SMED30001826

Overview
NameSMED30001826
Smed IDSMED30001826
Length (bp)2247
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30001826 (SMED30001826) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30001826 (SMED30001826) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001826

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30001826SMESG000049480.1 dd_Smed_v4_7716_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001826SMESG000049480.1 dd_Smed_v4_7716_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30001826SMESG000049480.1 dd_Smed_v4_7716_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001826SMESG000049480.1 dd_Smed_v6_7716_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30001826 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.007709:103..14688 +10845
Homology
BLAST of SMED30001826 vs. Planmine SMEST
Match: SMESG000049480.1 (SMESG000049480.1)

HSP 1 Score: 1358.97 bits (3516), Expect = 0.000e+0
Identity = 680/689 (98.69%), Postives = 685/689 (99.42%), Query Frame = 3
Query:  171 MSTKVFSCFFPMLLSFILIKPNSSQEYMQSKLLKIDPLSITVDPYLYRLCWNYLGHDPDKEIVGIRKGALAHFQIFNDSSSLIGKYCISNEENPSNYLIQLPFNRYNSSNTIQIQVDFTMPLGPPIDIIRIKTVPHGVHFQIDQEFRSIEKSEFVKCNVTLIYSTYWKESVIQFQISSNSNHQHVFQRIPPNSHFTAFSSCIIVDIIKASSAFVKYDGNTKVVENTSDLKLFIPIALRKFILIVWQNLPIVPEAYSIAIYEKQSSGKENCLKVFRMCKNNVINCEGINLARVDNSIIQTEDLGFYHDNDNFYYVILDMVRPLKYYSKYSLSIFWKNSYGAIKENFLPLTLIARKNNARINPMFLKYAPSKYDDLRNNISDMKQNVFPSNVVNPVMDETFELGLYEKILILPSISKTNELVFSETKNLNKQIITEKCANSNECSKGFYPFFYALLLQQTETQSNIEIVQLPKSKKIQLTYENVQLAADEYRSSLQVLWKVSDNSISPSMFWIKISHRPSDLCQGVYIIKCKTCNDKFNEISEKFSPKFTECRNPPVFLVDYYFYPTNKHFSINTNPISTESLFSAQIFAVVFSTVIKSNVSNSEFVRDGSKKKIVFGSIISAFSXXXXXXXXXXXXKFRKVLSKFKRPTENQTMQNCNDSLYDEDVDNNSDKQAQVSVNKEKEEFENLYE 2237
            MSTKVF+CFFPMLLSF+LIKPNSSQEYMQSKLLKIDPLSITVDPYL RLCWNYLGHDPDKEIVGIRKGA AHFQIFNDSSSLIGKYCISNEENPSNYLIQLPFNRYNSSNTIQIQVDFTMPLGPPIDIIRIKTVPHGVHFQIDQEFRSIEKSEFVKCNVTLIYSTYWKESVIQFQISSNSNHQHVFQRIPPNSHFTAFSSCIIVDIIKASSAFVKYDGNTKVVENTSDLKLFIPIALRKFILIVWQNLPIVPEAYSIAIYEKQSSGKENC+KVFRMCKNNVINCEGINLARV NSIIQTEDLGFYHD+DNFYYVILDMVRPLKYYSKYSLSIFWKNSYGAIKENFLPLTLIARKNNARINPMFLKYAPSKY+DLRNNISDMKQNVFPSNVVNPVMDETFELGLYEKILILPSISKTNELVFSETKNLNKQIITEKCANSNECSKGFYPFFYALLLQQTETQSNIEIVQLPKSKKIQLTYENVQLAADEYRSSLQVLWKVSDNSISPSMFWIKISHRPSDLCQGVYIIKCKTCNDKFNEISEKFSPKFTECRNPPVFLVD YFYPTNKHFSINTNPISTESLFSAQIFAVVFSTVIKSNVSNSEFVRDGSKKKIVFGSIISAFSLIAVVLLIIGLLKFRKVLSKFKRPTENQTMQNCNDSLYDEDVDNNSDKQAQVSVNKEKEEFENLYE
Sbjct:    1 MSTKVFNCFFPMLLSFVLIKPNSSQEYMQSKLLKIDPLSITVDPYLNRLCWNYLGHDPDKEIVGIRKGAPAHFQIFNDSSSLIGKYCISNEENPSNYLIQLPFNRYNSSNTIQIQVDFTMPLGPPIDIIRIKTVPHGVHFQIDQEFRSIEKSEFVKCNVTLIYSTYWKESVIQFQISSNSNHQHVFQRIPPNSHFTAFSSCIIVDIIKASSAFVKYDGNTKVVENTSDLKLFIPIALRKFILIVWQNLPIVPEAYSIAIYEKQSSGKENCVKVFRMCKNNVINCEGINLARVGNSIIQTEDLGFYHDDDNFYYVILDMVRPLKYYSKYSLSIFWKNSYGAIKENFLPLTLIARKNNARINPMFLKYAPSKYEDLRNNISDMKQNVFPSNVVNPVMDETFELGLYEKILILPSISKTNELVFSETKNLNKQIITEKCANSNECSKGFYPFFYALLLQQTETQSNIEIVQLPKSKKIQLTYENVQLAADEYRSSLQVLWKVSDNSISPSMFWIKISHRPSDLCQGVYIIKCKTCNDKFNEISEKFSPKFTECRNPPVFLVDNYFYPTNKHFSINTNPISTESLFSAQIFAVVFSTVIKSNVSNSEFVRDGSKKKIVFGSIISAFSLIAVVLLIIGLLKFRKVLSKFKRPTENQTMQNCNDSLYDEDVDNNSDKQAQVSVNKEKEEFENLYE 689          
BLAST of SMED30001826 vs. Planmine SMEST
Match: SMESG000049480.1 (SMESG000049480.1)

HSP 1 Score: 1337.01 bits (3459), Expect = 0.000e+0
Identity = 670/678 (98.82%), Postives = 674/678 (99.41%), Query Frame = 3
Query:  204 MLLSFILIKPNSSQEYMQSKLLKIDPLSITVDPYLYRLCWNYLGHDPDKEIVGIRKGALAHFQIFNDSSSLIGKYCISNEENPSNYLIQLPFNRYNSSNTIQIQVDFTMPLGPPIDIIRIKTVPHGVHFQIDQEFRSIEKSEFVKCNVTLIYSTYWKESVIQFQISSNSNHQHVFQRIPPNSHFTAFSSCIIVDIIKASSAFVKYDGNTKVVENTSDLKLFIPIALRKFILIVWQNLPIVPEAYSIAIYEKQSSGKENCLKVFRMCKNNVINCEGINLARVDNSIIQTEDLGFYHDNDNFYYVILDMVRPLKYYSKYSLSIFWKNSYGAIKENFLPLTLIARKNNARINPMFLKYAPSKYDDLRNNISDMKQNVFPSNVVNPVMDETFELGLYEKILILPSISKTNELVFSETKNLNKQIITEKCANSNECSKGFYPFFYALLLQQTETQSNIEIVQLPKSKKIQLTYENVQLAADEYRSSLQVLWKVSDNSISPSMFWIKISHRPSDLCQGVYIIKCKTCNDKFNEISEKFSPKFTECRNPPVFLVDYYFYPTNKHFSINTNPISTESLFSAQIFAVVFSTVIKSNVSNSEFVRDGSKKKIVFGSIISAFSXXXXXXXXXXXXKFRKVLSKFKRPTENQTMQNCNDSLYDEDVDNNSDKQAQVSVNKEKEEFENLYE 2237
            MLLSF+LIKPNSSQEYMQSKLLKIDPLSITVDPYL RLCWNYLGHDPDKEIVGIRKGA AHFQIFNDSSSLIGKYCISNEENPSNYLIQLPFNRYNSSNTIQIQVDFTMPLGPPIDIIRIKTVPHGVHFQIDQEFRSIEKSEFVKCNVTLIYSTYWKESVIQFQISSNSNHQHVFQRIPPNSHFTAFSSCIIVDIIKASSAFVKYDGNTKVVENTSDLKLFIPIALRKFILIVWQNLPIVPEAYSIAIYEKQSSGKENC+KVFRMCKNNVINCEGINLARV NSIIQTEDLGFYHD+DNFYYVILDMVRPLKYYSKYSLSIFWKNSYGAIKENFLPLTLIARKNNARINPMFLKYAPSKY+DLRNNISDMKQNVFPSNVVNPVMDETFELGLYEKILILPSISKTNELVFSETKNLNKQIITEKCANSNECSKGFYPFFYALLLQQTETQSNIEIVQLPKSKKIQLTYENVQLAADEYRSSLQVLWKVSDNSISPSMFWIKISHRPSDLCQGVYIIKCKTCNDKFNEISEKFSPKFTECRNPPVFLVD YFYPTNKHFSINTNPISTESLFSAQIFAVVFSTVIKSNVSNSEFVRDGSKKKIVFGSIISAFSLIAVVLLIIGLLKFRKVLSKFKRPTENQTMQNCNDSLYDEDVDNNSDKQAQVSVNKEKEEFENLYE
Sbjct:    1 MLLSFVLIKPNSSQEYMQSKLLKIDPLSITVDPYLNRLCWNYLGHDPDKEIVGIRKGAPAHFQIFNDSSSLIGKYCISNEENPSNYLIQLPFNRYNSSNTIQIQVDFTMPLGPPIDIIRIKTVPHGVHFQIDQEFRSIEKSEFVKCNVTLIYSTYWKESVIQFQISSNSNHQHVFQRIPPNSHFTAFSSCIIVDIIKASSAFVKYDGNTKVVENTSDLKLFIPIALRKFILIVWQNLPIVPEAYSIAIYEKQSSGKENCVKVFRMCKNNVINCEGINLARVGNSIIQTEDLGFYHDDDNFYYVILDMVRPLKYYSKYSLSIFWKNSYGAIKENFLPLTLIARKNNARINPMFLKYAPSKYEDLRNNISDMKQNVFPSNVVNPVMDETFELGLYEKILILPSISKTNELVFSETKNLNKQIITEKCANSNECSKGFYPFFYALLLQQTETQSNIEIVQLPKSKKIQLTYENVQLAADEYRSSLQVLWKVSDNSISPSMFWIKISHRPSDLCQGVYIIKCKTCNDKFNEISEKFSPKFTECRNPPVFLVDNYFYPTNKHFSINTNPISTESLFSAQIFAVVFSTVIKSNVSNSEFVRDGSKKKIVFGSIISAFSLIAVVLLIIGLLKFRKVLSKFKRPTENQTMQNCNDSLYDEDVDNNSDKQAQVSVNKEKEEFENLYE 678          
BLAST of SMED30001826 vs. Planmine SMEST
Match: SMESG000049480.1 (SMESG000049480.1)

HSP 1 Score: 1306.58 bits (3380), Expect = 0.000e+0
Identity = 655/662 (98.94%), Postives = 658/662 (99.40%), Query Frame = 3
Query:  252 MQSKLLKIDPLSITVDPYLYRLCWNYLGHDPDKEIVGIRKGALAHFQIFNDSSSLIGKYCISNEENPSNYLIQLPFNRYNSSNTIQIQVDFTMPLGPPIDIIRIKTVPHGVHFQIDQEFRSIEKSEFVKCNVTLIYSTYWKESVIQFQISSNSNHQHVFQRIPPNSHFTAFSSCIIVDIIKASSAFVKYDGNTKVVENTSDLKLFIPIALRKFILIVWQNLPIVPEAYSIAIYEKQSSGKENCLKVFRMCKNNVINCEGINLARVDNSIIQTEDLGFYHDNDNFYYVILDMVRPLKYYSKYSLSIFWKNSYGAIKENFLPLTLIARKNNARINPMFLKYAPSKYDDLRNNISDMKQNVFPSNVVNPVMDETFELGLYEKILILPSISKTNELVFSETKNLNKQIITEKCANSNECSKGFYPFFYALLLQQTETQSNIEIVQLPKSKKIQLTYENVQLAADEYRSSLQVLWKVSDNSISPSMFWIKISHRPSDLCQGVYIIKCKTCNDKFNEISEKFSPKFTECRNPPVFLVDYYFYPTNKHFSINTNPISTESLFSAQIFAVVFSTVIKSNVSNSEFVRDGSKKKIVFGSIISAFSXXXXXXXXXXXXKFRKVLSKFKRPTENQTMQNCNDSLYDEDVDNNSDKQAQVSVNKEKEEFENLYE 2237
            MQSKLLKIDPLSITVDPYL RLCWNYLGHDPDKEIVGIRKGA AHFQIFNDSSSLIGKYCISNEENPSNYLIQLPFNRYNSSNTIQIQVDFTMPLGPPIDIIRIKTVPHGVHFQIDQEFRSIEKSEFVKCNVTLIYSTYWKESVIQFQISSNSNHQHVFQRIPPNSHFTAFSSCIIVDIIKASSAFVKYDGNTKVVENTSDLKLFIPIALRKFILIVWQNLPIVPEAYSIAIYEKQSSGKENC+KVFRMCKNNVINCEGINLARV NSIIQTEDLGFYHD+DNFYYVILDMVRPLKYYSKYSLSIFWKNSYGAIKENFLPLTLIARKNNARINPMFLKYAPSKY+DLRNNISDMKQNVFPSNVVNPVMDETFELGLYEKILILPSISKTNELVFSETKNLNKQIITEKCANSNECSKGFYPFFYALLLQQTETQSNIEIVQLPKSKKIQLTYENVQLAADEYRSSLQVLWKVSDNSISPSMFWIKISHRPSDLCQGVYIIKCKTCNDKFNEISEKFSPKFTECRNPPVFLVD YFYPTNKHFSINTNPISTESLFSAQIFAVVFSTVIKSNVSNSEFVRDGSKKKIVFGSIISAFSLIAVVLLIIGLLKFRKVLSKFKRPTENQTMQNCNDSLYDEDVDNNSDKQAQVSVNKEKEEFENLYE
Sbjct:    1 MQSKLLKIDPLSITVDPYLNRLCWNYLGHDPDKEIVGIRKGAPAHFQIFNDSSSLIGKYCISNEENPSNYLIQLPFNRYNSSNTIQIQVDFTMPLGPPIDIIRIKTVPHGVHFQIDQEFRSIEKSEFVKCNVTLIYSTYWKESVIQFQISSNSNHQHVFQRIPPNSHFTAFSSCIIVDIIKASSAFVKYDGNTKVVENTSDLKLFIPIALRKFILIVWQNLPIVPEAYSIAIYEKQSSGKENCVKVFRMCKNNVINCEGINLARVGNSIIQTEDLGFYHDDDNFYYVILDMVRPLKYYSKYSLSIFWKNSYGAIKENFLPLTLIARKNNARINPMFLKYAPSKYEDLRNNISDMKQNVFPSNVVNPVMDETFELGLYEKILILPSISKTNELVFSETKNLNKQIITEKCANSNECSKGFYPFFYALLLQQTETQSNIEIVQLPKSKKIQLTYENVQLAADEYRSSLQVLWKVSDNSISPSMFWIKISHRPSDLCQGVYIIKCKTCNDKFNEISEKFSPKFTECRNPPVFLVDNYFYPTNKHFSINTNPISTESLFSAQIFAVVFSTVIKSNVSNSEFVRDGSKKKIVFGSIISAFSLIAVVLLIIGLLKFRKVLSKFKRPTENQTMQNCNDSLYDEDVDNNSDKQAQVSVNKEKEEFENLYE 662          
BLAST of SMED30001826 vs. Planmine SMEST
Match: SMESG000049481.1 (SMESG000049481.1)

HSP 1 Score: 258.455 bits (659), Expect = 9.514e-76
Identity = 166/538 (30.86%), Postives = 285/538 (52.97%), Query Frame = 3
Query:  204 MLLSFILIKPNSSQEYMQSKL-LKIDPLSITVDPYLYRLCWNYLGHDPDKEI-VGIRKGALAHFQIFNDSSSLIGKYCISNEENPSNYLIQLPFNRYNSSNTIQIQVDFTMPLGPPIDIIRIKTVPHGVHFQIDQEFRSIEKSEFVKCNVTLIYSTYWKESVIQFQISSNSNHQHVFQRIPPNSHFTAFSSCIIVDIIKASSAFVKYDGNTKVVENTSDLKLFIPIALRKFILIVWQNLPIVPEAYSIAIYEKQSSGKENCLKVFRMCKNNVI--NCEGINLARVDNSIIQTEDLGFYHDNDNFYY-VILDMVRPLKYYSKYSLSIFWKNSYGAIKENFLPLTLIARKNNARINPMFLKYAPSKYDDLRNNISDMKQNVFPSNVVNPVMDETFELGLYEKILILPSISKTNELVFSETKNLNKQIITEKCANSNECSKGFYPFFYALLLQQTETQSNIEIVQLPKSKKIQLTYENVQLAADEYRSSLQVLWKVSDN--SISPSMFWIKISHRPSDLCQGVYIIKCKTCNDKFNEISEK 1796
            M+++F++   N     + +K  L +DP+SI VDP LYRLCW+ +     + I   +         +F+D       +C+   +  S Y I+ P   Y+     +I V+F++ L P  DIIR + VP G+HF ++ EF  + K+ +  C V L+++T   + +IQF++ S+  + + F ++   S +  + SC     ++ SS      G T   E T  LK FI I  RKFI+ +W+N   VP +Y + I +     K  C+K FR+ K + I  N +     +   S ++  DLGFY  + +    VIL+M + +K   +Y  SIFWK+    ++ENF+  T +  +N A +NP F+    + YD+LRN  S+  Q +   N  +P+ +E      Y   LI+P++S+++ ++    ++  +  +  KC +S EC++GF+PFFY+L   + +   N EI+++P+S    +   NV+L ++   S+ QV W   D+  +ISPS + ++I     + C    IIKCKTC++ + + S K
Sbjct:    1 MMIAFVIFLINLYDLILATKWQLNVDPISIRVDPKLYRLCWDQINTSKFEYINASVSSSKEISLAVFSDPHQSNRTFCVERIDKHSLYSIKFPIMFYSKLERFEILVNFSVKLSPSWDIIRTQIVPSGIHFHLNSEFAGMSKN-YPICKVLLLFATSKSKDMIQFEMDSHRINNN-FIKLEKGSKYIFYYSCHQFTFVQTSSMISSETGTTFGEEKTLPLKPFIQIPFRKFIIALWKNPTNVPNSYVVLIRD----DKGRCVKKFRIMKKSFIKPNQKPEFEEKSCRSKMKVVDLGFYKGSQSGRIKVILNMEKFVKLDIRYKFSIFWKDLDQKVQENFIFFTFLPNENCATVNPKFMNPNLTNYDELRNQNSNFHQILMSENRADPITEEHINASGYNDALIVPAVSESDAMMIQVIQSETRVNMVNKCNSSPECNRGFFPFFYSLFTIRHKQDINTEIIEIPRSIVKTVKITNVELKSNNNTSTFQVSWSRPDSIETISPSSYLLEIKSLSPEKCHLACIIKCKTCSEVYKKGSLK 532          
BLAST of SMED30001826 vs. Planmine SMEST
Match: SMESG000049481.1 (SMESG000049481.1)

HSP 1 Score: 256.144 bits (653), Expect = 5.934e-75
Identity = 162/516 (31.40%), Postives = 274/516 (53.10%), Query Frame = 3
Query:  267 LKIDPLSITVDPYLYRLCWNYLGHDPDKEI-VGIRKGALAHFQIFNDSSSLIGKYCISNEENPSNYLIQLPFNRYNSSNTIQIQVDFTMPLGPPIDIIRIKTVPHGVHFQIDQEFRSIEKSEFVKCNVTLIYSTYWKESVIQFQISSNSNHQHVFQRIPPNSHFTAFSSCIIVDIIKASSAFVKYDGNTKVVENTSDLKLFIPIALRKFILIVWQNLPIVPEAYSIAIYEKQSSGKENCLKVFRMCKNNVI--NCEGINLARVDNSIIQTEDLGFYHDNDNFYY-VILDMVRPLKYYSKYSLSIFWKNSYGAIKENFLPLTLIARKNNARINPMFLKYAPSKYDDLRNNISDMKQNVFPSNVVNPVMDETFELGLYEKILILPSISKTNELVFSETKNLNKQIITEKCANSNECSKGFYPFFYALLLQQTETQSNIEIVQLPKSKKIQLTYENVQLAADEYRSSLQVLWKVSDN--SISPSMFWIKISHRPSDLCQGVYIIKCKTCNDKFNEISEK 1796
            L +DP+SI VDP LYRLCW+ +     + I   +         +F+D       +C+   +  S Y I+ P   Y+     +I V+F++ L P  DIIR + VP G+HF ++ EF  + K+ +  C V L+++T   + +IQF++ S+  + + F ++   S +  + SC     ++ SS      G T   E T  LK FI I  RKFI+ +W+N   VP +Y + I +     K  C+K FR+ K + I  N +     +   S ++  DLGFY  + +    VIL+M + +K   +Y  SIFWK+    ++ENF+  T +  +N A +NP F+    + YD+LRN  S+  Q +   N  +P+ +E      Y   LI+P++S+++ ++    ++  +  +  KC +S EC++GF+PFFY+L   + +   N EI+++P+S    +   NV+L ++   S+ QV W   D+  +ISPS + ++I     + C    IIKCKTC++ + + S K
Sbjct:   22 LNVDPISIRVDPKLYRLCWDQINTSKFEYINASVSSSKEISLAVFSDPHQSNRTFCVERIDKHSLYSIKFPIMFYSKLERFEILVNFSVKLSPSWDIIRTQIVPSGIHFHLNSEFAGMSKN-YPICKVLLLFATSKSKDMIQFEMDSHRINNN-FIKLEKGSKYIFYYSCHQFTFVQTSSMISSETGTTFGEEKTLPLKPFIQIPFRKFIIALWKNPTNVPNSYVVLIRD----DKGRCVKKFRIMKKSFIKPNQKPEFEEKSCRSKMKVVDLGFYKGSQSGRIKVILNMEKFVKLDIRYKFSIFWKDLDQKVQENFIFFTFLPNENCATVNPKFMNPNLTNYDELRNQNSNFHQILMSENRADPITEEHINASGYNDALIVPAVSESDAMMIQVIQSETRVNMVNKCNSSPECNRGFFPFFYSLFTIRHKQDINTEIIEIPRSIVKTVKITNVELKSNNNTSTFQVSWSRPDSIETISPSSYLLEIKSLSPEKCHLACIIKCKTCSEVYKKGSLK 531          
The following BLAST results are available for this feature:
BLAST of SMED30001826 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001826 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001826 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001826 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001826 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001826 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001826 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001826 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001826 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001826 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001826 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001826 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001826 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001826 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049480.10.000e+098.69SMESG000049480.1[more]
SMESG000049480.10.000e+098.82SMESG000049480.1[more]
SMESG000049480.10.000e+098.94SMESG000049480.1[more]
SMESG000049481.19.514e-7630.86SMESG000049481.1[more]
SMESG000049481.15.934e-7531.40SMESG000049481.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001826 ID=SMED30001826|Name=SMED30001826|organism=Schmidtea mediterranea sexual|type=transcript|length=2247bp
TGAAAATTTCGTCCAATGCGTTATCAATTCCGTTCTGCAAACAGATCTTA
ATTCGTTTACTTGCGGTATTCAGCGAATAGTTCGCCGATGTTGTGATCGC
CGATTCTTGTTGACAAGATCTATTTACATTAAATATTCAATCATTTGTTT
TGGAATTTTTATCGAAAATAATGTCGACTAAGGTTTTCAGTTGTTTTTTT
CCAATGTTATTGTCGTTTATTTTGATTAAACCTAACTCGAGTCAGGAATA
TATGCAGTCAAAATTGTTAAAAATTGACCCCCTCTCAATTACTGTCGATC
CGTATCTCTATCGGCTCTGTTGGAATTATCTCGGTCATGATCCAGATAAA
GAAATAGTTGGCATAAGAAAAGGCGCCCTTGCTCATTTCCAGATATTCAA
TGACTCGAGTAGTTTAATAGGGAAATATTGCATTTCCAATGAGGAAAATC
CCTCAAATTACTTAATTCAACTCCCTTTCAATAGATATAATTCATCCAAT
ACAATTCAGATCCAAGTGGATTTTACAATGCCTCTGGGACCACCGATTGA
TATCATACGAATAAAAACGGTTCCGCATGGAGTACATTTTCAAATAGATC
AAGAATTCAGAAGCATTGAAAAGTCAGAATTTGTTAAGTGCAATGTCACT
TTAATTTATTCGACATATTGGAAGGAATCAGTAATCCAATTTCAGATCTC
TTCGAATTCTAATCATCAACATGTTTTTCAAAGAATACCACCAAATTCGC
ATTTTACTGCATTTAGCAGTTGCATAATTGTAGATATCATTAAGGCTTCT
TCTGCCTTTGTGAAATACGACGGCAATACGAAAGTTGTAGAAAACACGTC
GGATTTGAAGCTGTTCATTCCGATTGCTTTGAGAAAATTTATTTTGATCG
TTTGGCAAAATCTACCAATAGTTCCAGAGGCTTACAGCATTGCAATTTAC
GAAAAGCAAAGTTCTGGTAAAGAAAATTGTTTAAAAGTATTTCGCATGTG
TAAAAACAATGTAATTAATTGTGAGGGAATTAATTTGGCACGTGTTGATA
ACAGTATCATTCAAACTGAAGATCTTGGTTTTTACCACGATAATGATAAT
TTTTATTATGTAATACTTGATATGGTACGTCCTCTGAAATATTATTCCAA
ATATTCATTGTCAATTTTCTGGAAAAACAGTTATGGTGCCATTAAAGAAA
ACTTTTTGCCCCTTACACTAATAGCTAGGAAAAATAATGCCAGAATTAAT
CCGATGTTTCTGAAATACGCGCCATCAAAATATGACGATTTGAGGAACAA
TATATCCGACATGAAACAAAATGTTTTTCCATCCAACGTTGTTAATCCTG
TAATGGACGAGACCTTCGAACTTGGACTTTATGAAAAGATTTTGATTTTA
CCATCAATTTCTAAAACAAACGAGCTGGTATTTAGTGAAACGAAGAATTT
AAACAAACAAATAATTACCGAGAAATGTGCAAATTCCAATGAGTGCTCAA
AAGGGTTTTATCCTTTTTTCTATGCGCTCCTGCTTCAACAAACTGAAACT
CAAAGTAATATTGAAATCGTTCAGTTGCCGAAGTCAAAGAAAATCCAATT
AACATATGAAAACGTTCAACTGGCGGCAGATGAGTATCGCTCTTCTTTGC
AAGTGTTGTGGAAAGTGTCGGACAATTCAATAAGTCCAAGCATGTTTTGG
ATCAAAATATCCCACCGACCGTCAGACCTCTGTCAAGGAGTTTACATAAT
AAAATGCAAAACTTGCAACGACAAATTCAACGAGATCTCAGAAAAGTTTT
CGCCAAAATTTACCGAATGCCGAAACCCGCCAGTTTTTTTGGTTGATTAT
TACTTTTACCCTACAAATAAACATTTTTCAATCAACACAAACCCAATTTC
TACTGAAAGTCTTTTTAGTGCCCAAATATTTGCAGTGGTATTTTCAACAG
TCATTAAATCAAATGTCAGCAATAGCGAGTTTGTAAGGGATGGTTCCAAG
AAAAAAATCGTATTCGGCTCAATTATATCAGCTTTTTCACTGATTGCTGT
CGTTTTACTAATTATCGGACTTCTGAAATTTCGTAAAGTTCTATCGAAAT
TTAAAAGACCAACAGAAAACCAAACAATGCAGAATTGTAATGACTCGCTA
TACGATGAAGATGTTGATAATAATTCTGACAAACAAGCACAAGTATCAGT
TAATAAAGAAAAGGAAGAGTTTGAAAATCTCTACGAATGAATGGGAG
back to top

protein sequence of SMED30001826-orf-1

>SMED30001826-orf-1 ID=SMED30001826-orf-1|Name=SMED30001826-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=690bp
MSTKVFSCFFPMLLSFILIKPNSSQEYMQSKLLKIDPLSITVDPYLYRLC
WNYLGHDPDKEIVGIRKGALAHFQIFNDSSSLIGKYCISNEENPSNYLIQ
LPFNRYNSSNTIQIQVDFTMPLGPPIDIIRIKTVPHGVHFQIDQEFRSIE
KSEFVKCNVTLIYSTYWKESVIQFQISSNSNHQHVFQRIPPNSHFTAFSS
CIIVDIIKASSAFVKYDGNTKVVENTSDLKLFIPIALRKFILIVWQNLPI
VPEAYSIAIYEKQSSGKENCLKVFRMCKNNVINCEGINLARVDNSIIQTE
DLGFYHDNDNFYYVILDMVRPLKYYSKYSLSIFWKNSYGAIKENFLPLTL
IARKNNARINPMFLKYAPSKYDDLRNNISDMKQNVFPSNVVNPVMDETFE
LGLYEKILILPSISKTNELVFSETKNLNKQIITEKCANSNECSKGFYPFF
YALLLQQTETQSNIEIVQLPKSKKIQLTYENVQLAADEYRSSLQVLWKVS
DNSISPSMFWIKISHRPSDLCQGVYIIKCKTCNDKFNEISEKFSPKFTEC
RNPPVFLVDYYFYPTNKHFSINTNPISTESLFSAQIFAVVFSTVIKSNVS
NSEFVRDGSKKKIVFGSIISAFSLIAVVLLIIGLLKFRKVLSKFKRPTEN
QTMQNCNDSLYDEDVDNNSDKQAQVSVNKEKEEFENLYE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 664..689
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 663..689
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.601
NoneNo IPR availableTMHMMTMhelixcoord: 613..635