (3689), Expect = 0.000e+0
Identity = 709/1572 (45.10%), Postives = 1023/1572 (65.08%), Query Frame = 2
Query:  209 PMPSYIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRNDFEYIHETTTFKTEGTQIMRLEIP--TRVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSLIN----QGSLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVIRLSFVPTQSLTCPTYRLRAEYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTNKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQNFQQPIEQDWLYNLEYIIRTYLPSPSFGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPE-NLIQVATNFIYNQQIK---GGI------FDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPN---AE----IIQRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYNRSIYQTVELYSNHICNVFGSYQCPYSPYFNVASSTV 4855
            P+ SYIILAP RIR  +L Q +V+I +L YP L+IR+SIK +  E I     F++ GT++M+L++P  TR A    Y+  V GS+  NS+++F NRT+LEF P+  S FIQ+SKPVYHQ Q V+FRVIP+ P+L P++G++ +I+ ++ +G + +RW+NP T+ GGI E+ FPL+D V EG WTI    E + + K+F V EYW P +DVN+T+P+++ D     YG + AN TSG  VRGNA++ +++R+    R+      Q+ R ++  +G A FL T+D++R  I       SLA  ++WVN T +  +   VRTGWAYT I+S    ++FLGG VRPFKPNM FTA++ V+ PDG+      +R + ++ +C ++  +    NL+VPD+G++  ++ P+    C TYRL+A+Y+++ +R+++   QR+F+Y+S S  ++Q++ +T  PRVNEY V  +  +YPT+ I   +V+ GNI+  D + M N++ +RTFS+++SR M P A ++AY++K   E+VSD+LTF++N TNLNNV++ VNRGKDLN DTVE+ G+  PGS+LA+NV+H DLY   A +ILR++NI+DE+  Y    Q+P    W  N+  + R Y+P+PS GAD NTTMN SGLI+F+DAN+T  NFY+TCNET+D ++ALPC+S TG+ CYSRAE+C+G  +C+ WVDE+ CP   ++  P+P   + ++++LYR WNDGAW+W + ++KP+G+I FRV+LPK++  W+ GA+A+D + G S++++P  F+GIRRFYM VEV EE  +GEQLGVR+ LFN WDYW EAL+E+K S + RV+Q+   G T A+ P+T  N+SV TLV+L AG +K+I+ P++    G    N++ +ICAY+FIGSNCE  E++++MNGV N+YHT   +DLTS + L V NFKI + Q +  PE RM R+VP S+ A +S+VGD +GP       F  T   LRM +G+AE++FFE GYN+ LL Y+      S +V    L YC+ +LQ   S+F+   G F+NFR+  +RP+ LATAFALWNLL   +  W+R IY+ +   I++       QQ     GG         GS+E  +++D +F P  IS      D EA RRIP  AMV+++        P+   AE    ++  A  FI RHL+ + DLFS +IGTYALS +  S    KI  +   IM+  R  G+  YF++  + P   E   AG  + NPR E PNDG   A T+   LL ++   W  +    M+ + +LA  RNH+SGF+STFDS VAL     F+ +D NR LY++ V+  +SS  +W     +  SNY+    TT P   VWG+  +  +GTG LL+QLDV   V      K PR+P +++   ++FDI C   F G+N+SI+IM  CG W+G        ++GM VF + LPTGYV LND+LRRYV SG  P LR+AR W   + F+   +   +TCV F+A+RY+PVAN ++  +CSAYEYYEPGRYN S+Y  V LY+NHICNV G+Y CPY P +N A   V
Sbjct:   27 PLTSYIILAPNRIRANELVQVTVSIFRLFYPQLSIRISIKIDTDEIISALEVFRSPGTRLMQLKVPDYTRNA---TYWFHVEGSIVANSSLLFFNRTKLEFMPQSASFFIQVSKPVYHQSQIVRFRVIPVLPDLTPLYGSLVSIEVLDASGNLFRRWLNPMTNTGGIIELDFPLSDMVHEGEWTIRATHELFSASKTFRVVEYWRPLWDVNVTVPMRMLDNELAFYGFVSANYTSGKAVRGNATVLIQLREAGDSRWIMPARAQLTRKLHAVDGIASFLITLDDIRRAITGTGASTSLANTEIWVNVTYYSWWEMDVRTGWAYTQIFSSTPMIRFLGGQVRPFKPNMYFTAYIVVFMPDGSMVQYFGSRRIRLQFFCNENTPSSPAVNLVVPDNGLVTYTYRPSGE-GCVTYRLQADYMDETDRILATRNQRIFQYHSYSDTFLQLSTSTLQPRVNEYFVVTVQTNYPTDTIHYVIVSNGNILVADQLRMPNAITSRTFSVAVSRSMFPFAHLIAYFIKDGSEIVSDALTFYTNYTNLNNVHLEVNRGKDLNQDTVEVRGHATPGSYLAVNVIHSDLYKFAAASILREHNIVDELVAYNGQSQRPFVHTWYDNMMDVQRVYVPAPSIGADANTTMNVSGLILFTDANFTKANFYHTCNETLDPARALPCFSMTGRDCYSRAEQCNGIAECVTWVDEMNCPINESD-LPQPSRTIDSYNVLYRLWNDGAWMWHSTFVKPDGQIQFRVNLPKLNADWIAGAFAVDEQLGMSLMQQPYYFAGIRRFYMTVEVVEEAVWGEQLGVRLCLFNNWDYWIEALVELKASPEIRVIQIGFGGRTSAYSPKTSVNESVQTLVFLEAGSSKYIYMPVLPKEPG----NSSFTICAYSFIGSNCETHEVRVTMNGVPNHYHTATFLDLTSSSALFVNNFKIIVPQKYTIPERRMHRFVPGSQFASLSVVGDCIGPALHSNFPFATTQNVLRMGYGSAESVFFELGYNLNLLLYLYGSPGLSQDVEREGLLYCSVVLQRGFSFFNPALGAFANFRDELDRPSPLATAFALWNLLLTRQPQWNRLIYVDDPTFIRIIDYLASTQQTSSSMGGTTSVDVRLAGSWEVGEVIDRRFAP--ISNATDPIDREAHRRIPCAAMVVIAFRSTGRPMPSGIGAERAEVVVASAVQFIARHLLQTNDLFSLMIGTYALSVATDSTSQQKI-MLAMQIMDQYRRKGEYIYFANYPIPPPKWELDQAGRRIENPRWEMPNDGYGVASTSFYFLLKRKLGEWNVHMTEAMDVVHWLASQRNHISGFSSTFDSLVALHALREFALSDTNRALYRMAVDEKISSISDWTNRIYVDRSNYSTVTRTTFPPWDVWGDVTMKVEGTGWLLLQLDVRVNVEYPQMQKMPRSPQNLEEVMRSFDIECIPGFRGRNNSIMIMKACGRWVGTTGVEPLSQSGMAVFSIGLPTGYVVLNDDLRRYVMSGQVPNLRFARTWTKTVDFFFDTITTNETCVQFQAERYYPVANTTQQQVCSAYEYYEPGRYNHSMYNVVSLYTNHICNVCGAYACPYCPDYNEAKRKV 1586          
BLAST of CD109 antigen vs. TrEMBL
Match: G7Y523 (CD109 antigen OS=Clonorchis sinensis OX=79923 GN=CLF_101128 PE=4 SV=1)

HSP 1 Score: 1421.37 bits (3678), Expect = 0.000e+0
Identity = 715/1602 (44.63%), Postives = 1031/1602 (64.36%), Query Frame = 2
Query:  203 LPPMP-SYIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRNDFEYIHETTTFKTEGTQIMRLEIP--TRVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSLINQG----SLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVIRLSFVPTQSLTCPTYRLRAEYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTNKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYN------IIDEMKTYEQNFQQPIEQDWLYNLEYIIRTYLPSPSFGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPE-NLIQVATNFIYNQQIK---GGI------FDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPN------AEII-QRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYNRSIYQTVELYSNHICNVFGSYQCPYSPYFNVASSTVEINFLFVFAIIVASLLDQLHL 4918
            LP  P SYIILAP RIR  +L Q +V+I +L YP L+IR+SIK +  E I     F++ GT++M+L++P  TR A    Y+  V GS+  NS+++F NRT+LEF P+  S FIQ+SKPVYHQ Q V+FRVIP+ P+L P++G++ +I+ ++ +G + +RW+NP T+ GGI E+ FPL+D V EG WTI    E + + K+F V EYW P +DVN+T+P+++ D     YG++ AN TSG  VRGNA++ +++R+    R+      Q+ + ++  +G A FL T+D++R  I       SLA  ++WVN + +  +   VRTGWAYT I+S    ++FLGG VRPFKPNM FTA++ V+ PDG+      +R + ++ +C ++  +    NL+VPD+G++  ++ P+    C TYRL+A+Y+++ +R+++   QR+F+Y+S S  ++Q++ +T  PRVNEY V  +  +YPT+ I   +V+ GNI+  D + + N++ +RTFS+++SR M P A ++AY++K   E+VSD+LTF++N TNLNNV++ VNRGKDLN DTVE+ G+  PGS+LA+NV+H DLY   A +ILR++N      I+DE+  Y    Q+P    W  N+  I R Y+P+PS GAD NTTMN SGLI+F+DAN+T  NFY+TCNET+D ++ALPC+STTG+ CYSRAE+C+G  +C+ WVDE+ CP   ++  P+P   + ++++LYR WNDGAW+W + ++KP+G+I FRV+LPK++  W+ GA+A+D + G S++++P  F+GIRRFYM VEV EE  +GEQLGVR+ LFN WDYW EAL+E+K S   RV+Q+   G T A+ P+T  N+SV TLV+L AG +K+I+ P++    GN    ++ +ICAY+FIGSNCE  E++++MNGV NYYHT   +DLTS + L V NFKI + Q +  PE RM R+VP S+ A +S+VGD +GP       F  T   LRM +G+AE++FFE GYN+ LL Y+      S +V    L YC+ +LQ   S+F+   G F+NFR+  +RP+ LATAFALWNLL   +  W+R IY+ +   I++       QQ     GG         GS+E  +++D +F P  IS      D EA RRIP  AMV+++        P+      AE++   A  FI RHL+ + DLFS +IGTYALS +  S    KI  +   IM+  R  G+  YF++  + P   E   AG  + NPR E PNDG   A T+   LL ++   W  +    M+ + +LA  RNH+SGF+STFDS VAL     F+ +D NR LY++ V+  +SS  +W     +  SNY+    TT P   VWG+  +  +GTG LL+QLDV   V      K PR+P +++   ++FDI C   F G+N+SI+IM  CG W+G        ++GM VF + LPTGYV LND+LRRYV SG  P LR+AR W   + F+   +   QTCV F+A+RY+PVAN ++  +CSAYEYYEPGRYN S+Y  V LY+NHICNV G+Y CPY P +N A             +I+   L Q +L
Sbjct:  123 LPFKPRSYIILAPNRIRANELVQVTVSIFRLFYPQLSIRISIKIDTDEIISALEVFRSPGTRLMQLKVPDYTRNA---TYWFHVEGSIVANSSLLFFNRTKLEFMPQSASFFIQVSKPVYHQSQIVRFRVIPVMPDLTPLYGSLVSIEVLDASGNLFRRWLNPMTNAGGIIELDFPLSDMVHEGEWTIRATHELFSASKTFRVVEYWRPLWDVNVTVPMRMLDNELAFYGLVSANYTSGKAVRGNATVLIQLREAGDSRWIMPARAQLTKQLHAVDGIASFLITLDDIRRAITGAGASTSLANTELWVNVSYYSWWETDVRTGWAYTQIFSSTPMIRFLGGQVRPFKPNMYFTAYIVVFMPDGSMVQYFGSRRIRLQFFCNENTPSSPAVNLVVPDNGLVTYTYRPSGE-GCVTYRLQADYMDETDRILATRNQRIFQYHSYSDTFLQLSTSTLQPRVNEYFVVTVQTNYPTDTIHYVIVSNGNILVADQLRLPNAITSRTFSVAVSRSMFPFAHLIAYFIKDSSEIVSDALTFYTNYTNLNNVHLEVNRGKDLNQDTVEVRGHATPGSYLAVNVIHSDLYKFAAASILREHNASAYIFIVDELAAYNGQSQRPFVHTWYDNMMDIQRVYVPAPSIGADANTTMNVSGLILFTDANFTKANFYHTCNETLDPARALPCFSTTGRDCYSRAEQCNGIAECVTWVDEMNCPINESD-LPQPSRTIDSYNLLYRLWNDGAWMWHSTFVKPDGQIQFRVNLPKLNADWIAGAFAVDEQLGMSLMQQPYYFAGIRRFYMTVEVVEEAVWGEQLGVRLCLFNNWDYWIEALVELKASPDIRVIQIGFGGRTSAYSPKTSVNESVQTLVFLEAGSSKYIYMPVLPKEPGN----SSFTICAYSFIGSNCETHEVRVTMNGVPNYYHTATFLDLTSSSALFVNNFKIIVPQKYTIPERRMHRFVPGSQFASLSVVGDCIGPALHSNFPFATTQNVLRMGYGSAESVFFELGYNLNLLLYLYGSPGLSQDVEREGLLYCSVVLQRGFSFFNPALGAFANFRDELDRPSPLATAFALWNLLLTRQPQWNRLIYVDDPTFIRIIDYLASTQQTSSSMGGTNSVDVRLAGSWEVGEVIDRRFAP--ISNATDPIDREAHRRIPCAAMVVIAFRSTGRPMPSGIGAERAEVVVASAVQFIARHLLQTNDLFSLMIGTYALSVATDSTSQQKI-MLAMQIMDQYRRKGEYIYFANYPIPPPKWELDQAGRRIENPRWEMPNDGYGVASTSFYFLLKRKLGEWNVHMTEAMDVVHWLASQRNHISGFSSTFDSLVALHALREFALSDTNRALYRMAVDEKISSISDWTNRIYVDRSNYSTVTRTTFPPWDVWGDVTMKVEGTGWLLLQLDVRVNVEYPQMQKMPRSPQNLEEVMRSFDIECIPGFRGRNNSIMIMKACGRWVGTTGVEPLSQSGMAVFSIGLPTGYVVLNDDLRRYVMSGQVPNLRFARTWTKTVDFFFDTITTNQTCVQFQAERYYPVANTTQQQVCSAYEYYEPGRYNHSMYNVVSLYTNHICNVCGAYACPYCPDYNEAKRKFSKKTTVSLLVILTLWLTQQYL 1712          
BLAST of CD109 antigen vs. TrEMBL
Match: A0A0X3QFD0 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR99363 PE=4 SV=1)

HSP 1 Score: 1420.22 bits (3675), Expect = 0.000e+0
Identity = 692/1592 (43.47%), Postives = 1019/1592 (64.01%), Query Frame = 2
Query:  173 ATAQRKESYKLPPMPSYIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRNDFEYIHETTTFKTEGTQIMRLEIPTRVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSLINQGSLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVP--DSGVIRLSFVPTQSLTCPTYRLRAEYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTNKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQNFQQPIEQDWLYNLEYIIRTYLPSPSFGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPK-NMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYI-PENLIQVATNFIYNQQIKGGI---FDGSFEPIDILDSKFLP-TNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEIIQRATA-------FIDRHLINSIDLFSQIIGTYALSKSGTSAYSGKISTMITTI-MNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYNRSIYQTVELYSNHICNVFGSYQCPYSPYFN-----VASSTVEINFLFVFAI 4885
            ATAQ    Y+LPP+PSY++LAP+RIRP Q  Q SV I+++LYP LTIR+SIK+   E I  T  F + GT+ M + +P + A   +Y+  + GS++ NS+++F NRT++EF+PK  S+ IQ SKP+YHQ Q V+FRV+P+ PNLMP +G++ +I  ++ +  + KRW+NP T++GGI E+ FPLADQV EG WTI  + EK+ + K+F V EYW P +DVN+T+  + +D  F + G+IQAN TSG +VRGNA++T+E+R+   D +   P +Q+ + I + +G ADFL  + +L+  I   SLA  DVW N +V++ + + V +GW +T I+S    +KFLGG VR +KP M FT ++ VY  DG + +   N  V +  YC +        N+++P  D  VI+ +F P    TC T RL+A Y+++ N +++   QRLFKYYS S  Y+Q+T +T  P+V +Y V  ++ +YP + I   + AGGNI+  D IVM NSV  R+FS++IS++MAP+ RVVA+ VK DGE+V+DSLTFF+N +NLNNV++ VNRGKDLN+DTVEI G+  PGS+LA NVLH DL+   + + +++ +++DEM +YE   Q P+   W  ++E + R YLP+P++GAD NTT+  SGL++ +DAN+T  NFY+TCNET + ++ALPCYSTTG++CY+R++RCDG  QC+ W DELGCPE  +     P    L +F+MLYR WND  WLW +  +KP+G+I FRV LPK++ +WV GA++ID  +G ++++RP  FSG RRFY  +EVPEE  +GEQ GVR+ +FNYWDYW EAL+ VK +    V++V   G+T A+      N++V TL+YL AGE+++ F P++    GNN    + +ICAY+FIGSNCE R I++ MNG+TNY+HT+  +DLTS + L V NF++ + Q F   E+R  R+VP S++  VSI GD++GP+ S   ++ DT   LR+S+GAAEN+FFE GYN+ L+ Y+R       +V    +NYC  +LQ   +YF++ +G F+NFR+  N  + L TAFA+WN+L     +W+RYI++  E  ++  T  +  Q+    +     GS+     +D +F P  N +      D EA RR+   AMV++S+       P+    +RAT        FI  H++N  DLF++II TYAL  +  +    +++  +  I +   R D    Y+++  +     E   +G  + NPR+EWPNDG    C+A+  L+  E N W       ++ + +L   RNHV+GFTSTFDS +AL     F+  D+NR LY++ V   +SS  +W     I   NY+    T  P + VWGE  +   GTG + +Q+DV+  V      K PRNP   +   ++FDI C   F G+N+S + M +CG W+G ++     E+GM VF+V +PTG V LN+ELR +V  G+ P LRYARF PG +HF+  KL   + CV + A R++PV+NV+   +C AYEYYEPGRYN S+Y+ + +Y+N ICNV G++ C Y P +N     +AS  + +  L V A+
Sbjct:   22 ATAQLTGGYQLPPVPSYLMLAPRRIRPDQDVQVSVFILRMLYPQLTIRLSIKKGVMELISTTVVFISAGTRTMHMRVPNQ-ASIGEYWFHLDGSLSPNSSLLFQNRTKIEFSPKTVSLLIQTSKPIYHQSQIVRFRVVPVQPNLMPWYGSLVSIDVLDASKNVFKRWLNPMTNIGGIIELDFPLADQVNEGEWTIRAQHEKYTAEKNFSVVEYWAPLWDVNVTMMPRFTDDAFALTGLIQANYTSGKYVRGNATVTIELRERGPDMWAKPPAVQLTKHIRWLDGLADFLVPLKDLQQQITGASLASMDVWANVSVYNWWEKDVHSGWGFTQIFSAKANIKFLGGTVRTYKPKMYFTVYMVVYTADGRQLLFIANHKVRLTIYCAEGAV---LRNVLLPISDDSVIQYTFRPAGE-TCSTLRLQASYIDENNVVLATDFQRLFKYYSPSSTYLQLTTSTPQPQVGQYMVINVETNYPVDTIHYLISAGGNIITADRIVMPNSVSIRSFSVAISKEMAPICRVVAFCVKNDGEIVADSLTFFANYSNLNNVHMEVNRGKDLNLDTVEIRGHATPGSYLAFNVLHSDLFRFDSPSFIQENDVVDEMFSYEAEAQLPLMFTWFDSVELVNRVYLPTPTYGADANTTIEKSGLVLLTDANFTKANFYHTCNETENPARALPCYSTTGQECYARSQRCDGVQQCVTWADELGCPENKSLAMQPPVLRRLGSFEMLYRDWNDAGWLWYSTVVKPDGQIQFRVPLPKIEAAWVAGAFSIDPNQGLALMQRPYRFSGARRFYFTLEVPEEGFWGEQFGVRVCVFNYWDYWVEALVVVKANPDVGVLKVGYGGLTTAWAAAFTVNQTVETLLYLEAGESRYAFMPVLPRHLGNN----SFTICAYSFIGSNCETRSIRVRMNGITNYFHTSRFLDLTSSSNLFVNNFRVIVPQKFTVVEQRAHRFVPGSQVGVVSITGDVIGPSLSKNFEYADTENTLRLSYGAAENVFFELGYNLQLMLYLRGAGYLPPDVQTKGVNYCAVVLQRGFTYFNTEAGAFANFRDELNGTHALPTAFAIWNMLLARLTEWERYIFVDDETFVRSITFLLQTQENSSKVNIRLRGSWPVPYAVDRRFTPEINATAWPDPIDREAHRRLATAAMVVISLRGAGQTPPSGLAAERATTVVNLAVEFIRLHILNVDDLFTKIISTYALQVAAGANAQNELTQALNQIELRQLRED--HVYYANYRIPAPIWEMDQSGRRIENPRMEWPNDGYGVVCSALMFLIKLETNAWTPAVDEALDMVHWLTTQRNHVAGFTSTFDSLMALFALRKFALADKNRALYRMAVNQKISSLNSWEPRLFIVPDNYSTLARTVYPPEDVWGEVTMQVDGTGLITLQMDVDYNVEFPDIQKEPRNPEDFNEYLRSFDIECTPAFWGRNASFMRMTVCGQWVGNHAFEPLKESGMAVFEVGVPTGMVVLNNELRDFVRRGAVPNLRYARFRPGTVHFFFDKLTSERVCVEYNASRFYPVSNVTLQQVCLAYEYYEPGRYNNSLYEVMPMYTNTICNVCGAFMCSYCPDYNGVVCSLASWGILLTLLMVSAL 1602          
BLAST of CD109 antigen vs. Ensembl Cavefish
Match: cd109 (CD109 molecule [Source:NCBI gene;Acc:103033754])

HSP 1 Score: 161.77 bits (408), Expect = 2.917e-39
Identity = 254/1167 (21.77%), Postives = 465/1167 (39.85%), Query Frame = 2
Query: 1352 NLIVPDSGVIRLSFVPTQ-SLTCPTYRLRAEYLEDGNRLISWSEQRLFK-YYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTNKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEIN-GYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQNFQQPIEQDWLYNLEYIIRTYLPSPSFGADTNTTMNSSGLIIFSDANYTMV-NFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPN-AEIIQRATAFIDRHLINSIDL-FSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQL----DVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYNRSIYQTVELYSNHICNVFGSYQCPY 4822
             L VP  G+I    +P Q S T  T  + A+Y +  N L       L++ Y S S +Y+Q+  A    +V +     ++ ++P  +    V++ G +V   T        +  F++S      P A V+ Y + +DGE++SD+L      T  NNV++   R +    + V ++    EPGS + + V+      +G+ ++ R  ++ +E   YE           L     ++   L   S   D  +   +S + + +DAN   V N+Y   N+ +++          G Q +S  +         N       PET                          WLW   ++  N  +   + +P   TSWV  A+ I    G      P      + F++ + +P     GE L + +TLFNY D   E ++EV++S  +  V   E  +              H  V+   G    + FPI    K  +     IS+ A +   S+   + I +   G+   +     ++             +  +  F  P    +  V  S+ A V+ VGDI+GP+    +  +DT   ++M +G  E     F  N+Y+L+Y+         +    +NY  +  +  LSY     G FS F +S    +T  +AF L   L         +I+I E+++    +++  QQ   G F    EP      + + T +   L ++       + +TA VI++  +  + S N A  +  A  ++   L   I   +S  + TYALS     A S    + ++ +M+ A+       +S  D            + +I+    W          +  +L + +Q   ++        + +L++ R+H+ G+ ST D+ +A++   ++++ +   +     +++T+++  +    + I  SNY +     I         V  A G G  L QL    +VE +   + R ++     +  +     DIN  + +         ++IC   L  N  ++  + GM + +V L TG+    D +          L++     PGK+  YL  + +++ CVT      F V +V +D + + Y+YYEP R     Y +       IC+ F    C Y
Sbjct:  438 QLPVPADGIIS---IPIQLSETVATLTIEAQYEDQQNSL------HLYRGYLSPSDSYIQL-QALSPSQVGQPLKINVESNFPLPQFHYMVISRGQVVDAGT------SSSSVFTLSPDFAWVPHASVLVYCIHSDGEIISDALYISFTQTMRNNVSLSWERERAEPAEAVSLSISVAEPGSLVGILVV-----DKGSQDVDRSNDLTEEKVMYE-----------LDKFNGVLFPPLAGTSM-MDPYSMFMASDVTVLTDANLNPVYNYY--INDFIEE----------GVQMFSMKQD--------NLQPRKNFPET--------------------------WLWLESYMSENTTLPLHLTVPDSMTSWVATAFVISENLGIGF-SAPTELVVFKDFFLSLSLPAYVIRGELLLLEVTLFNYMDQELEVMVEVQESSMFEFVSPIEDSMPGVR----------HVSVWSQNGTT--VQFPI----KAIDLGQIPISVKAVSNYASDSVYQTILVKPEGMEESFTQTLFLEFPPLQN------DLHKKLDFIFP----VNVVSGSQRAVVTAVGDILGPS----ISGLDTL--IQMPYGCGEQNMINFAPNVYVLQYLSSTGQADEKIRTTAINYLTQGYERELSY-QREDGSFSAFGDSDPSGSTWLSAFVLRCFLQAR-----AFIFIDESVLLRTASWLIAQQTSDGAFK---EP-----GRVIHTELQGGLDSS-------VSLTAYVIMAFLEDVSYSSNYAGQVSLAVNYLTLKLSEGISSNYSLCLVTYALSL----AKSPSAGSALSELMSRAKMQDNVPVWSSPD------------SGLID---SWQPRSADIEMASYTLLSYYQQGSVEQ----GFTLMKWLSQQRSHLGGYGSTQDTVIAMQALSTYASLNSGEQ---TDIDITVTNPMDKVANFTINQSNYLLYQSQEIEATEELHIHV-SAVGKGIALFQLTTFYNVEAKEL-SRRRRDAHTNEAFHMDINVMDINLYSIY---------INICFR-LSENQVLD--QTGMAILEVGLLTGFSLAQDGITL------NSLVKKVETPPGKVILYLDSVTKSEECVTIPTLLEFKVTSV-QDAVVALYDYYEPRRRTVRTYTSEARQDMPICS-FCEGDCSY 1423          

HSP 2 Score: 88.5817 bits (218), Expect = 5.938e-17
Identity = 68/233 (29.18%), Postives = 107/233 (45.92%), Query Frame = 2
Query:  215 PSYIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRNDFEYIHETTTFKTEGTQIMRLEIPTRVAPP---DD------YYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGI 886
            PSY+I   K +RPG     SVT +K   P L +         E IH  T+ +T+ + I       +V PP   DD      Y L V G       +++ N T L +  +  ++ +Q  KP Y  GQ V+ R + + P+  P    I  +  ++P   +V +W++  TSVG     +F L+D    GNW I   +++    + F V  Y LP+F+V +  P  L  +   VY +
Sbjct:   29 PSYLIAVFKTVRPGLPVTVSVTNLKQ-SPVLVVS--------EIIHGNTSIQTQNSTIEAGSTARQVLPPIPEDDQSYWIPYELRVRG--YSEGILVYCNSTSLRYELQGMAILLQTDKPKYKPGQAVKIRAVVITPDGKPCDKRIDLV-IMDPKRNMVHQWLSVETSVG-TASREFQLSDNPPLGNWVIAASMKEVAQEQVFTVSHYVLPKFEVLVNAPDVLYYEDHLVYTV 248          
BLAST of CD109 antigen vs. Ensembl Cavefish
Match: c4 (complement C4-B-like [Source:NCBI gene;Acc:103045695])

HSP 1 Score: 158.688 bits (400), Expect = 2.287e-38
Identity = 323/1527 (21.15%), Postives = 596/1527 (39.03%), Query Frame = 2
Query:  524 VFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKW---KSRKSFHVKEYWLPRFDVNI--TLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKAD-FLFTMDELRSLINQGSLAFKD--VWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVT----TINRNVNVKAYCIDSVKTDEFSNLIVPDSGVIRLSF-VPTQSLTCPTYRLRAEYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEY----PRVNEYAVFQIDMSYPT----NKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYVKTDGE--VVSDSLTFFSNITNLNNVNIGVNRGKDLN-MDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQNFQQPIEQDWLYNLEYI----IRTYLPSPSFGA------------DTNTTMNSSGLI-IFSDANYTMVN-------FYNTCNETVDKS--QALPCYSTTGKQCYSRAERCDGTNQCINWVD-ELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENR---EIKISMNG-VTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKV-SIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYI------------RRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNT-LATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAV---SPNAEII---QRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQL---------------------DVEGRVF------DAVRLKNPRNPSSVDLPFQT---------FDINCRAKFSG----KNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYNRSIY 4759
            +FIQ  KP+Y+ G+ V FR+  L  N M     +  ++  N  G +V   +  +     I+     + D    G+W I      +   ++   F V+EY LP F+VNI  T P    +  F  + I  A  T G    G A +   + D   +R T  P   I + I   +G+AD  L+T D L +  NQ     +   +++ ATV +  +  +    + +    +   V  L    + F P   F+   +   PDG+K  T    T    VN      D +  +   N    + G I  +F VP ++ T          +E G   +  S+  +    +Q      +++  ++    P  N    F+ D++ P     + I+  V++ G ++ V  +  Q S  T T S+  S DM P  R++AYY    G   +V+DS+           V I +   KDL   +  E+    +P S +AL+ +   +Y     N L    + D M +Y+        +D    L+ +    I ++L SP                 T   ++ S L   F  A+    +          +C+E + K+  Q+  C     K C + A R     + IN +   LG          + + ++    +  R +   +W+W       +G I ++   P   T+W + A A+   KGF + + P      + F++ V++P   +  EQL V+  ++NY     +  + +K++D          G+  A + + + + SV      +A    F   P+++           I I    +   + ++R   E+++   G + + Y   N+   T K          +   +   PE+     VP+   A + S  G ++G +    L        +++  G AE    +    ++ +KY+            RRD   S+     T           +  F  + G +  F     RP++   TAF     +A    +    I + ++ IQ + +++ ++Q  GG +D   +P  + D     T +   +  T  EA    P+TA ++++++  K       + E+I   ++A +++ ++     + ++  I  YALS  G +    + +T    +M  A  D +  +++          +  +G       L+   D ++   TA  +L    Q +  ++    +   ++L + R +  GF ST D+ VAL     FS  + + E   L+VE+ +    N +ET  +  + Y       +    V GE  L   G GR  + +                      V+G +       +  +L +  N  S D              FD+  R K       K  +IL+  +C    G NS      +GM V D+ L +G   +  +L   V+ G++  + +  F   K+  Y  KL + + C+ FR ++  P+  + +      Y+YY P R   + Y
Sbjct:  138 IFIQTDKPIYNPGELVNFRIFTL-DNYMKPIDDLIYVKITNSRGLMVYSHLLRSEQ---IFRRSVRIPDVELAGHWKITASYYNYGMSETSVEFEVREYVLPMFEVNIEATKPYLTLNSEFFPFSIT-ARYTYGKGADGIAYVRFGLVDGKGER-TYLP--GIEKQIKVEDGRADCLLYTQDLLSAAANQSLQNIEGMYLYIAATVLEKASGDLEEAESSSVKIVNSPYVVDLSKTKKHFTPGGKFSILGTTTFPDGSKVPTLKKATATVTVNPGGPAEDVLIEENLEN----NKGDIDFTFVVPEKAKTM----FITVSVEGGEEEVIISDANITSTATQPSKNCYLSVEVQHQVLQPGQNLQVTFR-DITPPGTTRPSHIYYMVLSKGRVLMVGKV--QRSDLTST-SLDFSEDMVPSFRLLAYYYTEGGSMGLVADSVWVDVKDVCKGKVEIEIVPFKDLKPAEEFEVLVRTDPDSSVALSAVDSAVYILNKRNKLSPQKMFDYMNSYDLACSVGGGEDSESVLQRVGLTYISSFLESPILNQHKCNKKEEKGHHQTKRDVDLSKLFNSFKHADRKCCDDGRKLGLTLKSCDERLKKTRHQSESCRQAFKKCCEAAAAR--RKREKINSMKLSLG---RVLGGDGEEEGLIDEAAIHLRSYFPQSWMWALLDPDVSGNIRYKDVTPDSITTWEVQAVAMSPSKGFCVAD-PKPLRVFQDFFVSVKLPYSVKRNEQLEVKAVVYNYKKEDLKVKVRMKKAD----------GLCSAGEGDVVQDVSVSG---QSAVAVYFTVVPLII---------GKIPINVLAYASPSAQDRIQKELRVVGEGELVSIYKEYNIDAKTDK----------KTEFTLPAPEDE----VPEQDSATLMSFKGGVMGESVDNCLNLDGVDNLIKLPTGCAEQTMVKMSPALHAMKYLDGTNQWAFLKAERRDEAQSMIQAGYT----------TVLTFKKSDGSYGAF---LTRPSSNWLTAF-----IAKEMTNSRSIIQVRDSYIQESMSYLISKQKAGGSWD---DPNPLYD-----TGMKGGVGQTKDEA----PLTAYILIAMTHAKQAYEQGTDTELITAMEKAKSYLVQNFARLQNPYAVTITAYALSLIGQTPQEAQQAT--RKMMEMATCDTKRCFWN--------VREAVSG-------LDSKADAISIEATAYGLL----QAVSLKDKERALRIASWLTQQRKYGGGFQSTQDTVVALEALSKFSIQNNDVEDLDLRVELCI----NDKETKNLHLNKYNALTQAAVQIKEV-GEMSLNINGRGRGTLSILQTYRSLKKEESHCDQFHFSVQVDGELVLKSSEEEEEQLDDYYNYESNDEELAKDEPMSREEWFDLRTRRKRQAPEQPKKENILVYTVCVGIKGRNS------SGMVVVDISLLSGLTPVIQDLEDNVK-GTEKYIDHYDFHHNKVFLYFDKLTEEKDCLRFRVEQIIPIGLI-QPAAAVIYDYYNPDRRCSTFY 1538          
BLAST of CD109 antigen vs. Ensembl Cavefish
Match: cpamd8 (C3 and PZP like alpha-2-macroglobulin domain containing 8 [Source:NCBI gene;Acc:103025510])

HSP 1 Score: 142.124 bits (357), Expect = 2.809e-33
Identity = 178/859 (20.72%), Postives = 338/859 (39.35%), Query Frame = 2
Query:  221 YIILAPKRIRPGQLYQTSVTIVKLLYPT-LTIRMSIKRNDFEYIHETTTFKTEGTQIMRLEIPTRVAPPDDYYLEVVGSVT-DNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSL-INQGSLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVIRLSFVPT--QSLTCPTYRLRAEYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTN-KIFVQVVAGGNIVYVDTIVMQNSVKTRTFSIS------------------------------------ISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQNFQQPIEQD----WLYNLEYIIRTYLPSP---SFGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKP-NGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEV 2647
            Y+I AP   R G     SVT+   +  T + +++S+K     + H T   K  GT  ++L++P+ +       L+V G+        IF N T +  + K  +VFIQ  KP+Y     V   V  + P+L P    I A   ++P G  + +W +      GI  M FPL+DQ   G W + V+++     KSF V++Y  PRF++ +  P  + D        ++A  T G  V G  ++ + +      R        + +T++  +G A F   + ++  L +        ++WV+    D   + +      T ++     +K+     + FKP + +   + V  PDG+     +   V  +    D+V T E ++          +  +PT  Q +   T  +  +    G++ +  S   +  +YS S  ++Q+   T    + +     +  + P N  +  ++ + GNIV        ++ ++R  +++                                    I+  MAP++R++ YYV+ +GE V+DSL         N V++ ++  + +   +V ++  GE GS + +  +   +Y       L    +  E+  ++ +    + +D    W   L    R     P       D       +GL++ +D    MV   +     +   +A+P +                             P T+       ++  R      R +    W+W    +    G    R+D+P   T+WV  A  +  +KG  +  +PA     + F++   +P     GEQ  V +T++NY    TE  ++V
Sbjct:   31 YLIAAPSVFRAGVEEAVSVTLFNTVDETRVQVQLSVKGETVAHSHGTVLDK--GT--IKLKVPSDLR--GQAILKVWGNRHLTEGGYIFHNHTTVTIDSKGTAVFIQTDKPIYKPQHKVLINVYSITPDLRPANDKIEAY-VVDPRGSRMVQWKDLKPVCCGIVNMSFPLSDQPVFGEWLVFVDVQGHTYNKSFEVQKYVTPRFELIVEPPPYIRDLSRCEQATVKARYTFGKPVTGKLTVNMTVNGVGYYRHEVG--HPVVKTMD-MKGSATFSLCVKDMMPLDVTDHFRGTVNMWVSVNSVDGGQQTMFDD--STPVHKQLIDIKYSKDTRKQFKPGLPYKGKIEVMYPDGSP-ADGVQVRVKAELTPKDNVYTSELTSK--NGEATFEIPSIPTAAQYVWLETKVIAIDGNPAGDQYLP-SYLSISSWYSPSKCHIQLQSPTAPLIIGQEVEVMLKSTCPCNFTLHYEITSRGNIVQSGHRHPNSTARSRRAAVTFDKNIHTTPQPPLHSGSEEATAQDESDSCVSVLRFQITAAMAPLSRLLVYYVRENGEGVTDSLQIPVLPRFENQVSVSMSTNESMPGSSVSLHVRGEKGSCVCVATVDKSMYLLKPGYQLTPEKVFKELADFDVSDAFGVPKDDGHFWWPGLSSRRRRSSVFPWHWDITKDARFAFTETGLVVMTD----MVRLNHRQTGGMYTDEAVPAFQ----------------------------PHTSTQGAMHSRSTARAIKH-KRTFFPETWIWNCLNVSNITGEAELRLDVPDSITTWVTEAVGLSEDKGLGLA-KPAELRTFKPFFIDFTLPYSVIRGEQTKVPLTVYNYLPACTEVHVKV 839          

HSP 2 Score: 92.8189 bits (229), Expect = 2.742e-18
Identity = 150/620 (24.19%), Postives = 253/620 (40.81%), Query Frame = 2
Query: 3029 VPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSIS---DKKAVSPNAEIIQRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSG----KISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTAC-------TAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTM---SSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDA---------VRLKNPRNPSSVDLPFQTF-----------------------DINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLP-QTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPG 4738
            VP S+ A  S++GD++GPT    L  +D  K LR+  G  E     F  N+++LKY+++ R  S  V     +Y  +  Q  L+Y     G +S F E  +  +   TAF L +      A    +I+I    +Q A  ++ + Q +    +GSF  +  + +K L   I   +S T         +TA++   IS   +K AVS       +A  F++ +  ++ D ++  +  YAL+    S Y+     +++ M  T      +       +D D    +                  NDGL+ +        TA  +L +        +  + +  + +L++ RN + GF+ST D+ VAL+    ++        Y   V +T+   S+  +++ET+ +Q  N  +     IP+    G FV  A+G G  LMQ+DV   V D          V+LK PR      L +                          D    A         + ++ C  WL   S      + M V ++ L +G+ A  + L + +      L RY      K+ FY  ++P Q  TCV F+A R + V   +   +   Y+YYEP 
Sbjct: 1113 VPGSERATASMIGDVMGPT----LNNLD--KLLRLPFGCGEQNMIHFAPNVFVLKYLQKTRQLSPEVKSEATDYLLQGYQRQLTY-KRQDGSYSAFGERDSSGSMWLTAFVLKSF-----AQSRGFIFIDPEELQAAKAWLISHQRE----EGSFPAMGRILNKDLQGGIHGKISLT------AYVVTALLETGISTEEEKLAVS-------KAKDFLESNTYSADDPYTTALSAYALALL-RSHYAPLALRRLNHMAITQDGFTHWSLTGSTVADEDTFMGF------------------NDGLSQSVVSAEVEMTAYGLLTYTLMG----DVASALPVVKWLSQQRNALGGFSSTQDTCVALQALSEYAILS-----YVGGVNLTISLASTNLDFQETFELQRDNKKILQKAVIPS-IPTGLFV-SAKGEGCCLMQIDVTYNVPDPVAKPAFQLMVQLKEPRQERHTPLSYSWHSSSRSRSRADNRSELSRTRRSPADDEDPAAHQDNLDYRVTLEACTRWLHPGS------SNMAVLEIPLLSGFRADVESLEKLLMDKRVGLKRY-EMEGRKVLFYFDEIPSQCMTCVAFQAVREYIVGKTAPVPV-KVYDYYEPA 1665          
BLAST of CD109 antigen vs. Ensembl Cavefish
Match: cpamd8 (C3 and PZP like alpha-2-macroglobulin domain containing 8 [Source:NCBI gene;Acc:103025510])

HSP 1 Score: 141.739 bits (356), Expect = 4.158e-33
Identity = 178/860 (20.70%), Postives = 338/860 (39.30%), Query Frame = 2
Query:  218 SYIILAPKRIRPGQLYQTSVTIVKLLYPT-LTIRMSIKRNDFEYIHETTTFKTEGTQIMRLEIPTRVAPPDDYYLEVVGSVT-DNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSL-INQGSLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVIRLSFVPT--QSLTCPTYRLRAEYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTN-KIFVQVVAGGNIVYVDTIVMQNSVKTRTFSIS------------------------------------ISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQNFQQPIEQD----WLYNLEYIIRTYLPSP---SFGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKP-NGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEV 2647
             Y+I AP   R G     SVT+   +  T + +++S+K     + H T   K  GT  ++L++P+ +       L+V G+        IF N T +  + K  +VFIQ  KP+Y     V   V  + P+L P    I A   ++P G  + +W +      GI  M FPL+DQ   G W + V+++     KSF V++Y  PRF++ +  P  + D        ++A  T G  V G  ++ + +      R        + +T++  +G A F   + ++  L +        ++WV+    D   + +      T ++     +K+     + FKP + +   + V  PDG+     +   V  +    D+V T E ++          +  +PT  Q +   T  +  +    G++ +  S   +  +YS S  ++Q+   T    + +     +  + P N  +  ++ + GNIV        ++ ++R  +++                                    I+  MAP++R++ YYV+ +GE V+DSL         N V++ ++  + +   +V ++  GE GS + +  +   +Y       L    +  E+  ++ +    + +D    W   L    R     P       D       +GL++ +D    MV   +     +   +A+P +                             P T+       ++  R      R +    W+W    +    G    R+D+P   T+WV  A  +  +KG  +  +PA     + F++   +P     GEQ  V +T++NY    TE  ++V
Sbjct:   30 GYLIAAPSVFRAGVEEAVSVTLFNTVDETRVQVQLSVKGETVAHSHGTVLDK--GT--IKLKVPSDLR--GQAILKVWGNRHLTEGGYIFHNHTTVTIDSKGTAVFIQTDKPIYKPQHKVLINVYSITPDLRPANDKIEAY-VVDPRGSRMVQWKDLKPVCCGIVNMSFPLSDQPVFGEWLVFVDVQGHTYNKSFEVQKYVTPRFELIVEPPPYIRDLSRCEQATVKARYTFGKPVTGKLTVNMTVNGVGYYRHEVG--HPVVKTMD-MKGSATFSLCVKDMMPLDVTDHFRGTVNMWVSVNSVDGGQQTMFDD--STPVHKQLIDIKYSKDTRKQFKPGLPYKGKIEVMYPDGSP-ADGVQVRVKAELTPKDNVYTSELTSK--NGEATFEIPSIPTAAQYVWLETKVIAIDGNPAGDQYLP-SYLSISSWYSPSKCHIQLQSPTAPLIIGQEVEVMLKSTCPCNFTLHYEITSRGNIVQSGHRHPNSTARSRRAAVTFDKNIHTTPQPPLHSGSEEATAQDESDSCVSVLRFQITAAMAPLSRLLVYYVRENGEGVTDSLQIPVLPRFENQVSVSMSTNESMPGSSVSLHVRGEKGSCVCVATVDKSMYLLKPGYQLTPEKVFKELADFDVSDAFGVPKDDGHFWWPGLSSRRRRSSVFPWHWDITKDARFAFTETGLVVMTD----MVRLNHRQTGGMYTDEAVPAFQ----------------------------PHTSTQGAMHSRSTARAIKH-KRTFFPETWIWNCLNVSNITGEAELRLDVPDSITTWVTEAVGLSEDKGLGLA-KPAELRTFKPFFIDFTLPYSVIRGEQTKVPLTVYNYLPACTEVHVKV 839          

HSP 2 Score: 93.9745 bits (232), Expect = 1.555e-18
Identity = 150/620 (24.19%), Postives = 253/620 (40.81%), Query Frame = 2
Query: 3029 VPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSIS---DKKAVSPNAEIIQRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSG----KISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTAC-------TAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTM---SSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDA---------VRLKNPRNPSSVDLPFQTF-----------------------DINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLP-QTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPG 4738
            VP S+ A  S++GD++GPT    L  +D  K LR+  G  E     F  N+++LKY+++ R  S  V     +Y  +  Q  L+Y     G +S F E  +  +   TAF L +      A    +I+I    +Q A  ++ + Q +    +GSF  +  + +K L   I   +S T         +TA++   IS   +K AVS       +A  F++ +  ++ D ++  +  YAL+    S Y+     +++ M  T      +       +D D    +                  NDGL+ +        TA  +L +        +  + +  + +L++ RN + GF+ST D+ VAL+    ++        Y   V +T+   S+  +++ET+ +Q  N  +     IP+    G FV  A+G G  LMQ+DV   V D          V+LK PR      L +                          D    A         + ++ C  WL   S      + M V ++ L +G+ A  + L + +      L RY      K+ FY  ++P Q  TCV F+A R + V   +   +   Y+YYEP 
Sbjct: 1113 VPGSERATASMIGDVMGPT----LNNLD--KLLRLPFGCGEQNMIHFAPNVFVLKYLQKTRQLSPEVKSEATDYLLQGYQRQLTY-KRQDGSYSAFGERDSSGSMWLTAFVLKSF-----AQSRGFIFIDPEELQAAKAWLISHQRE----EGSFPAMGRILNKDLQGGIHGKISLT------AYVVTALLETGISTEEEKLAVS-------KAKDFLESNTYSADDPYTTALSAYALALL-RSHYAPLALRRLNHMAITQDGFTHWSLTGSTVADEDTFMGF------------------NDGLSQSVVSAEVEMTAYGLLTYTLMG----DVASALPVVKWLSQQRNALGGFSSTQDTCVALQALSEYAILS-----YVGGVNLTISLASTNLDFQETFELQRDNKKILQKAVIPS-IPTGLFV-SAKGEGCCLMQIDVTYNVPDPVAKPAFQLMVQLKEPRQERHTPLSYSWHSSSRSRSRADNRSELSRTRRSPADDEDPAAHQDNLDYRVTLEACTRWLHPGS------SNMAVLEIPLLSGFRADVESLEKLLMDKRVGLKRY-EMEGRKVLFYFDEIPSQCMTCVAFQAVREYIVGKTAPVPV-KVYDYYEPA 1665          
BLAST of CD109 antigen vs. Ensembl Cavefish
Match: cpamd8 (C3 and PZP like alpha-2-macroglobulin domain containing 8 [Source:NCBI gene;Acc:103025510])

HSP 1 Score: 141.354 bits (355), Expect = 5.831e-33
Identity = 178/860 (20.70%), Postives = 338/860 (39.30%), Query Frame = 2
Query:  218 SYIILAPKRIRPGQLYQTSVTIVKLLYPT-LTIRMSIKRNDFEYIHETTTFKTEGTQIMRLEIPTRVAPPDDYYLEVVGSVT-DNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSL-INQGSLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVIRLSFVPT--QSLTCPTYRLRAEYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTN-KIFVQVVAGGNIVYVDTIVMQNSVKTRTFSIS------------------------------------ISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQNFQQPIEQD----WLYNLEYIIRTYLPSP---SFGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKP-NGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEV 2647
             Y+I AP   R G     SVT+   +  T + +++S+K     + H T   K  GT  ++L++P+ +       L+V G+        IF N T +  + K  +VFIQ  KP+Y     V   V  + P+L P    I A   ++P G  + +W +      GI  M FPL+DQ   G W + V+++     KSF V++Y  PRF++ +  P  + D        ++A  T G  V G  ++ + +      R        + +T++  +G A F   + ++  L +        ++WV+    D   + +      T ++     +K+     + FKP + +   + V  PDG+     +   V  +    D+V T E ++          +  +PT  Q +   T  +  +    G++ +  S   +  +YS S  ++Q+   T    + +     +  + P N  +  ++ + GNIV        ++ ++R  +++                                    I+  MAP++R++ YYV+ +GE V+DSL         N V++ ++  + +   +V ++  GE GS + +  +   +Y       L    +  E+  ++ +    + +D    W   L    R     P       D       +GL++ +D    MV   +     +   +A+P +                             P T+       ++  R      R +    W+W    +    G    R+D+P   T+WV  A  +  +KG  +  +PA     + F++   +P     GEQ  V +T++NY    TE  ++V
Sbjct:   30 GYLIAAPSVFRAGVEEAVSVTLFNTVDETRVQVQLSVKGETVAHSHGTVLDK--GT--IKLKVPSDLR--GQAILKVWGNRHLTEGGYIFHNHTTVTIDSKGTAVFIQTDKPIYKPQHKVLINVYSITPDLRPANDKIEAY-VVDPRGSRMVQWKDLKPVCCGIVNMSFPLSDQPVFGEWLVFVDVQGHTYNKSFEVQKYVTPRFELIVEPPPYIRDLSRCEQATVKARYTFGKPVTGKLTVNMTVNGVGYYRHEVG--HPVVKTMD-MKGSATFSLCVKDMMPLDVTDHFRGTVNMWVSVNSVDGGQQTMFDD--STPVHKQLIDIKYSKDTRKQFKPGLPYKGKIEVMYPDGSP-ADGVQVRVKAELTPKDNVYTSELTSK--NGEATFEIPSIPTAAQYVWLETKVIAIDGNPAGDQYLP-SYLSISSWYSPSKCHIQLQSPTAPLIIGQEVEVMLKSTCPCNFTLHYEITSRGNIVQSGHRHPNSTARSRRAAVTFDKNIHTTPQPPLHSGSEEATAQDESDSCVSVLRFQITAAMAPLSRLLVYYVRENGEGVTDSLQIPVLPRFENQVSVSMSTNESMPGSSVSLHVRGEKGSCVCVATVDKSMYLLKPGYQLTPEKVFKELADFDVSDAFGVPKDDGHFWWPGLSSRRRRSSVFPWHWDITKDARFAFTETGLVVMTD----MVRLNHRQTGGMYTDEAVPAFQ----------------------------PHTSTQGAMHSRSTARAIKH-KRTFFPETWIWNCLNVSNITGEAELRLDVPDSITTWVTEAVGLSEDKGLGLA-KPAELRTFKPFFIDFTLPYSVIRGEQTKVPLTVYNYLPACTEVHVKV 839          

HSP 2 Score: 93.5893 bits (231), Expect = 2.020e-18
Identity = 150/620 (24.19%), Postives = 253/620 (40.81%), Query Frame = 2
Query: 3029 VPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSIS---DKKAVSPNAEIIQRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSG----KISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTAC-------TAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTM---SSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDA---------VRLKNPRNPSSVDLPFQTF-----------------------DINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLP-QTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPG 4738
            VP S+ A  S++GD++GPT    L  +D  K LR+  G  E     F  N+++LKY+++ R  S  V     +Y  +  Q  L+Y     G +S F E  +  +   TAF L +      A    +I+I    +Q A  ++ + Q +    +GSF  +  + +K L   I   +S T         +TA++   IS   +K AVS       +A  F++ +  ++ D ++  +  YAL+    S Y+     +++ M  T      +       +D D    +                  NDGL+ +        TA  +L +        +  + +  + +L++ RN + GF+ST D+ VAL+    ++        Y   V +T+   S+  +++ET+ +Q  N  +     IP+    G FV  A+G G  LMQ+DV   V D          V+LK PR      L +                          D    A         + ++ C  WL   S      + M V ++ L +G+ A  + L + +      L RY      K+ FY  ++P Q  TCV F+A R + V   +   +   Y+YYEP 
Sbjct: 1113 VPGSERATASMIGDVMGPT----LNNLD--KLLRLPFGCGEQNMIHFAPNVFVLKYLQKTRQLSPEVKSEATDYLLQGYQRQLTY-KRQDGSYSAFGERDSSGSMWLTAFVLKSF-----AQSRGFIFIDPEELQAAKAWLISHQRE----EGSFPAMGRILNKDLQGGIHGKISLT------AYVVTALLETGISTEEEKLAVS-------KAKDFLESNTYSADDPYTTALSAYALALL-RSHYAPLALRRLNHMAITQDGFTHWSLTGSTVADEDTFMGF------------------NDGLSQSVVSAEVEMTAYGLLTYTLMG----DVASALPVVKWLSQQRNALGGFSSTQDTCVALQALSEYAILS-----YVGGVNLTISLASTNLDFQETFELQRDNKKILQKAVIPS-IPTGLFV-SAKGEGCCLMQIDVTYNVPDPVAKPAFQLMVQLKEPRQERHTPLSYSWHSSSRSRSRADNRSELSRTRRSPADDEDPAAHQDNLDYRVTLEACTRWLHPGS------SNMAVLEIPLLSGFRADVESLEKLLMDKRVGLKRY-EMEGRKVLFYFDEIPSQCMTCVAFQAVREYIVGKTAPVPV-KVYDYYEPA 1665          
BLAST of CD109 antigen vs. Ensembl Sea Lamprey
Match: cd109 (CD109 molecule [Source:ZFIN;Acc:ZDB-GENE-120215-253])

HSP 1 Score: 227.254 bits (578), Expect = 3.410e-60
Identity = 335/1483 (22.59%), Postives = 601/1483 (40.53%), Query Frame = 2
Query:  416 APPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKS-FHVKEYWLPRFDVNITLPVKLS-DQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSLINQGSLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRN---VNVKAYCIDSVKTDEFS-NLIVPDSGVIRLSF--VPTQSLTCPTYRLRAEYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTNKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEIN---GYGEPGSFLALNVLHYD-LYSRGADNILRDY--NIIDEMKTYEQNFQQPIEQDWLYNLEYIIRTYLPSPSFGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRV-VQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKG--GIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKA-VSPNAEIIQRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSA-TDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYNRSIYQTVELYSNHICNVFGS 4807
            A P  Y L V G   D+S ++F N + L F+ +   +F+Q  K VY  GQTV FR   +  +L P  G    I+  +P G  V++W    TS  G+    FP++DQ   G W I V  E+   ++  F V EY LP+F+V + LP  ++ + G GV G I+A  T G  VRGNA++TL I +P    +   P L +       +G A F F+ DE+++L+   S       + A V +  T + ++G            V+F+   +  FK  + +TA++ +  PD +  +     +   V V    + S     +  N  VP SGV+ + F  +P       +  +   Y +  N L     Q   +  ++SG  +Q++ A    +  E   F +  +    + F QVV+ GNIV          V + TF +  +   AP A VV +YV+ DGEVV  S+TF  ++  +    + +N   ++      ++      +  +F+ + V+    L  +  ++I  D   + +  M +  +    P   D +    ++   +LP+PS   D+ +T   +GL++ +DA      F+                       Y   E   G +        +            P   +R    L+       W+W       N    F   +P   TSWV  A+++    G  + +        + F++ + +P     GEQ  V+  +FNY D   +  + +  SD Y V V   E G         I N+ + T+   +A    F   P +L           I++ A     ++   +++ +   GV   +    L+  +    +   +          E  +R          A ++I+GDI+GP+ S   + V      +M +G  E     F  NIY++KY+         +    L++ N   Q  L+Y     G FS F       +T  +AF L   L         Y++I + ++   T+     Q+ G  G+F    EP  ++ +                 +   + +TA  ++++ ++ + ++ +  ++    +  D+ +I S +L      TYALS+  +   + + + +    + + + D   KY         + E+ N  ++++  R                +LL    ++   N  NN++   +  + R  + G +S  D+ V L+    F+A T  +R    LQV  T S       ++ +  +N  V     +    +     L A G G  + QL+    VF  +++   R   S D     F++         N+  + +++C  W G  S      +GM +  V + +G+VA +D  +  V       ++      GK++ YL  L  T  CVT R+ R   V + +++   S  +YYEP R     Y +  L S  +C + G+
Sbjct:    5 ASPGLYELWVHG--VDSSGLLFVNSSTLIFDSQALLLFVQTDKAVYKPGQTVHFRAFSVDSSLRPHLGGAYDIEIQDPVGNRVQQWRG-LTSASGVVSADFPVSDQPLLGQWQIIVHGEQGVDKEQPFTVAEYVLPKFEVLLKLPSFVAREDGQGVSGTIEAKYTYGKLVRGNATVTLIIGNP--RPWEWQPSLNLTIRNLKLDGNAGFAFSSDEVKALVAD-SFVPDTYTIEAHVTELLTGITQSGGGSVKTPEYRVDVQFVNSPLS-FKAGLNYTAYVHLSLPDDSPLLPRDLESPLLVQVSQSNLSSALLSSWEQNYTVPASGVVAVHFSVLP----DADSVYVNVVYKQQKNNL-----QLNKESSTRSGESIQLSSANSKAQAGEPLQFSVTSTEHVEEFFYQVVSRGNIVAT------GKVNSNTFQLLPTSAWAPSAHVVVHYVRDDGEVVPASVTF--DVAGIFENKVVLNWTAEMATPASSVSLKVSASDAEAFVGVLVVDKSVLLLKTGNDITADSVTSAVSAMASTSRG--GPF--DAVPWGRFMPLFWLPNPS---DSLSTFTEAGLVLLTDAYVHHPEFF---------------------LVYKEGESGAGASYFRPLGGAMNMMPVATGAGAAPAERVRT---LFPE----TWIWADGETGKNRSKTFTATVPDSITSWVASAFSVSSSLGLGVADTAQQLLAFQPFFVSLNLPYSVVRGEQFVVQALVFNYLDTDLQVRVTLDPSDAYVVLVDTNEVG--------AIPNEQLVTVRSQDAATVSFPVSPALLGL-------VPITVRARAATAADAMTQQLLVKAEGVERSFSKTLLLQRSGGDAVTQGSLVFPFPSGVVEGSQR----------ATLTIIGDIMGPSISGLERLV------QMPYGCGEQNMINFAPNIYVIKYLTATGQGGGEIRQRALSFMNTGYQRELTY-QRQDGSFSAFGNEDASGSTWLSAFVLRCFLQALP-----YVFI-DPVVVAETHVWLMSQLNGSTGVFA---EPGRVIHADM------------QGGSSGPLSLTAYALVALLEQPSHMTAHKRVLTLTQSERDKRVIRSGNLRILSTVTYALSRKHSPTENERKTRL---CIRSVKLD-SLKY---------WPERGNNESMLVQLRPHETRPPGKDVRKISRLLLLTSVHL---NKKNNVQITKWNLQSRTRLEGQSSLLDTVVGLQALSEFAARTTGSRS--NLQVRAT-SKLLTGPLSFTVNSANALVLQRAEVKACEI--NVALSATGAGFAVAQLN----VFYNLKMSGGRAKRSAD-QTDAFELTIDPHILDLNN--VDVNVCVRWAGTGS------SGMALLQVNMLSGFVADSDFPKPQV-------VKRVEVDGGKVNLYLDSLNGTLVCVTIRSTRVQTVGS-AQEAQVSITDYYEPRRRTERSYSSGYLASVSVCELCGA 1333          
BLAST of CD109 antigen vs. Ensembl Sea Lamprey
Match: cpamd8 (C3 and PZP like alpha-2-macroglobulin domain containing 8 [Source:ZFIN;Acc:ZDB-GENE-050208-428])

HSP 1 Score: 132.88 bits (333), Expect = 3.977e-31
Identity = 187/826 (22.64%), Postives = 341/826 (41.28%), Query Frame = 2
Query: 2375 WLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYG---ITRAFDPETISNKSVH-TLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFI---GSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYN--FKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEI-IQRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTAC-------TAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTM---SSRGNWRETYGIQFSNYTVGNLTTIPNDFVWG-EFVLVAQGTGRLLMQLDVEGRVFD---------AVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGS-WLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLP-QTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYNRSI 4756
            W+W  +  +  G    +V++P   TSWV  A AI   +G  +    ++ +  + F++   +P     GEQ  V +T+ NY     E  + VK +    V  V  +G   +TR    E    K+    L +   G+      P+      +   +A++ +     +   G++ + R++++   G+   Y T ++    ++     +N  F + +  S           VP S+ A  S++GD++GPT        +    L++  G  E     F  N+++LKY+++ +    +V     +Y  +  Q  L+Y     G +S F E  +  +   TAF L +      A    +IYI    +  A  +I N Q +    DGSF  +  + +K +   I             +I +TA V+ ++ +    +   +  + RA  F++ ++ ++ D ++  +  YAL    T  +S      +  + N A      K++S S      T  TN  T M        +DGL+ +        TA A+L +        +    +  + +L++ RN   GF+ST D+ VAL+    ++        Y   V +T+   S+  +++E++ +   N  +    T+  + ++  +  + A+G G  LMQ+DV   V D          V L  PR+  +          N   + S  +     +  C   WL   S      + M V +V L +G+ A  + L + +      L RY      K+ FY  ++P Q  TCV F ADR + V   +   +   Y+YYEPG    S+
Sbjct:  766 WIWHCFNTRATGEARLQVEVPDSITSWVAEALAISPAQGLGLAPARSLRT-FKPFFVDFTLPYALIRGEQAKVPLTVHNYMPLCAE--VHVKVTVPKGVKFVGHHGKQHLTRKMCVEADETKTTSLVLSFAELGQTNITVMPVC-----SPACSASVCVRRGELLRGGGADAQGRQLRMQAEGMPREY-TYSVFFCPNENTKGNHNEAFTLAVPHSV----------VPGSERATASMIGDVMGPT------LNNLDNLLKLPFGCGEQNMIHFAPNVFVLKYLQQTKQLVADVRTEATDYLLQGYQRQLTY-KRQDGSYSAFGERDSSGSMWLTAFVLKSF-----AQSRAFIYIDPKELAAAKAWIINHQKE----DGSFPAVGRILNKDIQGGI-----------HGKISLTAYVLAALMETGTDNEGEKTAVARAKMFLESNMYSAEDPYTTALSAYAL----TLLHSSYAPVALRRLNNVAITQDGLKHWSLSG-----TTVTNDDTFMGF------SDGLSQSVVSAEVEMTAYALLTYTALG----DVATALPIVKWLSQQRNAQGGFSSTQDTCVALQSLSEYAILS-----YIGGVNLTISLASTNLDFQESFELNKDNKKILQTATVSQNVLFQTKSPICAKGEGCCLMQIDVSYNVPDPAAKPAFQLTVELTEPRSTRA------QIKKNKHGRHSCVHRCTCCVFTCACRWLQTGS------SNMAVLEVPLLSGFRADVESLEQVLLDKKLGLKRY-ELDGRKVLFYFDEIPNQCMTCVKFHADREYIVGQTAPVPV-KIYDYYEPGSSRDSL 1507          

HSP 2 Score: 112.079 bits (279), Expect = 8.995e-25
Identity = 138/601 (22.96%), Postives = 246/601 (40.93%), Query Frame = 2
Query:  221 YIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRNDFEYIHETTTFKTEGTQIMRLEIPTRV--APPDDYYLEVVGS---VTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAI-NPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTA-PLLQINRTINYFEGKADF-LFTMDELRSLINQGSLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVI--RLSFVPT--QSLTCPTYRLRAEYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTN-KIFVQVVAGGNIVY------------------------------VDTIVMQNSVKTRT--FSISISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGS 1888
            Y++ AP   R G     SVT       T  ++  +  +     H       +G  +++L++ T+V        +L V GS    + + A  F N T +    K  +V IQ  KPVY   Q V    I + P L P+   + A   I +P G  + +W +      GI  + FP+++Q   G W I VEL      KSF V++Y LP+F+V+I+ P  + +        ++A  T G  VRG A++ + +      R     P+L+        +G A F +   D +   + +       VW      D   ++  T    T ++     +K+     + FKP + +   L V  PDG+         V V+     + K + +++ +V   G++  ++  +PT  Q +         +  E G++ +S +   +  ++S S  ++Q+       +V E A   I  + P N  +  +V A GNIV                               V    ++  VK       I ++  M P +R++ Y+V+ +GE V+DS+      +  N V++ +++ +    D V+I      GS
Sbjct:   24 YLVAAPSVFRAGVEEAISVTFFNPAAET-AVQACLAVHGETVAHSRGDVFEKG--VIKLKVLTKVPRGLRGQAHLRVWGSHNSTSKSDAFSFQNSTTITVEQKGSTVLIQTDKPVYKPKQRVLANFIIISPELRPINEKVEAYIVIQDPRGSRMVQWSDLHPICCGIMNVSFPISEQPIFGEWMIFVELHSHTYNKSFEVQKYVLPKFEVDISTPSFIRNLNVCDKARVRARYTFGKPVRGKATVNMTVNGVGYYRQDLGMPVLKTFEV----DGAASFDICVKDLMPPNVPEHFRGALSVWATVVASDGSKQI--TFDDSTLVHKQLVDIKYSRETRKQFKPGLPYHGKLEVTYPDGSPA-----DGVTVRIKAELAAKDNIYTSELVSRDGIVAFQIHSIPTMAQYVWLEAKVTAIDGREVGDQYLS-NFMSITGWFSPSKCHLQLQPPAAPLKVGEEAKVAIRSTCPCNVSLHYEVAARGNIVQSGAQSPPGMPTPLTGHRSRRNAPPRAVPESVGKSAVEEPVKVCEMWLRIPVTHAMVPSSRLLVYHVRANGEGVADSVQIPVKPSFENEVSLELSQNETSPGDKVDIVVRAAKGS 609          
BLAST of CD109 antigen vs. Ensembl Sea Lamprey
Match: cpamd8 (C3 and PZP like alpha-2-macroglobulin domain containing 8 [Source:ZFIN;Acc:ZDB-GENE-050208-428])

HSP 1 Score: 105.916 bits (263), Expect = 6.810e-23
Identity = 161/651 (24.73%), Postives = 267/651 (41.01%), Query Frame = 2
Query: 3029 VPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEI-IQRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTAC-------TAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTM---SSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFD---------AVRLKNPRNPSS-------------VDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLP-QTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGR-----YNRSIYQTV--ELYSNHICNVFGSYQCP---YSPYFNVASS 4849
            VP S+ A  S++GD++GPT        +    L++  G  E     F  N+++LKY+++ +    +V     +Y  +  Q  L+Y     G +S F E  +  +   TAF L +      A    +IYI    +  A  +I N Q +    DGSF  +  + +K +   I             +I +TA V+ ++ +    +   +  + RA  F++ ++ ++ D ++  +  YAL    T  +S      +  + N A      K++S S      T  TN  T M        +DGL+ +        TA A+L +        +    +  + +L++ RN   GF+ST D+ VAL+    ++        Y   V +T+   S+  +++E++ +   N  +    TIP+    G FV  A+G G  LMQ+DV   V D          V L  P+ P S                     D +  A         + +++C  WL   S      + M V +V L +G+ A  + L + +      L RY      K+ FY  ++P Q  TCV F ADR + V   +   +   Y+YYEP       YN S    +  EL     CN     Q P   +SP F+  SS
Sbjct: 1102 VPGSERATASMIGDVMGPT------LNNLDNLLKLPFGCGEQNMIHFAPNVFVLKYLQQTKQLVADVRTEATDYLLQGYQRQLTY-KRQDGSYSAFGERDSSGSMWLTAFVLKSF-----AQSRAFIYIDPKELAAAKAWIINHQKE----DGSFPAVGRILNKDIQGGI-----------HGKISLTAYVLAALMETGTDNEGEKTAVARAKMFLESNMYSAEDPYTTALSAYAL----TLLHSSYAPVALRRLNNVAITQDGLKHWSLSG-----TTVTNDDTFMGF------SDGLSQSVVSAEVEMTAYALLTYTALG----DVATALPIVKWLSQQRNAQGGFSSTQDTCVALQSLSEYAILS-----YIGGVNLTISLASTNLDFQESFELNKDNKKILQTATIPS-IPTGLFV-SAKGEGCCLMQIDVSYNVPDPAAKPAFQLTVELTEPQRPHSRRHPQPLPLPHPGSASGSSDNDDDDPAAHHDSKEYKVTLEVCARWLQTGS------SNMAVLEVPLLSGFRADVESLEQVLLDKKLGLKRY-ELDGRKVLFYFDEIPNQCMTCVKFHADREYIVGQTAPVPV-KIYDYYEPALEATRFYNASANSPLARELCEGKSCNEL--LQLPSRSHSPGFSSGSS 1689          

HSP 2 Score: 104.76 bits (260), Expect = 1.467e-22
Identity = 134/608 (22.04%), Postives = 243/608 (39.97%), Query Frame = 2
Query:  218 SYIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRNDFEYIHETTTFKTEGTQIMRLEIPTRVAPPDDYYLEVVGS---VTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTA-PLLQINRTINYFEGKADF-LFTMDELRSLINQGSLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVI--RLSFVPT--QSLTCPTYRLRAEYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTN-KIFVQVVAGGNIV-----------------------------YVDTIVMQNSVKTRTFS--------------------ISISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEI 1864
             Y++ AP   R G     SVT       T  ++  +  +     H       +G  +++L++P  +      +L V GS    + + A  F N T +    K  +V IQ  KPVY   Q V    I + P L P+   + A   ++P G  + +W +      GI  + FP+++Q   G W I VEL      KSF V++Y LP+F+V+I+ P  + +        ++A  T G  VRG A++ + +      R     P+L+        +G A F +   D +   + +       VW      D   ++  T    T ++     +K+     + FKP + +   L V  PDG+         V V+     + K + +++ +V   G++  ++  +PT  Q +         +  E G++ +S +   +  ++S S  ++Q+       +V E A   I  + P N  +  +V A GNIV                               D +V   +      S                    I ++  M P +R++ Y+V+ +GE V+DS+      +  N V++ +++ +    D V+I
Sbjct:    1 GYLVAAPSVFRAGVEEAISVTFFNPAAET-AVQACLAVHGETVAHSRGDVFEKG--VIKLKVPRGLR--GQAHLRVWGSHNSTSKSDAFSFQNSTTITVEQKGSTVLIQTDKPVYKPKQRVLANFIIISPELRPINEKVEAY-IVDPRGSRMVQWSDLHPICCGIMNVSFPISEQPIFGEWMIFVELHSHTYNKSFEVQKYVLPKFEVDISTPSFIRNLNVCDKARVRARYTFGKPVRGKATVNMTVNGVGYYRQDLGMPVLKTFEV----DGAASFDICVKDLMPPNVPEHFRGALSVWATVVASDGSKQI--TFDDSTLVHKQLVDIKYSRETRKQFKPGLPYHGKLEVTYPDGSPA-----DGVTVRIKAELAAKDNIYTSELVSRDGIVAFQIHSIPTMAQYVWLEAKVTAIDGREVGDQYLS-NFMSITGWFSPSKCHLQLQPPAAPLKVGEEAKVAIRSTCPCNVSLHYEVAARGNIVQSGAQSPPGSAVPAAAGADPGDRVPPPRRRRDALVFDKNADATHRSQEQAGPAVEEPVKVCEMWLRIPVTHAMVPSSRLLVYHVRANGEGVADSVQIPVKPSFENEVSLELSQNETSPGDKVDI 590          
BLAST of CD109 antigen vs. Ensembl Sea Lamprey
Match: cpamd8 (C3 and PZP like alpha-2-macroglobulin domain containing 8 [Source:ZFIN;Acc:ZDB-GENE-050208-428])

HSP 1 Score: 100.138 bits (248), Expect = 3.499e-21
Identity = 180/792 (22.73%), Postives = 320/792 (40.40%), Query Frame = 2
Query: 2429 DLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYL------NAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMN--GVTNYYHTNNLVDLTSKAQLAVYN--FKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEIIQRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTM---SSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLP-QTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYNRSIYQ 4762
            ++P   TSWV  A AI   +G  +    ++ +  + F++   +P     GEQ  V +T+ NY     E    V  S    ++QV      +   P+ +     H   +L       A E K     +VL++     TN T+     T          +K+SM   G+   Y T ++    ++     +N  F + +  S           VP S+ A  S++GD++GPT        +    L++  G  E     F  N+++LKY+++ +    +V     +Y  +  Q  L+Y     G +S F E  +  +   TAF L +      A    +IYI    +  A  +I N Q +    DGSF  +  + +K +   I             +I +TA V+ ++ +    + N  +++ ++     ++ ++ D ++  +  YAL    T  +S      +  + N A      K++S S              L+++  +E          TA A+L +        +    +  + +L++ RN   GF+ST D+ VAL+    ++        Y   V +T+   S+  +++E++ +   N  +    TIP+    G FV  A+G G  LMQ+DV   V D      P    +  L  +  + +C  +      +  +      WL   S      + M V +V L +G+ A  + L + +      L RY      K+ FY  ++P Q  TCV F ADR + V   +   +   Y+YYEPG      Y+
Sbjct:  726 EVPDSITSWVAEALAISPAQGLGLAPARSLRT-FKPFFVDFTLPYALIRGEQAKVPLTVHNYMPLCAETAFVVGLS----IMQVH----VKVTVPKGVKFVGHHGKQHLTRKMCVEADETKTT--SLVLSFAELGQTNITVCASRRTQRPQRMTVITVKLSMQAEGMPREY-TYSVFFCPNEESDGNHNEAFTLAVPHSV----------VPGSERATASMIGDVMGPT------LNNLDNLLKLPFGCGEQNMIHFAPNVFVLKYLQQTKQLVADVRTEATDYLLQGYQRQLTY-KRQDGSYSAFGERDSSGSMWLTAFVLKSF-----AQSRAFIYIDPKELAAAKAWIINHQKE----DGSFPAVGRILNKDIQGGI-----------HGKISLTAYVLAALMETG--TDNEVMVETSS-----NMYSAEDPYTTALSAYAL----TLLHSSYAPVALRRLNNVAITQDGLKHWSLS----------GRARLVVSAEVEM---------TAYALLTYTALG----DVATALPIVKWLSQQRNAQGGFSSTQDTCVALQSLSEYAILS-----YIGGVNLTISLASTNLDFQESFELNKDNKKILQTATIPS-IPTGLFV-SAKGEGCCLMQIDVSYNVPD------PAAKPAFQLTVELTEHSCVHR-----CTCCVFTCACRWLQTGS------SNMAVLEVPLLSGFRADVESLEQVLLDKKLGLKRY-ELDGRKVLFYFDEIPNQCMTCVKFHADREYIVGQTAPVPV-KIYDYYEPGSSRDHQYK 1408          

HSP 2 Score: 92.0485 bits (227), Expect = 9.224e-19
Identity = 128/555 (23.06%), Postives = 222/555 (40.00%), Query Frame = 2
Query:  434 YLEVVGS---VTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAI-NPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTA-PLLQINRTINYFEGKADF-LFTMDELRSLINQGSLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKT-VTTINRNVNVKA----YCIDSVKTDEFSNLIVPD----SGVIRLSFVPTQSLTCPTYRLRA-EYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTN-KIFVQVVAGGNIV-----------------------------YVDTIVM----------QNSVKTRTFSISI--SRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLY 1924
            +L V GS    + + A  F N T +    K  +V IQ  KPVY   Q V    I + P L P+   + A   I +P G  + +W +      GI  + FP+++Q   G W I VEL      KSF V++Y LP+F+V+I+ P  + +        ++A  T G  VRG A++ + +      R     P+L+        +G A F +   D +   + +       VW      D   ++  T    T ++     +K+     + FKP + +   L V  PDG+     T+     + A    Y I   + D+   +++        VI    + T   T  T ++ A +  E G++ +S +   +  ++S S  ++Q+       +V E A   I  + P N  +  +V A GNIV                               D +V           Q    T    IS+  S      +R++ Y+V+ +GE V+DS+      +  N V++ +++ +    D V+I      GS   +  +   ++
Sbjct:   11 HLRVWGSHNSTSKSDAFSFQNSTTITVEQKGSTVLIQTDKPVYKPKQRVLANFIIISPELRPINEKVEAYIVIQDPRGSRMVQWSDLHPICCGIMNVSFPISEQPIFGEWMIFVELHSHTYNKSFEVQKYVLPKFEVDISTPSFIRNLNVCDKARVRARYTFGKPVRGKATVNMTVNGVGYYRQDLGMPVLKTFEV----DGAASFDICVKDLMPPNVPEHFRGALSVWATVVASDGSKQI--TFDDSTLVHKQLVDIKYSRETRKQFKPGLPYHGKLEVTYPDGSPADGVTVRIKAELAAKDNIYTILYWQGDQQPCMVISILIYYYSVIEYPTMLTSDCTENTAKVTAIDGREVGDQYLS-NFMSITGWFSPSKCHLQLQPPAAPLKVGEEAKVAIRSTCPCNVSLHYEVAARGNIVQSGAQSPPGSAVPAAAGADPGDRVPPPRRRRDALVFDKNADATHRSQEQAATGMVKISLLDSFQAYQGSRLLVYHVRANGEGVADSVQIPVKPSFENEVSLELSQNETSPGDKVDIVVRAAKGSCACVAAVDKSVH 558          
BLAST of CD109 antigen vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006925.1 (pep scaffold:Pmarinus_7.0:GL476344:729185:756992:-1 gene:ENSPMAG00000006257.1 transcript:ENSPMAT00000006925.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.2781 bits (225), Expect = 7.967e-19
Identity = 95/396 (23.99%), Postives = 154/396 (38.89%), Query Frame = 2
Query: 2318 PKNMLRNFDMLYRHWNDG---AWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISI--CAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLA---VYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIF 3481
            P N  ++  +  R  NDG    W W+   + P+  I F    P++++ W+  A++I    G S+      F       + + VP     GE+  V  T+FN      + L ++ +++ + ++     G++       +S +S  T            FFP+ LN  G       +S     YT +G         +   G    Y  + L+ L    +     V+NF   + Q               S  A + I GDI+GP+ +   Q +      +M +G  E     F   IY+  Y+   R T+ ++   +LNY N   +  L Y  S  G FS F  S  + +T  TAF L   L         YI +  N+I  A NF+ N     G F
Sbjct:  174 PINNGKSRKLENRLLNDGLLDTWFWQNGVLGPDKTITFTATAPEINSHWIAIAFSISNTSGLSVDYTSTPFEVTSPLQVTINVPSVTFLGEEFIVEATVFNKQTQTAQVLAKLMENENFTIL-FQSNGLSPNERSLNVSGQSSAT-----------AFFPVSLNVDGKVSFAVVVSYQNVDYTVVGYTL------VKYPGFPQTYSESALLSLYENKKFTRSFVFNFPPNIVQG--------------SSSAVLYIYGDIIGPSLTGLDQLI------QMPYGCGEQNMINFAPGIYIRIYLDVSRQTTPDIAAKSLNYMNSGYERELMYRRS-DGSFSAFGNSDQQGSTWLTAFVLRTFLQARS-----YIPVDSNVIDTARNFLLNSLAPSGQF 525          
BLAST of CD109 antigen vs. Ensembl Nematostella
Match: EDO32954 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STJ6])

HSP 1 Score: 90.8929 bits (224), Expect = 1.271e-18
Identity = 87/318 (27.36%), Postives = 138/318 (43.40%), Query Frame = 2
Query:  743 GNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGF---GVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINY-FEGKADFLFTMDELRSLINQG------SLAFKDVW----VNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVIRLSF-VPTQSLTCPTYRLRAEYLEDGNRLISWSEQRLF---KYYSQSGAYMQ-------ITMATEYPRVNEYAVFQIDMSYPTNKIFVQVV 1621
            G W I+V        ++F VKEY LP+F V++TLP   + +G     + G I    T G  V G A+I+L       DRF    ++Q+ RT +   +G + F FT  E+  L  Q          +   W    VNAT  +  T    +G +    +S D  ++F       FKP + F A L V QPDG+    T  +++ V  +   +    E ++   P  GVI +   VP+ +       L A+Y +D N    + EQ      K  S S +Y+Q       + + T  P V    +   ++ YP++K+    +
Sbjct:    2 GMWKIQVTAMGQTYERTFEVKEYVLPKFKVSVTLPPYATKKGLEEDSLKGAIDVKYTYGKGVEGTANISL-----GFDRFK---MIQLTRTKDLTVKGSSSFYFTKREIEDLFKQQYPWSQPQYLYSSRWYSLVVNATFEEKLTGRKASGESTISFFSSDVKLEFPSFNPNSFKPGLLFDAVLQVTQPDGSPLSPTRQQDMKVTIHRRFTYGEYESADAYTPKDGVIVIQIDVPSNATIV---SLLAKYKDDINNKDEYGEQAYLNAEKALSPSSSYLQLQTSTPAVKLQTSTPAVKLLILTATNL-YPSSKVITHFI 307          
BLAST of CD109 antigen vs. Ensembl Nematostella
Match: EDO38193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDN3])

HSP 1 Score: 77.7962 bits (190), Expect = 3.938e-14
Identity = 72/270 (26.67%), Postives = 121/270 (44.81%), Query Frame = 2
Query:  179 AQRKESYKLPPMPSYIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRNDF-----EYIHETTTFKTEGTQIMRLEI-PTRVAPPD---DYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKS----FHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEI 949
            A R  S +L   P+Y I AP+ +  G     SVT+  +  P   + +++   D+     E+ H   TF+ +    + +++  T V PP    D Y  +V    D   + F   TR+  + +   + +Q+ KP+Y   QTV+ RVIPL  +L  +   +  I   NP G   + W    +S  GI      L  +   GNWTI      + ++ +    F VK+Y LPRF V I  P  +  +   +   + +  T G   +G+ ++ L +
Sbjct:   17 ADRTNSQRL--RPNYFIFAPEVLHVGVTENISVTVSGVTRP---VNVTLFLTDYPDKSTEFAHAQGTFRPDENGFLSVKVNATEVTPPSRDGDLYAYLVVMCRD-PQVPFIRETRVLISYRSMMLLVQIDKPIYTPSQTVKMRVIPLDFDLQSLKVKVDII-VKNPQGIRTQNWQK-LSSEHGIISKALSLGPRAMLGNWTIISYHHGYGNKTNTTVHFEVKQYVLPRFSVRIIGPDYILPKTRSIKIAVISKYTYGKAAQGSVTVRLSV 278          

HSP 2 Score: 56.9954 bits (136), Expect = 7.555e-8
Identity = 26/93 (27.96%), Postives = 48/93 (51.61%), Query Frame = 2
Query: 2354 RHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTE 2632
            R +    W++  Y    +G++  R  LP   T+W + A A+  E GF + E   + +  + F++ + +P   Q GEQ+ V+  +FNY +  +E
Sbjct:  765 RKYFPETWIFDEYQTGLDGKLALRYTLPDTITTWAVQALAVSNETGFGVTELSRV-TTFKNFFIALLLPYSAQRGEQISVKAAVFNYGEQESE 856          
BLAST of CD109 antigen vs. Ensembl Nematostella
Match: EDO32956 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STJ8])

HSP 1 Score: 74.7146 bits (182), Expect = 1.737e-13
Identity = 112/538 (20.82%), Postives = 222/538 (41.26%), Query Frame = 2
Query: 2528 IRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVV-QVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTL---ATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSIS-----DKKAVSPNAEIIQRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSGKISTM--ITTIMNNARY--DGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSA 4102
            ++ F++ +++P     GE++ ++  +FNY     E  + +K S  + ++ +++  G     +P+    K     + + A E + + FPI     G       I + A +   ++   R + +   GV   Y    LVDL        Y+   + R+  Y     ML +    +    S  GDI+G +      F +    LRM +G  E     F  NI++LKY+   +  +  +      +  K  Q   +Y     G +S F E R++  ++    TAF + +      A   +YIYI E  +  +  ++ ++Q       G+F  +  + S +L   +           Q  I +TA V+++++     DK A+S  A  ++     + + +I+  D ++  I TYA++ + + + S   + +  + T+ +   Y  DG+    +    +P Y            PR            TA A+L        +   P     + +L++ RN + G++ST D+ V ++    F++
Sbjct:    1 MQPFFVSLDLPYSVIRGEEVAIKALVFNYLQQPQEVTITLKASKHWTIINELSPRGAPDQGEPKDTEYK-----MTVPANEGRAVSFPITPKTLG----TIPIIVQAQSVSAADAVQRILIVEPEGVEQEYSYTVLVDLNQSK----YDHVTEKRKKIY-----MLFF---HEFPSFSCTGDIMGSS------FSNLDNLLRMPYGCGEQNMVNFAPNIFVLKYLTAVKQLTPAIRNKAEVFMIKGYQREQTY-RHPEGSYSAFGE-RDKEGSMWYVLTAFVVKSF-----AQARKYIYIDEKALDQSIFWMVSKQSP----SGAFPKVGTVHSSYLKGGL-----------QSEIALTAFVVIALAEAKSQDKGAISAQANALRYLETNL-QSVISKQDAYTLAICTYAMALTNSRSLSKARTALTGLATVKDGTMYWTDGKQDKLAGPS-RPYY-----------RPR------SADIEITAYALLAIGHNKDVQTGLP----VVRWLSQQRNSLGGYSSTQDTVVGIQAMSEFAS 466          
BLAST of CD109 antigen vs. Ensembl Nematostella
Match: EDO33391 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSB9])

HSP 1 Score: 61.6178 bits (148), Expect = 1.957e-9
Identity = 80/367 (21.80%), Postives = 149/367 (40.60%), Query Frame = 2
Query: 3029 VPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEIIQRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTT----ACTAMAMLLFKEQNIWKENDPNN-----METITFLAKMRNHVSGFTSTFDSSVALRLFYSFSA 4102
            V  S  A VS +GD++GP+    L  +D    LR+  G  E    +F  NI++++Y+   R  + +V+   + Y     Q  L+Y     G +S F +     +   TAF L +      A   ++I+I +N       +I  +Q +     G F+P   L +  L   +ST ++           +TA V++S+ +   V+P+  +I +A   I     +  D +S  I  +A + +G +         I  +   A ++G   +                G   + P     N  +      A T + M  +    +  +   +N     +  + +L + RN + GF+ST D+ VAL+    ++ 
Sbjct:   39 VDGSVHATVSAIGDLMGPS----LSGLDGL--LRLPTGCGEQNMVKFAPNIFVMQYLNSTRQMTDDVSTKAVGYLRTGYQRQLTY-KRKDGSYSAFGDRDKEGSLWLTAFVLRSF-----AQARQFIFIDDNETNGTKEWIMKKQQE----TGCFQPHGKLFNNALKGGVSTPVT-----------LTAFVVVSLLEA-GVAPSDPVITKAMKCISSKKNSVTDSYSNAILAFAHTIAGHADRD----VYIARLKAKAIFEGTPTF--------------GFGFRFLTPSKSIKNTQIIVFVRHASTKIEMTSYALMALIGDGSDSNAVADVLPVVRWLTQQRNALGGFSSTQDTCVALQALSRYAG 359          
BLAST of CD109 antigen vs. Ensembl Nematostella
Match: EDO32952 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STJ4])

HSP 1 Score: 57.7658 bits (138), Expect = 1.559e-8
Identity = 39/118 (33.05%), Postives = 56/118 (47.46%), Query Frame = 2
Query:  218 SYIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRNDFEYIHETTTFKTEGTQIMRLEIP-TRVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQT 568
            +YIILAP + RPG +Y   V+I+K     + +   I       I  T  F    T  + L++P       ++YYL V GS      + FS ++ + F    FS+ IQ  K VY  GQT
Sbjct:   34 TYIILAPNQFRPGMVYTIKVSILK-SSAKVNVTAEIASETKSLIENTAVFSQGNTGNLDLKVPFNEAVSSENYYLTVNGS----GGLEFSEKSYVRFRENGFSLNIQTDKGVYKPGQT 146          
BLAST of CD109 antigen vs. Ensembl Medaka
Match: ENSORLT00000001261.2 (alpha-2-macroglobulin-like protein 1 [Source:NCBI gene;Acc:101161037])

HSP 1 Score: 80.8777 bits (198), Expect = 1.347e-14
Identity = 183/883 (20.72%), Postives = 335/883 (37.94%), Query Frame = 2
Query: 1706 DMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYD-LYSRGADNILRDYNIIDEMKTYEQNFQQPIEQDWLYNLEYIIRTYLPSPSFGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDK-SQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTAN-PTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNF------KIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEIIQRATAFIDRHLINSI-DLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFS-----DSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSN---YTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDV 4300
            ++AP+A+VV Y + + GEVV+DS  F   +   N V++  +  ++L      +    +P S  ++  +    L  +  + +  DY        Y Q    PI++ W Y  +Y +     +P F       +     I+                E  DK S+ LP Y   G   Y+  +         N        E+  N P P P    +  + + R +    W+W    +  +G  +    +P   T W  GA+ +    GF +     + +  + F++ + +P     GE   ++ T+FNY          + +SDQ+                    +  V++ V L A E+K   F  ++      D    +S  A       C    + +   G  +   T  LV+     Q+  +N        +  + S   PE+    +V  S+ A VS+VGD++G      ++ +D  K L M +G  E     F  NI++L Y++       +     + Y     Q  L+Y     G +S F  S    NT  T F + +  A  +     YI++ +  I+ A  ++   Q      DG  + +  L    +   +S  +S T   A       AM+ L   D  A +P   ++Q     +   +   I +L++  + +Y  + +G      K   +IT +   +  +G  +++      ++D+     E T+   L +      P  GL  A                         + +LA+ +N   GF+ST D+ VAL+    ++    + E       +T++S G   + + +  +N   Y    LT IP     GE+ + A+G   +L Q+ +
Sbjct:  506 NLAPIAQVVVYTIVSSGEVVADSRDFPIQLCLNNKVSLKFSAVQELPGAKTTLTLRAQPSSLCSVRAIDQSVLLLKSEEELTVDY-------VYNQ---LPIKKMWGY--DYQVEDDSSNPCFPRPWPRPIPLEPEILL--------------RERRDKRSRILPFYE--GDDVYTIFKVKPLAINAANL-------ESVMNEPVPAPAPEGQKTETI-RTYFPETWIWDLVSVGSSGSTSLVKTVPDTITKWAAGAFCVS-PAGFGVAPNVGL-TAFQPFFVSLTLPYSVVRGEVFTLKATVFNYLPKCIMVKATLAKSDQFTFKNC---------------DGCVYSSVCLCAEESK--TFSWIVTPTALGDVTLKVSAEAERS-NKKCGTEVVTVPTVGHVDTVITTLLVEAEGVPQMVSHNALLCPARPVSKKISLELPED----FVNGSERASVSVVGDLMGRA----MKNLD--KLLAMPYGCGEQNMLLFAPNIFILDYLKSTGQLKESTRKMAVGYLESGYQRELNY-KRDDGSYSAFGMSDPSGNTWLTTFVMKSFNAAKQ-----YIFVDQTYIEDARTWLSGLQKP----DGCIQSVGKLFHNGMKGGVSDDVSLTAYVA------AAMLEL---DGNATNP---VVQNCLKCLRTAVSGKITNLYTVALLSYTFTLAGDQDMRSK---LITLLDQKSINEGGTRHWKRDGAPETDLDSVEVEMTSYVLLALLSGPSLPGFGLDYAAG----------------------IVRWLAQQQNPFGGFSSTQDTVVALQALAKYATATFSPE---GSTTVTVTSVGGLNKRFTVNKNNRLLYQEEKLTEIP-----GEYTIKAEGQSCVLAQISL 1267          

HSP 2 Score: 77.411 bits (189), Expect = 1.557e-13
Identity = 48/176 (27.27%), Postives = 85/176 (48.30%), Query Frame = 2
Query:  356 TTTFKTEGTQIMRLEIPTRVAPPDDYYLEVVGSVTDNSAII--------FSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPV---FGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKS-RKSFHVKEYWLPRFDVNITLP 847
            T    +  T+I +L   T +     + + +V S T  S  +         +  T++   P  F   +Q  KP+Y  GQTVQFR++ +  N +PV    G    +   +PN   + +W++ +   GGI ++  P   +  +G + I  E +K ++   +F +KEY LP+F+V + LP
Sbjct:   44 TLDVDSSSTKIGQLSFKTEIYRCFQFLVPIVSSTTVASISVKIQGKMDSLNQETKVLIEPPAFVHIVQTDKPIYKPGQTVQFRIVSMDTNFIPVNRMVGFYIHVLKQDPNSNRIAQWLDKSID-GGILDLSHPTIPEAAQGIYVISAETDKGETISHNFEIKEYVLPKFEVTVNLP 218          
BLAST of CD109 antigen vs. Ensembl Medaka
Match: ENSORLT00000030023.1 (alpha-2-macroglobulin-like protein 1 [Source:NCBI gene;Acc:101161539])

HSP 1 Score: 80.4925 bits (197), Expect = 1.732e-14
Identity = 40/124 (32.26%), Postives = 69/124 (55.65%), Query Frame = 2
Query:  479 FSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKS-RKSFHVKEYWLPRFDVNITLP 847
             S  T++   P  F   +Q  KP+Y  GQTVQFR++ +  N MPV  T+  +  ++PN   + +W++     GGI ++  P   +  +G + I  E ++ ++   +F +KEY LP+F+V + LP
Sbjct:   80 MSKDTKVLIEPPAFVHIVQTDKPIYKPGQTVQFRIVSMDTNFMPVNRTVCFL--LDPNSNRIAQWLDKNVD-GGILDLSHPTIPEAAQGIYVISAETDEGETISYNFEIKEYVLPKFEVTVNLP 200          

HSP 2 Score: 67.0106 bits (162), Expect = 2.203e-10
Identity = 91/422 (21.56%), Postives = 158/422 (37.44%), Query Frame = 2
Query: 2300 ANPTPKPKNMLRNFDM---------LYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNF------KIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYI------------PENLIQVATNFIYNQQIKGGIFD 3484
            A+  P P+ M  N D+           R +    W+W    +  NG  +    +P   T W  GA+ +    GF +     + +  + F++ + +P     GE   ++ T+FNY          +  SDQ+                    +  V++ V L A E+K   F  ++      D    +S  A       C    + +   G  +   T  LV+     Q+  +N        +    S   PE+    +V  S+ A VS+VGD++G      ++ +D  K L M +G  E     F  NI++L Y++       +     + Y     Q  L+Y     G +S F  S    NT  T F + +  A  +  +   +YI            P+  IQ +   +++  +KGG+ D
Sbjct:  648 ADLAPAPEQMSSNTDVQPSDTQKKETVRTYFPETWIWDLVSVGSNGSTSLVKTVPDTITKWAAGAFCVS-PAGFGVAPNVGL-TAFQPFFVSLTLPYSVVRGEVFTLKATVFNYLPKCIMVKATLANSDQFTFKNC---------------DGCVYSSVCLCAEESK--TFSWIVTPTALGDVTLKVSAEAEKS-NKKCGKGVVTVPTVGQVDTVITTLLVEAEGVPQMVSHNALLCPARPVSKNISLELPED----FVNGSERASVSVVGDLMGRA----MKNLD--KLLAMPYGCGEQNMLLFAPNIFILDYLKSTGQLKESTRKTAVGYLESGYQRELNY-KHDDGSYSAFGMSDPSGNTWLTTFVMKSFNAAKQYIFVDQMYIKEARKWLSGLQKPDGCIQ-SVGKLFHSGMKGGVSD 1037          
BLAST of CD109 antigen vs. Ensembl Medaka
Match: cd109 (CD109 molecule [Source:ZFIN;Acc:ZDB-GENE-120215-253])

HSP 1 Score: 80.1073 bits (196), Expect = 1.868e-14
Identity = 98/438 (22.37%), Postives = 171/438 (39.04%), Query Frame = 2
Query: 2240 CDGTNQCI--NWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQY--------RVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKF 3523
            C G +Q +  N  +  G      N  P    M +N +   R +    W+W       +  +   + +P   TSW   A+ +    G  I E PA  +  + F++ + +P     GE L + I LFNY     E  L   ++  +        R V VA  G T    P                        P+VL           IS+ A +F  S+  +  + +   G+   + ++ L++L S  Q+ +         +F  P +     V  S+ A V+ +GDI+GP+    +  +D+   ++M +G  E        NI++L+Y+         +T    +Y  +  +  LS F    G FS F +S    +T  +AF L   L        ++I I  N++    ++I  QQ   G F+   EP  ++ ++ 
Sbjct:  281 CIGISQWLTYNAFETDGTEGNEGNEGP----MQQNQEPHERKYFPETWIWMDVNTGDSHTVKLPLTVPDSITSWTATAFVMSEHLGLGITEEPATLTVFQDFFLSLNLPPYVIRGEDLVLEIILFNYLQQDQEVSLLCVENQLFLSKFRINVRQVHVASGGGTNVLVP----------------------IRPLVLG-------EIPISVKATSFESSDFISTTVLVKAEGLEQTFSSSVLLEL-SAGQMNLSKIV-----AFTFPPDV----VVGSERASVTAIGDILGPS----ISGLDSL--IQMPYGCGEQNMIHLAPNIFILQYLTLTGQDDPEITKRATDYMMRGYEQELS-FQRADGSFSAFGDSDASGSTWLSAFVLKCFLQAQ-----KFIVIDSNVLLRVASWISAQQGADGRFE---EPGRVIHTEL 660          

HSP 2 Score: 60.4622 bits (145), Expect = 1.813e-8
Identity = 40/119 (33.61%), Postives = 62/119 (52.10%), Query Frame = 2
Query:  431 YYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSR 787
            Y LEV G V    +++FSN T L F+PK  + FIQ  K  Y  GQ + F +I L       F   + I+  +P G  +++W N  +++ G+   +F L++    G WTI  E++   SR
Sbjct:   48 YVLEVKGYV--GKSLLFSNSTNLSFDPKGCTTFIQTDKLNYLPGQVIIFTIIVL-------FSCFSLIK--DPRGNFIRQWQNKESNL-GVVSTEFELSENPPLGQWTILTEVKVSTSR 154          

HSP 3 Score: 54.6842 bits (130), Expect = 1.077e-6
Identity = 67/271 (24.72%), Postives = 117/271 (43.17%), Query Frame = 2
Query: 3989 PNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSA------TDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGY------VALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYNRSIYQT 4765
            P+ +E +  L++ RN + G+ ST D+ VAL+   +F+A      +D N     ++V    S RG    T+ I   NY + NL             + A+G G  L+QL+V   + +   ++  R+  S     + F +    + S  N  +  + IC   +G N+       GM + +V L +G+      V+LND +++                PGK+  YL  +   + C+       + VA V ++     Y+YYEP R    +Y +
Sbjct:  761 PDGLELMKALSQQRNSMGGYGSTQDTIVALQALSTFAAAVGSYPSDLN-----IKVTSINSGRGT---TFHINQENYLL-NLE------------VTAEGHGLALLQLNVFYNIKNEKLMRQRRDADS----HEAFTM--YIELSDINVDLAQLSIC---MGLNA------TGMAIMEVGLLSGFLLQEPGVSLNDVVKK------------VEVQPGKVIVYLDSV--KEMCLLIPLMVEYKVAKV-QEVAVILYDYYEPRRRTERMYTS 980          
BLAST of CD109 antigen vs. Ensembl Medaka
Match: ENSORLT00000021018.2 (pep primary_assembly:ASM223467v1:4:29856521:29867873:1 gene:ENSORLG00000016794.2 transcript:ENSORLT00000021018.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 1.937e-14
Identity = 97/422 (22.99%), Postives = 170/422 (40.28%), Query Frame = 2
Query:  218 SYIILAPKRIRPGQLYQTSVTIVKLLYPT-LTIRMSIKRNDFEYIHETTTFKTEGTQIMRLEIPTRVAPPDDYYLEVVGSVT-DNSAIIFSNRTRLEFNPKEFSVFIQMSKPVY---HQGQTVQFRVIPLYPNLMPVFGTITAIQAIN--PNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTA-PLLQINRTINYFEGKADFLFTMDELRSL-INQGSLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVIRLSF--VPT--QSLTCPTYRLRAEY 1444
             Y++ AP   R G     SVT+      T +  ++S+K     + H     K  GT  ++L++P+ +      +L+V G+        IF N T +    K  +VFIQ  KP+Y   H+G   Q                   ++ IN  P G  + +W N      G+  M FPL+DQ   G W + VE+      KSF V++Y +P+F++ +  P  + D        + A  T G  V G  ++ + +      R     P+++I        G A+F   + E+  + +         +W + T  D   +        T ++     +K+     + FKP + +   + V  PDG+         V V+     S + D +++ +V   G +      +PT  Q +    +R  AE+
Sbjct:   32 GYLVAAPSVFRAGVEESVSVTLFNPKAETRVQAQLSVKGQTVAHSHSFVFDK--GT--IKLKVPSGLR--GQAHLKVWGNRHLTEGGYIFHNFTTVTVESKGTAVFIQTDKPIYKPKHKGAGSQL------------------VKKINRDPRGSRMIQWKNLKPVCCGLVNMSFPLSDQPVFGEWLVFVEVHGHTYNKSFQVQKYVMPKFELVVDPPRYIRDLNLCELASVTAKYTFGKPVTGKLTVNMTVNGVGYYRHEMGHPVIKI-------RGSANFSLCVKEMMPVDVADHFRGTVSIWASVTSVDGSRQTTFD--DSTPVHKQLIDIKYSKETRKQFKPGLPYKGKVDVTYPDGSPA-----DGVKVRIKAELSPRDDIYTSELVSKDGQVSFEIPSIPTAAQYVWLEVFRELAEF 415          
BLAST of CD109 antigen vs. Ensembl Medaka
Match: c3b.2 (complement C3 [Source:NCBI gene;Acc:101170893])

HSP 1 Score: 76.6406 bits (187), Expect = 2.236e-13
Identity = 116/507 (22.88%), Postives = 203/507 (40.04%), Query Frame = 2
Query:  524 VFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSR---KSFHVKEYWLPRFDVNITLPVK----LSDQGFGVYGIIQANKTSGMFVRGNASITLEIR-DPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSLI-NQGSLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLV--------RPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVIRLSF-VP--TQSLTCPTYRLRAEYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQID--MSYPTNKIFVQ-----VVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYVK---TDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNM---DTVEINGYGEPGSFLALNVLHYDLYSRGADNI 1945
            +FIQ  KP+Y  G  V+FR     P     F +   I   N +G +VK+ +  T +V G+    FPL++   EG W +  + + W+       F VK+Y LP F+V +T P K    L D    V   I A    G  V G A +   ++ +  + R  +       + ++  +G      +++EL++   +  +L    V+V A+V      L +TG     + ++ T VK +            + FKP +     + V   DG+       RNV VK   +D          ++  +G  R S  +P   Q  T     ++A+   D       + Q    +      Y+ I+  ++   V +     I   MS   N+  V+     V++ G I+  +   + +   T    + ++ +M P  RVVA++        EVVSDS+        +  + +G        +    +V     G+PGS + L  +   +Y    D +
Sbjct:  122 IFIQTDKPIYKPGDNVRFRTFMSSP-FFKAFDSSITIDITNSDGVVVKQ-ITRTRAVKGVIADTFPLSEIANEGTWQVTAKFDHWQQNTFTSPFQVKKYVLPAFNVTLT-PTKSFISLDDSELVVE--ITARYLFGEPVEGTAYVVFGVKMNQEMKRLPSV------KQLSDLDG-GRVSLSIEELKAAYPDPETLVGHSVYVKASV------LTKTG--SDLVEAEKTGVKIVKSPYVISFTDSPKYFKPGLPLDLTIEVSNHDGSPA-----RNVQVKISQLDVP--------VIASAGTARASINMPDDQQPQTITVETIQADLRPDQQARTQITLQPYVAFNQHQQNYLYISTGSKSVSVGDRVSLDISVKMSIQENRKLVKHITYLVLSNGKILKAERADVTDRSVT-NVGLVVTSEMMPSFRVVAFFSLPWVGREEVVSDSVWIDVVDACIGGLTVGSGDSTPRTLAPGQSVRFKIRGDPGSKVNLVAVDNSVYLLNKDRL 594          
BLAST of CD109 antigen vs. Planmine SMEST
Match: SMESG000016163.1 (SMESG000016163.1)

HSP 1 Score: 3307.69 bits (8575), Expect = 0.000e+0
Identity = 1607/1607 (100.00%), Postives = 1607/1607 (100.00%), Query Frame = 2
Query:  116 MKIYCFXXXXXXXXXXXXNATAQRKESYKLPPMPSYIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRNDFEYIHETTTFKTEGTQIMRLEIPTRVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSLINQGSLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVIRLSFVPTQSLTCPTYRLRAEYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTNKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQNFQQPIEQDWLYNLEYIIRTYLPSPSFGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEIIQRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYNRSIYQTVELYSNHICNVFGSYQCPYSPYFNVASSTVEINFLFVFAIIVASLLDQLHLFSNLKN 4936
            MKIYCFITLLIVLILQIQNATAQRKESYKLPPMPSYIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRNDFEYIHETTTFKTEGTQIMRLEIPTRVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSLINQGSLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVIRLSFVPTQSLTCPTYRLRAEYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTNKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQNFQQPIEQDWLYNLEYIIRTYLPSPSFGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEIIQRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYNRSIYQTVELYSNHICNVFGSYQCPYSPYFNVASSTVEINFLFVFAIIVASLLDQLHLFSNLKN
Sbjct:    1 MKIYCFITLLIVLILQIQNATAQRKESYKLPPMPSYIILAPKRIRPGQLYQTSVTIVKLLYPTLTIRMSIKRNDFEYIHETTTFKTEGTQIMRLEIPTRVAPPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQTVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQFPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQGFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINYFEGKADFLFTMDELRSLINQGSLAFKDVWVNATVFDSFTELVRTGWAYTFIYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKAYCIDSVKTDEFSNLIVPDSGVIRLSFVPTQSLTCPTYRLRAEYLEDGNRLISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTNKIFVQVVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYVKTDGEVVSDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHYDLYSRGADNILRDYNIIDEMKTYEQNFQQPIEQDWLYNLEYIIRTYLPSPSFGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGKQCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWNDGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPAIFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQYRVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNNDTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAVYNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDTYKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKILQDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYIPENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDAEAQRRIPITAMVILSISDKKAVSPNAEIIQRATAFIDRHLINSIDLFSQIIGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQTNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITFLAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGNWRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVFDAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNSPINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIHFYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYNRSIYQTVELYSNHICNVFGSYQCPYSPYFNVASSTVEINFLFVFAIIVASLLDQLHLFSNLKN 1607          
The following BLAST results are available for this feature:
BLAST of CD109 antigen vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CD1093.131e-7322.99CD109 molecule [Source:HGNC Symbol;Acc:HGNC:21685][more]
CD1093.824e-7323.07CD109 molecule [Source:HGNC Symbol;Acc:HGNC:21685][more]
CD1096.251e-5622.27CD109 molecule [Source:HGNC Symbol;Acc:HGNC:21685][more]
A2ML14.344e-2920.96alpha-2-macroglobulin like 1 [Source:HGNC Symbol;A... [more]
A2ML17.190e-2920.96alpha-2-macroglobulin like 1 [Source:HGNC Symbol;A... [more]
back to top
BLAST of CD109 antigen vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tep-13.378e-3023.47TEP (ThiolEster containing Protein) [Source:UniPr... [more]
tep-13.378e-3023.47TEP (ThiolEster containing Protein) [Source:UniPr... [more]
tep-13.542e-3023.47TEP (ThiolEster containing Protein) [Source:UniPr... [more]
tep-13.542e-3023.47TEP (ThiolEster containing Protein) [Source:UniPr... [more]
tep-13.542e-3023.47TEP (ThiolEster containing Protein) [Source:UniPr... [more]
back to top
BLAST of CD109 antigen vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mcr1.619e-13828.21gene:FBgn0267488 transcript:FBtr0079543[more]
Tep26.402e-4721.76gene:FBgn0041182 transcript:FBtr0079513[more]
Tep21.412e-4421.46gene:FBgn0041182 transcript:FBtr0079510[more]
Tep17.900e-3520.68gene:FBgn0041183 transcript:FBtr0080811[more]
Tep25.056e-2821.51gene:FBgn0041182 transcript:FBtr0335487[more]
back to top
BLAST of CD109 antigen vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpamd81.011e-3020.55C3 and PZP like alpha-2-macroglobulin domain conta... [more]
cd1092.098e-2224.04CD109 molecule [Source:ZFIN;Acc:ZDB-GENE-120215-25... [more]
cpamd82.919e-1924.72C3 and PZP like alpha-2-macroglobulin domain conta... [more]
c49.547e-1620.43complement component 4 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
c41.134e-1520.11complement component 4 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of CD109 antigen vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
c4a6.866e-2021.27complement component 4A (Rodgers blood group) [Sou... [more]
tubal3.12.442e-1923.30tubulin alpha like 3, gene 1 [Source:Xenbase;Acc:X... [more]
tubal3.13.957e-1824.75tubulin alpha like 3, gene 1 [Source:Xenbase;Acc:X... [more]
bcl9l8.441e-1820.88B cell CLL/lymphoma 9 like [Source:Xenbase;Acc:XB-... [more]
bcl9l2.418e-1620.11B cell CLL/lymphoma 9 like [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of CD109 antigen vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cd1096.400e-3523.36CD109 antigen [Source:MGI Symbol;Acc:MGI:2445221][more]
A2ml13.020e-2421.07alpha-2-macroglobulin like 1 [Source:MGI Symbol;Ac... [more]
Pzp7.829e-2119.55PZP, alpha-2-macroglobulin like [Source:MGI Symbol... [more]
Gm72981.220e-1520.88predicted gene 7298 [Source:MGI Symbol;Acc:MGI:364... [more]
Mug24.850e-1327.59murinoglobulin 2 [Source:MGI Symbol;Acc:MGI:99836][more]
back to top
BLAST of CD109 antigen vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6YHK3|CD109_HUMAN1.836e-7223.07CD109 antigen OS=Homo sapiens OX=9606 GN=CD109 PE=... [more]
sp|Q8R422|CD109_MOUSE6.796e-3225.41CD109 antigen OS=Mus musculus OX=10090 GN=Cd109 PE... [more]
sp|P06238|A2MG_RAT2.909e-3020.77Alpha-2-macroglobulin OS=Rattus norvegicus OX=1011... [more]
sp|A8K2U0|A2ML1_HUMAN2.086e-2820.96Alpha-2-macroglobulin-like protein 1 OS=Homo sapie... [more]
sp|Q8IZJ3|CPMD8_HUMAN7.072e-2722.55C3 and PZP-like alpha-2-macroglobulin domain-conta... [more]
back to top
BLAST of CD109 antigen vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4FB410.000e+045.49Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A4Z2DU200.000e+045.47Alpha-2-macroglobulin OS=Schistosoma japonicum OX=... [more]
A0A4V3SF510.000e+045.10Uncharacterized protein OS=Opisthorchis felineus O... [more]
G7Y5230.000e+044.63CD109 antigen OS=Clonorchis sinensis OX=79923 GN=C... [more]
A0A0X3QFD00.000e+043.47Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
BLAST of CD109 antigen vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cd1092.917e-3921.77CD109 molecule [Source:NCBI gene;Acc:103033754][more]
c42.287e-3821.15complement C4-B-like [Source:NCBI gene;Acc:1030456... [more]
cpamd82.809e-3320.72C3 and PZP like alpha-2-macroglobulin domain conta... [more]
cpamd84.158e-3320.70C3 and PZP like alpha-2-macroglobulin domain conta... [more]
cpamd85.831e-3320.70C3 and PZP like alpha-2-macroglobulin domain conta... [more]
back to top
BLAST of CD109 antigen vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cd1093.410e-6022.59CD109 molecule [Source:ZFIN;Acc:ZDB-GENE-120215-25... [more]
cpamd83.977e-3122.64C3 and PZP like alpha-2-macroglobulin domain conta... [more]
cpamd86.810e-2324.73C3 and PZP like alpha-2-macroglobulin domain conta... [more]
cpamd83.499e-2122.73C3 and PZP like alpha-2-macroglobulin domain conta... [more]
ENSPMAT00000006925.17.967e-1923.99pep scaffold:Pmarinus_7.0:GL476344:729185:756992:-... [more]
back to top
BLAST of CD109 antigen vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CD109 antigen vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO329541.271e-1827.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO381933.938e-1426.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329561.737e-1320.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333911.957e-921.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329521.559e-833.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CD109 antigen vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000001261.21.347e-1420.72alpha-2-macroglobulin-like protein 1 [Source:NCBI ... [more]
ENSORLT00000030023.11.732e-1432.26alpha-2-macroglobulin-like protein 1 [Source:NCBI ... [more]
cd1091.868e-1422.37CD109 molecule [Source:ZFIN;Acc:ZDB-GENE-120215-25... [more]
ENSORLT00000021018.21.937e-1422.99pep primary_assembly:ASM223467v1:4:29856521:298678... [more]
c3b.22.236e-1322.88complement C3 [Source:NCBI gene;Acc:101170893][more]
back to top
BLAST of CD109 antigen vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000016163.10.000e+0100.00SMESG000016163.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001852 ID=SMED30001852|Name=CD109 antigen|organism=Schmidtea mediterranea sexual|type=transcript|length=5304bp
TTCATTCGTATAATATTTAAAAACATTTTCCTTATTAAAAGGAAATATTT
TTGTACAGTATCAAATTAATAAAACTACCCATATCATTCCAAAGAGTTCA
GAAATTATCAGTCTCATGAAGATTTATTGCTTCATAACACTTTTAATAGT
GTTAATTTTGCAAATTCAAAATGCAACTGCTCAAAGAAAAGAATCATATA
AACTTCCTCCAATGCCGAGCTACATCATACTAGCTCCGAAACGAATCAGA
CCTGGTCAATTATATCAAACAAGTGTGACAATTGTTAAATTGCTTTATCC
AACGTTAACAATTCGAATGTCAATTAAACGAAATGATTTTGAATATATTC
ATGAAACTACTACATTTAAAACAGAAGGAACTCAAATTATGAGATTAGAG
ATTCCAACTCGCGTTGCTCCACCTGATGATTACTATCTGGAAGTAGTGGG
ATCTGTAACAGATAACAGTGCCATTATATTCTCAAACCGTACACGATTAG
AATTTAATCCGAAAGAATTTTCAGTGTTTATTCAAATGAGCAAACCAGTT
TATCATCAAGGCCAAACCGTTCAATTCCGAGTGATACCGCTCTATCCGAA
TCTGATGCCGGTATTTGGTACGATAACTGCGATTCAAGCTATCAATCCGA
ATGGATTCATTGTGAAACGTTGGATGAATCCCACAACATCGGTTGGAGGT
ATATACGAAATGCAATTTCCATTGGCTGATCAAGTGACAGAAGGCAATTG
GACGATTGAAGTTGAACTGGAAAAATGGAAATCACGAAAATCATTCCATG
TGAAAGAATATTGGCTGCCGAGATTCGATGTGAATATTACTCTTCCTGTT
AAATTGTCAGATCAAGGATTCGGTGTTTATGGAATCATTCAGGCAAACAA
AACCAGTGGAATGTTTGTCAGAGGAAATGCCTCGATCACTCTGGAAATTA
GAGACCCAGCATTGGACCGTTTTACGACGGCGCCGCTGTTGCAAATAAAT
AGAACAATCAATTACTTTGAAGGGAAAGCAGATTTTCTTTTCACAATGGA
CGAATTGAGAAGTTTAATCAATCAAGGCTCATTGGCATTTAAAGATGTTT
GGGTAAATGCGACTGTTTTCGATTCATTTACAGAACTCGTTCGAACTGGC
TGGGCGTACACTTTTATCTATTCGGATGATACCGCAGTGAAATTTCTTGG
TGGTCTTGTCAGGCCTTTCAAGCCTAATATGACTTTTACAGCTTTTTTGT
CAGTTTATCAACCGGATGGCACAAAAACTGTTACTACGATTAATCGCAAT
GTCAACGTGAAGGCGTACTGCATCGACAGCGTTAAGACCGATGAGTTTTC
CAATCTCATTGTCCCGGATAGTGGAGTTATTCGATTGTCATTTGTTCCCA
CCCAAAGTTTAACATGTCCAACGTATCGATTGAGGGCAGAATATTTGGAG
GACGGCAATCGACTAATCAGCTGGAGCGAACAGAGACTGTTTAAATATTA
TTCTCAATCTGGAGCTTACATGCAAATAACAATGGCCACCGAATATCCGA
GAGTAAATGAATATGCGGTCTTTCAAATTGATATGTCATATCCAACAAAC
AAAATCTTCGTTCAAGTAGTTGCTGGTGGTAATATTGTCTATGTCGATAC
AATCGTAATGCAAAATTCGGTCAAAACGAGAACTTTCTCCATATCAATTA
GCCGAGACATGGCTCCTGTAGCTCGAGTGGTCGCGTACTATGTGAAAACA
GATGGAGAAGTCGTTTCAGATTCGTTGACGTTTTTTTCGAATATTACAAA
TTTAAATAACGTCAACATTGGTGTCAACAGAGGGAAAGATCTTAATATGG
ATACTGTGGAAATCAATGGCTATGGAGAACCAGGATCATTTCTCGCATTG
AATGTATTACATTATGATCTCTATAGTCGAGGGGCTGACAATATTCTTAG
GGATTATAATATAATTGACGAAATGAAAACCTATGAACAAAACTTTCAAC
AGCCCATAGAACAAGACTGGTTATATAACCTCGAATATATCATTCGCACT
TATTTGCCATCTCCATCATTCGGAGCTGATACAAATACAACTATGAATTC
CTCTGGGCTGATAATATTTTCCGATGCCAACTATACTATGGTCAATTTTT
ACAATACTTGCAATGAAACTGTAGATAAGAGTCAAGCCTTGCCTTGTTAC
TCGACCACGGGGAAGCAATGCTATAGCCGAGCTGAACGTTGTGATGGCAC
GAACCAGTGTATCAATTGGGTCGACGAACTCGGTTGCCCTGAGACAACAG
CCAATCCTACTCCAAAGCCAAAAAACATGCTACGCAATTTTGATATGCTT
TATAGGCATTGGAATGATGGAGCATGGCTCTGGAAAACTTACTGGATTAA
ACCAAACGGACGAATCAATTTTCGCGTTGATTTACCAAAGATGGACACAT
CGTGGGTTATTGGAGCATATGCAATAGATCGGGAAAAAGGATTTTCTATT
GTTGAAAGACCAGCGATATTTAGTGGAATCAGAAGGTTTTATATGGTCGT
CGAAGTGCCAGAAGAATGTCAATATGGTGAACAACTTGGAGTTAGAATAA
CTTTGTTCAACTATTGGGATTATTGGACTGAGGCTTTATTGGAAGTCAAA
CAATCTGATCAGTATCGAGTGGTTCAAGTTGCGGAATATGGTATTACCCG
AGCGTTTGATCCAGAAACAATATCGAATAAATCAGTTCATACTTTGGTAT
ACCTAAATGCGGGAGAAGCAAAATTCATATTTTTCCCCATCGTTCTCAAT
TGGAAAGGAAATAACGACACAAATGCCACAATAAGCATATGTGCATATAC
ATTCATCGGATCCAACTGTGAAAATAGGGAAATCAAAATTTCGATGAATG
GTGTTACGAATTATTATCACACAAATAATTTGGTTGATCTTACATCTAAA
GCTCAACTAGCCGTTTACAATTTCAAAATACAGCTTCGACAAAGCTTTTA
CGAACCAGAAGAAAGAATGTTACGTTGGGTGCCGGATTCAAAAATAGCTA
AAGTTTCCATAGTCGGAGATATTGTTGGTCCCACACCAAGTTTTAAACTT
CAGTTTGTTGATACTTATAAAGGTTTACGAATGTCCCATGGTGCCGCGGA
AAATATATTCTTCGAATTCGGCTACAATATATATTTGTTAAAATATATTC
GTCGTGATCGAACTACTTCAATAAATGTTACAATTAACACGTTAAACTAC
TGCAATAAGATCCTTCAAGATTGTCTTAGTTATTTTGACTCGACATCTGG
TGGATTTTCCAATTTCCGAGAATCAAGAAATAGACCGAATACTCTGGCTA
CCGCTTTTGCGTTATGGAATCTCCTAGCCGTTAACGAAGCTGACTGGGAT
CGTTATATTTACATCCCGGAAAATTTGATTCAAGTTGCTACAAATTTCAT
TTACAATCAACAAATTAAAGGAGGAATTTTCGATGGAAGTTTTGAACCAA
TCGATATCTTGGATAGCAAATTTCTCCCGACAAATATATCAACTACGTTG
AGTGCTACTGACGCAGAAGCCCAAAGACGTATTCCAATAACAGCAATGGT
CATCCTCAGTATTAGTGACAAAAAAGCTGTTTCACCTAATGCAGAAATAA
TCCAGAGAGCTACTGCATTTATTGATAGGCATTTGATCAACAGTATAGAT
TTATTTAGCCAAATTATCGGGACCTACGCTCTTAGTAAAAGTGGAACTTC
AGCTTATAGTGGCAAGATTTCAACAATGATAACAACTATAATGAACAATG
CTCGTTATGATGGACAGGCTAAATACTTTTCCGATTCGGATGTCAAACCG
CAATATACTGAACAAACCAATGCCGGAACGTTGATGATCAATCCAAGATT
GGAGTGGCCAAATGATGGCCTCACAACGGCATGTACTGCAATGGCTATGT
TGTTGTTCAAAGAACAAAATATATGGAAAGAAAACGATCCGAATAATATG
GAAACGATAACGTTTCTAGCTAAAATGAGAAATCACGTCAGCGGTTTTAC
CAGTACTTTCGATTCTTCTGTAGCACTGAGACTTTTCTACAGTTTCTCAG
CAACAGACAGAAATAGAGAATTGTACAAACTGCAAGTCGAAATGACAATG
AGCAGTCGTGGAAATTGGCGTGAAACATACGGAATACAATTTTCAAATTA
TACAGTCGGTAATTTGACCACCATTCCGAATGATTTTGTATGGGGAGAAT
TCGTTCTTGTAGCTCAAGGAACAGGGCGATTGTTAATGCAGTTAGACGTT
GAAGGCCGTGTTTTCGATGCGGTTCGACTAAAAAACCCAAGAAATCCTTC
ATCGGTTGATTTGCCCTTTCAAACTTTCGATATTAATTGTCGTGCCAAAT
TTTCTGGGAAAAATTCTTCAATTCTTATTATGGATATTTGCGGTTCTTGG
CTTGGTTTCAATTCACCAATCAACAGACCGGAAGCAGGAATGACTGTTTT
TGACGTGGAATTACCCACCGGATATGTGGCACTTAATGATGAATTGAGAC
GCTATGTTGAGTCTGGATCTCAACCACTTCTCAGATATGCAAGATTTTGG
CCTGGAAAAATACATTTCTATTTAGCTAAATTACCACAAACACAAACATG
TGTAACATTTAGAGCTGACCGCTATTTCCCAGTTGCTAACGTGAGCCGTG
ATCATTTATGCAGTGCCTATGAATATTATGAACCGGGACGGTACAATAGA
TCAATTTATCAAACCGTTGAATTATATTCCAATCACATTTGTAACGTATT
CGGATCATACCAATGCCCTTATTCACCATATTTCAATGTTGCCAGCAGCA
CAGTTGAGATCAATTTCCTCTTTGTGTTTGCGATCATTGTTGCATCGCTA
CTGGATCAATTACATTTATTTAGTAACCTGAAGAATTTCTTTATAACGTG
AATTATTTTCCTACAATTCTAACCATTCCCTACAAAGATTCGCGTCTGTG
TATATAATGTTATGTGCATTTTTATGATTGACTTGAGGTCGAGCGAGTTA
TTTTACTATTTCTATGAACGGCTGTGTTTTATTCCATTACTTTTTTAATT
TTAATTCCATAATTGTATAATAATGTTGCTTTATAAATGTGACGGATGCT
CACGTACCTGTCATATATAACTGGAAGGCAAGGTTTGTGATATTCCAATC
CTCCTTTTATTAGTTTCGGAAATGTACTTTTTCAAATGGCTGTGAATTTA
CAATAATTTACTGTGAAATAAATCTTTTTCATTTATAAAAAAAAGATCGG
AAGA
back to top

protein sequence of SMED30001852-orf-1

>SMED30001852-orf-1 ID=SMED30001852-orf-1|Name=SMED30001852-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1612bp
MKIYCFITLLIVLILQIQNATAQRKESYKLPPMPSYIILAPKRIRPGQLY
QTSVTIVKLLYPTLTIRMSIKRNDFEYIHETTTFKTEGTQIMRLEIPTRV
APPDDYYLEVVGSVTDNSAIIFSNRTRLEFNPKEFSVFIQMSKPVYHQGQ
TVQFRVIPLYPNLMPVFGTITAIQAINPNGFIVKRWMNPTTSVGGIYEMQ
FPLADQVTEGNWTIEVELEKWKSRKSFHVKEYWLPRFDVNITLPVKLSDQ
GFGVYGIIQANKTSGMFVRGNASITLEIRDPALDRFTTAPLLQINRTINY
FEGKADFLFTMDELRSLINQGSLAFKDVWVNATVFDSFTELVRTGWAYTF
IYSDDTAVKFLGGLVRPFKPNMTFTAFLSVYQPDGTKTVTTINRNVNVKA
YCIDSVKTDEFSNLIVPDSGVIRLSFVPTQSLTCPTYRLRAEYLEDGNRL
ISWSEQRLFKYYSQSGAYMQITMATEYPRVNEYAVFQIDMSYPTNKIFVQ
VVAGGNIVYVDTIVMQNSVKTRTFSISISRDMAPVARVVAYYVKTDGEVV
SDSLTFFSNITNLNNVNIGVNRGKDLNMDTVEINGYGEPGSFLALNVLHY
DLYSRGADNILRDYNIIDEMKTYEQNFQQPIEQDWLYNLEYIIRTYLPSP
SFGADTNTTMNSSGLIIFSDANYTMVNFYNTCNETVDKSQALPCYSTTGK
QCYSRAERCDGTNQCINWVDELGCPETTANPTPKPKNMLRNFDMLYRHWN
DGAWLWKTYWIKPNGRINFRVDLPKMDTSWVIGAYAIDREKGFSIVERPA
IFSGIRRFYMVVEVPEECQYGEQLGVRITLFNYWDYWTEALLEVKQSDQY
RVVQVAEYGITRAFDPETISNKSVHTLVYLNAGEAKFIFFPIVLNWKGNN
DTNATISICAYTFIGSNCENREIKISMNGVTNYYHTNNLVDLTSKAQLAV
YNFKIQLRQSFYEPEERMLRWVPDSKIAKVSIVGDIVGPTPSFKLQFVDT
YKGLRMSHGAAENIFFEFGYNIYLLKYIRRDRTTSINVTINTLNYCNKIL
QDCLSYFDSTSGGFSNFRESRNRPNTLATAFALWNLLAVNEADWDRYIYI
PENLIQVATNFIYNQQIKGGIFDGSFEPIDILDSKFLPTNISTTLSATDA
EAQRRIPITAMVILSISDKKAVSPNAEIIQRATAFIDRHLINSIDLFSQI
IGTYALSKSGTSAYSGKISTMITTIMNNARYDGQAKYFSDSDVKPQYTEQ
TNAGTLMINPRLEWPNDGLTTACTAMAMLLFKEQNIWKENDPNNMETITF
LAKMRNHVSGFTSTFDSSVALRLFYSFSATDRNRELYKLQVEMTMSSRGN
WRETYGIQFSNYTVGNLTTIPNDFVWGEFVLVAQGTGRLLMQLDVEGRVF
DAVRLKNPRNPSSVDLPFQTFDINCRAKFSGKNSSILIMDICGSWLGFNS
PINRPEAGMTVFDVELPTGYVALNDELRRYVESGSQPLLRYARFWPGKIH
FYLAKLPQTQTCVTFRADRYFPVANVSRDHLCSAYEYYEPGRYNRSIYQT
VELYSNHICNVFGSYQCPYSPYFNVASSTVEINFLFVFAIIVASLLDQLH
LFSNLKNFFIT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000025nervous system
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036595A-macroglobulin_rcpt-bd_sf
IPR009048A-macroglobulin_rcpt-bd
IPR011625A2M_N_BRD
IPR001599Macroglobln_a2
IPR011626Alpha-macroglobulin_TED
IPR008930Terpenoid_cyclase/PrenylTrfase
IPR002172LDrepeatLR_classA_rpt
IPR002890MG2
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005615extracellular space
Vocabulary: molecular function
TermDefinition
GO:0004866endopeptidase inhibitor activity
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0010951negative regulation of endopeptidase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011625Alpha-2-macroglobulin, bait region domainSMARTSM01359A2M_N_2_2coord: 469..602
e-value: 3.3E-14
score: 63.2
IPR011625Alpha-2-macroglobulin, bait region domainPFAMPF07703A2M_BRDcoord: 470..597
e-value: 5.1E-16
score: 59.3
IPR009048Alpha-macroglobulin, receptor-bindingSMARTSM01361A2M_recep_2coord: 1457..1548
e-value: 2.2E-16
score: 70.5
IPR009048Alpha-macroglobulin, receptor-bindingPFAMPF07677A2M_recepcoord: 1457..1548
e-value: 5.3E-18
score: 65.5
IPR001599Alpha-2-macroglobulinSMARTSM01360A2M_2coord: 753..844
e-value: 8.8E-5
score: 29.5
IPR001599Alpha-2-macroglobulinPFAMPF00207A2Mcoord: 753..835
e-value: 5.7E-11
score: 42.1
IPR036595Alpha-macroglobulin, receptor-binding domain superfamilyGENE3DG3DSA:2.60.40.690coord: 1419..1574
e-value: 5.3E-26
score: 93.5
IPR036595Alpha-macroglobulin, receptor-binding domain superfamilySUPERFAMILYSSF49410Alpha-macroglobulin receptor domaincoord: 1420..1549
NoneNo IPR availableGENE3DG3DSA:2.60.40.1940coord: 235..348
e-value: 1.8E-5
score: 27.2
NoneNo IPR availableGENE3DG3DSA:2.20.130.20coord: 713..805
e-value: 2.2E-6
score: 29.4
NoneNo IPR availableGENE3DG3DSA:2.60.40.1930coord: 134..234
e-value: 1.7E-23
score: 84.9
NoneNo IPR availableGENE3DG3DSA:2.60.40.1930coord: 464..559
e-value: 4.6E-19
score: 70.2
NoneNo IPR availableGENE3DG3DSA:1.50.10.20coord: 1002..1332
e-value: 2.4E-38
score: 134.3
NoneNo IPR availablePANTHERPTHR11412MACROGLOBULIN/COMPLEMENTcoord: 35..1582
NoneNo IPR availablePANTHERPTHR11412:SF146LD23292Pcoord: 35..1582
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.895
IPR002890Macroglobulin domainPFAMPF01835MG2coord: 137..229
e-value: 9.5E-10
score: 38.8
IPR011626Alpha-macroglobulin-like, TED domainPFAMPF07678TED_complementcoord: 980..1323
e-value: 2.0E-25
score: 89.5
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 681..725
score: 8.913
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 700..724
e-value: 0.00595603
score: 34.1046
IPR008930Terpenoid cyclases/protein prenyltransferase alpha-alpha toroidSUPERFAMILYSSF48239Terpenoid cyclases/Protein prenyltransferasescoord: 1004..1321