TNF receptor associated factor 3

Overview
NameTNF receptor associated factor 3
Smed IDSMED30001818
Length (bp)1698
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor associated factor 3 (SMED30001818) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor associated factor 3 (SMED30001818) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor associated factor 3 (SMED30001818) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor associated factor 3 (SMED30001818) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001818

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30001818SMESG000026104.1 dd_Smed_v4_9703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30001818SMESG000026104.1 dd_Smed_v4_9703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30001818SMESG000026104.1 dd_Smed_v4_9703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30001818SMESG000026104.1 dd_Smed_v4_9703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30001818SMESG000026104.1 dd_Smed_v4_9703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30001818SMESG000026104.1 dd_Smed_v4_9703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor associated factor 3 vs. Ensembl Human
Match: TRAF2 (TNF receptor associated factor 2 [Source:HGNC Symbol;Acc:HGNC:12032])

HSP 1 Score: 64.3142 bits (155), Expect = 3.350e-10
Identity = 27/62 (43.55%), Postives = 41/62 (66.13%), Query Frame = 1
Query: 1513 FVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            F+WKI  F  K ++A  G+ P+I+S AF+T + GYKM L++   GD     T+LS++F +MK
Sbjct:  354 FIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMK 415          
BLAST of TNF receptor associated factor 3 vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 62.3882 bits (150), Expect = 1.358e-9
Identity = 39/124 (31.45%), Postives = 57/124 (45.97%), Query Frame = 1
Query:  160 IEDEMMCLLCKKLLINAHSAPCGCRFCLTCISEYLDIENKICPGETEECQIELINMNGNIIIDRPMNVKISKLIVKCPEQSCEHACELRKIEDHVRICNYRAVECPYSNIGCDKYEISHHNVVD 531
            +E +  C +C   L  A   PCG RFC  CI + +      CP + E      I +   +  D     +I  L+VKCP + C H  ELR +EDH   C +  ++CP       K+ I+ H + D
Sbjct:   64 LESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKD 181          
BLAST of TNF receptor associated factor 3 vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 62.3882 bits (150), Expect = 1.358e-9
Identity = 39/124 (31.45%), Postives = 57/124 (45.97%), Query Frame = 1
Query:  160 IEDEMMCLLCKKLLINAHSAPCGCRFCLTCISEYLDIENKICPGETEECQIELINMNGNIIIDRPMNVKISKLIVKCPEQSCEHACELRKIEDHVRICNYRAVECPYSNIGCDKYEISHHNVVD 531
            +E +  C +C   L  A   PCG RFC  CI + +      CP + E      I +   +  D     +I  L+VKCP + C H  ELR +EDH   C +  ++CP       K+ I+ H + D
Sbjct:   64 LESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKD 181          
BLAST of TNF receptor associated factor 3 vs. Ensembl Human
Match: TRAF1 (TNF receptor associated factor 1 [Source:HGNC Symbol;Acc:HGNC:12031])

HSP 1 Score: 54.6842 bits (130), Expect = 1.845e-7
Identity = 31/106 (29.25%), Postives = 55/106 (51.89%), Query Frame = 1
Query: 1381 RNVDAQSVKRQRDLVLSNKIEESVQRFFKSLQIKKNQNKQINCEFVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            R V+ Q    Q+D  L  K+E+S         ++  +    +  F+WKI     +  ++  G+  S++S AF+T K GYK+ L+L   GD   + T+LS++  +M+
Sbjct:  113 RVVELQQTLAQKDQAL-GKLEQS---------LRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMR 208          
BLAST of TNF receptor associated factor 3 vs. Ensembl Human
Match: TRAF1 (TNF receptor associated factor 1 [Source:HGNC Symbol;Acc:HGNC:12031])

HSP 1 Score: 53.5286 bits (127), Expect = 6.999e-7
Identity = 31/106 (29.25%), Postives = 55/106 (51.89%), Query Frame = 1
Query: 1381 RNVDAQSVKRQRDLVLSNKIEESVQRFFKSLQIKKNQNKQINCEFVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            R V+ Q    Q+D  L  K+E+S         ++  +    +  F+WKI     +  ++  G+  S++S AF+T K GYK+ L+L   GD   + T+LS++  +M+
Sbjct:  235 RVVELQQTLAQKDQAL-GKLEQS---------LRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMR 330          
BLAST of TNF receptor associated factor 3 vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 53.9138 bits (128), Expect = 2.166e-7
Identity = 22/63 (34.92%), Postives = 36/63 (57.14%), Query Frame = 1
Query: 1510 EFVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            + +WKIDK + +  +A++G   +I+S  F +H+ GYKM    C  GD       +S+Y  L+K
Sbjct:  264 QLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLK 326          
BLAST of TNF receptor associated factor 3 vs. Ensembl Fly
Match: Traf6 (gene:FBgn0265464 transcript:FBtr0071188)

HSP 1 Score: 53.1434 bits (126), Expect = 4.265e-7
Identity = 44/167 (26.35%), Postives = 72/167 (43.11%), Query Frame = 1
Query:  133 NDNFH------TVGEIEDEMM-----CLLCKKLLINAHSAPCGCRFCLTCISEYLDIENKICPGETEECQIELINMNGNIIIDRPMNVKISKLIVKCPEQS--CEHACELRKIEDHVRICNYRAVE------CPYSNIGCDKYEISHHNVV-DHLRSDTMIHTKLLM 573
            N N H      T GE E+E++     C +C   L       CG RFC +C++ ++   N+ CP + +    E      +I  D     +I +L   CP  S  C       ++  H+  C YR  +      CP++ I CD       N + +HL++D   H +L++
Sbjct:   78 NQNHHYAPGSDTSGEQEEELLDSRYECAICIDWLNEPVLTSCGHRFCRSCLTAWMQKNNQCCPMDNKRLSAE-----HDIFPDNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYRRQQEPQEEKCPFAKIKCDFVGRPETNQLEEHLKADMPHHMQLML 239          
BLAST of TNF receptor associated factor 3 vs. Ensembl Zebrafish
Match: BX901915.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:28768979:-1 gene:ENSDARG00000109857.1 transcript:ENSDART00000191629.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX901915.1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.241e-12
Identity = 28/62 (45.16%), Postives = 41/62 (66.13%), Query Frame = 1
Query: 1513 FVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            FVWKI  F  K +DA  G+ P+++S AF+T K GYKM L++   GD     T+LS++F +M+
Sbjct:  128 FVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMR 189          
BLAST of TNF receptor associated factor 3 vs. Ensembl Zebrafish
Match: AL844899.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28760787:-1 gene:ENSDARG00000111038.1 transcript:ENSDART00000183806.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL844899.1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.241e-12
Identity = 28/62 (45.16%), Postives = 41/62 (66.13%), Query Frame = 1
Query: 1513 FVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            FVWKI  F  K +DA  G+ P+++S AF+T K GYKM L++   GD     T+LS++F +M+
Sbjct:  128 FVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMR 189          
BLAST of TNF receptor associated factor 3 vs. Ensembl Zebrafish
Match: unm_sa808 (un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21])

HSP 1 Score: 68.1662 bits (165), Expect = 3.575e-12
Identity = 37/139 (26.62%), Postives = 64/139 (46.04%), Query Frame = 1
Query: 1282 NQEEIQDFDTKFQQQSKQIDQVNSKYNEMEGKYRNVDAQSVKRQRDLVLSNKIEESVQRFFKSLQIKKNQNKQINCEFVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            +Q++I+    K +Q  +Q+   +    EMEG+ R + A +                                  +  F+W+I  F  K +DA  G+ P+++S AF+T K GYKM L++   GD     T+LS++F +M+
Sbjct:   90 DQDKIEALSNKVRQLERQVGVKDLTVAEMEGRLREMSATT---------------------------------FDGVFIWRISDFTKKRQDAIAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMR 195          
BLAST of TNF receptor associated factor 3 vs. Ensembl Zebrafish
Match: traf2a (Tnf receptor-associated factor 2a [Source:ZFIN;Acc:ZDB-GENE-071120-2])

HSP 1 Score: 67.0106 bits (162), Expect = 2.919e-11
Identity = 28/62 (45.16%), Postives = 41/62 (66.13%), Query Frame = 1
Query: 1513 FVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            FVWKI  F  K +DA  G+ P+++S AF+T K GYKM L++   GD     T+LS++F +M+
Sbjct:  428 FVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMR 489          
BLAST of TNF receptor associated factor 3 vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 64.6994 bits (156), Expect = 1.704e-10
Identity = 26/62 (41.94%), Postives = 42/62 (67.74%), Query Frame = 1
Query: 1513 FVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            F+WKI +F  + +DA  G+ P+++S AF++ K GYKM L+L   GD     ++LS++F +MK
Sbjct:  385 FIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMK 446          
BLAST of TNF receptor associated factor 3 vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 67.0106 bits (162), Expect = 4.231e-11
Identity = 28/62 (45.16%), Postives = 44/62 (70.97%), Query Frame = 1
Query: 1513 FVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            F+WKI +F  K +DA NG+ P+++S  F+T+K GYKM L++   GD    +T+LS++F +MK
Sbjct:  334 FIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMK 395          
BLAST of TNF receptor associated factor 3 vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 66.6254 bits (161), Expect = 4.698e-11
Identity = 28/62 (45.16%), Postives = 44/62 (70.97%), Query Frame = 1
Query: 1513 FVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            F+WKI +F  K +DA NG+ P+++S  F+T+K GYKM L++   GD    +T+LS++F +MK
Sbjct:  307 FIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMK 368          
BLAST of TNF receptor associated factor 3 vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 61.6178 bits (148), Expect = 2.407e-9
Identity = 40/137 (29.20%), Postives = 56/137 (40.88%), Query Frame = 1
Query:  115 VWEAIKNDNFHTVGEIEDEMMCLLCKKLLINAHSAPCGCRFCLTCISEYLDIENKICPGETEECQIELINMNGNIIIDRPMNVKISKLIVKCPEQSCEHACELRKIEDHVRICNYRAVECPYSNIGCDKYEISHHNV 525
            V E ++  +      +E +  C +C   L  A   PCG RFC  CI + +      CP + E        M   +  D     +I  L VKCP Q C    ELR +E H+  C++  VEC        KY +  H  
Sbjct:   51 VLEDVQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACILKSIRDAGHKCPVDNESL------MENQLFPDNFAKREILSLRVKCPSQGCTETMELRHLERHLVRCDFAGVECSQCQSSFPKYSLQKHKF 181          
BLAST of TNF receptor associated factor 3 vs. Ensembl Xenopus
Match: hspb6 (heat shock protein family B (small) member 6 [Source:Xenbase;Acc:XB-GENE-876273])

HSP 1 Score: 58.5362 bits (140), Expect = 1.193e-8
Identity = 26/62 (41.94%), Postives = 40/62 (64.52%), Query Frame = 1
Query: 1513 FVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            F+WKI    +K  DA  G+  S+YS AF+T K GYK+ L++   GD   + T++S++F +MK
Sbjct:  232 FLWKISDLTNKSHDAVTGRAISLYSPAFYTAKYGYKVCLRIYLNGDGAGKGTHVSLFFTVMK 293          
BLAST of TNF receptor associated factor 3 vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 53.9138 bits (128), Expect = 4.948e-7
Identity = 31/108 (28.70%), Postives = 58/108 (53.70%), Query Frame = 1
Query: 1384 NVDAQSVKRQRDLVLSN---KIEESVQRFFKSLQIKKNQNKQINCEFVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            N+D Q   ++ D++LSN   ++  + +RF      +  +    N + +WKI  +  K  +A  G+  SI+S+ F+T   GY++  +    GD   + ++LS+YF +MK
Sbjct:  348 NLDGQF--KKHDVLLSNHKMQMTSNEERF------RLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMK 447          
BLAST of TNF receptor associated factor 3 vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 65.0846 bits (157), Expect = 1.148e-10
Identity = 27/62 (43.55%), Postives = 41/62 (66.13%), Query Frame = 1
Query: 1513 FVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            F+WKI  F  K ++A  G+ P+I+S AF+T + GYKM L++   GD     T+LS++F +MK
Sbjct:  361 FIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMK 422          
BLAST of TNF receptor associated factor 3 vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 65.0846 bits (157), Expect = 1.173e-10
Identity = 27/62 (43.55%), Postives = 41/62 (66.13%), Query Frame = 1
Query: 1513 FVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            F+WKI  F  K ++A  G+ P+I+S AF+T + GYKM L++   GD     T+LS++F +MK
Sbjct:  354 FIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMK 415          
BLAST of TNF receptor associated factor 3 vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 57.3806 bits (137), Expect = 3.317e-8
Identity = 38/124 (30.65%), Postives = 54/124 (43.55%), Query Frame = 1
Query:  160 IEDEMMCLLCKKLLINAHSAPCGCRFCLTCISEYLDIENKICPGETEECQIELINMNGNIIIDRPMNVKISKLIVKCPEQSCEHACELRKIEDHVRICNYRAVECPYSNIGCDKYEISHHNVVD 531
            +E +  C +C   L  A   PCG RFC  CI + +      CP + E      I +   +  D     +I  L VKCP + C    ELR +EDH   C +  V CP       K +++ H + D
Sbjct:   64 LESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCPQCQRPFQKCQVNTHIIED 181          
BLAST of TNF receptor associated factor 3 vs. Ensembl Mouse
Match: Traf1 (TNF receptor-associated factor 1 [Source:MGI Symbol;Acc:MGI:101836])

HSP 1 Score: 55.4546 bits (132), Expect = 1.203e-7
Identity = 44/197 (22.34%), Postives = 94/197 (47.72%), Query Frame = 1
Query: 1168 AEMSKKKEINRLEMTKKLEKTCEILRNEVNDYKLKVDKNQEEI-------QDFDTKFQQQSKQIDQVNSKYN-EMEGKYRNVDAQSVKRQRD----LVLSNKIEESVQRFFKSLQI--------KKNQNKQINCEFVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            A M+ ++ ++ L++   +E T ++   EV+ Y+    ++QEE+       +    + +++ +    + +  N E+E  +  + A   + Q D    L L  ++ E  Q   +  Q+        +  +    +  F+WKI     +  ++  G+  S++S AF+T K GYK+ L+L   GD   + T+LS++  +M+
Sbjct:  130 APMALERNLSELQLQAAVEATGDL---EVDCYRAPCCESQEELALQHLVKEKLLAQLEEKLRVFANIVAVLNKEVEASHLALAASIHQSQLDREHILSLEQRVVELQQTLAQKDQVLGKLEHSLRLMEEASFDGTFLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMR 323          
BLAST of TNF receptor associated factor 3 vs. Ensembl Mouse
Match: Traf1 (TNF receptor-associated factor 1 [Source:MGI Symbol;Acc:MGI:101836])

HSP 1 Score: 55.4546 bits (132), Expect = 1.203e-7
Identity = 44/197 (22.34%), Postives = 94/197 (47.72%), Query Frame = 1
Query: 1168 AEMSKKKEINRLEMTKKLEKTCEILRNEVNDYKLKVDKNQEEI-------QDFDTKFQQQSKQIDQVNSKYN-EMEGKYRNVDAQSVKRQRD----LVLSNKIEESVQRFFKSLQI--------KKNQNKQINCEFVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            A M+ ++ ++ L++   +E T ++   EV+ Y+    ++QEE+       +    + +++ +    + +  N E+E  +  + A   + Q D    L L  ++ E  Q   +  Q+        +  +    +  F+WKI     +  ++  G+  S++S AF+T K GYK+ L+L   GD   + T+LS++  +M+
Sbjct:  130 APMALERNLSELQLQAAVEATGDL---EVDCYRAPCCESQEELALQHLVKEKLLAQLEEKLRVFANIVAVLNKEVEASHLALAASIHQSQLDREHILSLEQRVVELQQTLAQKDQVLGKLEHSLRLMEEASFDGTFLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMR 323          
BLAST of TNF receptor associated factor 3 vs. UniProt/SwissProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 8.203e-10
Identity = 27/62 (43.55%), Postives = 41/62 (66.13%), Query Frame = 1
Query: 1513 FVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            F+WKI  F  K ++A  G+ P+I+S AF+T + GYKM L++   GD     T+LS++F +MK
Sbjct:  354 FIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMK 415          
BLAST of TNF receptor associated factor 3 vs. UniProt/SwissProt
Match: sp|Q12933|TRAF2_HUMAN (TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2)

HSP 1 Score: 64.3142 bits (155), Expect = 1.609e-9
Identity = 27/62 (43.55%), Postives = 41/62 (66.13%), Query Frame = 1
Query: 1513 FVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            F+WKI  F  K ++A  G+ P+I+S AF+T + GYKM L++   GD     T+LS++F +MK
Sbjct:  354 FIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMK 415          
BLAST of TNF receptor associated factor 3 vs. UniProt/SwissProt
Match: sp|B6CJY5|TRAF6_MACMU (TNF receptor-associated factor 6 OS=Macaca mulatta OX=9544 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 2.249e-9
Identity = 40/124 (32.26%), Postives = 57/124 (45.97%), Query Frame = 1
Query:  160 IEDEMMCLLCKKLLINAHSAPCGCRFCLTCISEYLDIENKICPGETEECQIELINMNGNIIIDRPMNVKISKLIVKCPEQSCEHACELRKIEDHVRICNYRAVECPYSNIGCDKYEISHHNVVD 531
            +E +  C +C   L  A   PCG RFC  CI + +      CP + E      I +   +  D     +I  L+VKCP + C H  ELR +EDH   C +  V+CP       K+ I+ H + D
Sbjct:   64 LESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALVDCPQCQRPFQKFHINIHILKD 181          
BLAST of TNF receptor associated factor 3 vs. UniProt/SwissProt
Match: sp|B6CJY4|TRAF6_CERAT (TNF receptor-associated factor 6 OS=Cercocebus atys OX=9531 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 2.391e-9
Identity = 40/124 (32.26%), Postives = 57/124 (45.97%), Query Frame = 1
Query:  160 IEDEMMCLLCKKLLINAHSAPCGCRFCLTCISEYLDIENKICPGETEECQIELINMNGNIIIDRPMNVKISKLIVKCPEQSCEHACELRKIEDHVRICNYRAVECPYSNIGCDKYEISHHNVVD 531
            +E +  C +C   L  A   PCG RFC  CI + +      CP + E      I +   +  D     +I  L+VKCP + C H  ELR +EDH   C +  V+CP       K+ I+ H + D
Sbjct:   64 LESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALVDCPQCQRPFQKFHINIHILKD 181          
BLAST of TNF receptor associated factor 3 vs. UniProt/SwissProt
Match: sp|Q9Y4K3|TRAF6_HUMAN (TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 6.520e-9
Identity = 39/124 (31.45%), Postives = 57/124 (45.97%), Query Frame = 1
Query:  160 IEDEMMCLLCKKLLINAHSAPCGCRFCLTCISEYLDIENKICPGETEECQIELINMNGNIIIDRPMNVKISKLIVKCPEQSCEHACELRKIEDHVRICNYRAVECPYSNIGCDKYEISHHNVVD 531
            +E +  C +C   L  A   PCG RFC  CI + +      CP + E      I +   +  D     +I  L+VKCP + C H  ELR +EDH   C +  ++CP       K+ I+ H + D
Sbjct:   64 LESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKD 181          
BLAST of TNF receptor associated factor 3 vs. TrEMBL
Match: A0A0F7GWW3 (TNF receptor associated factor 4 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 6.802e-46
Identity = 86/153 (56.21%), Postives = 110/153 (71.90%), Query Frame = 1
Query:  325 MNGNIIIDRPMNVKISKLIVKCPEQSCEHACELRKIEDHVRICNYRAVECPYSNIGCDKYEISHHNVVDHLRSDTMIHTKLLMDFVGNLNNEMSILKTNNNELREENKSLRTEINQLKLDVERSQGEIVDLESKLNRKIQDIDELNTDVICFK 783
            +N NI +D PMN+KI+KL VKC E+SC++  ELRK+EDH R C YR+V CPYSNIGCDK  IS   V DHL+S+  +HTKLLMDFV N NNEM +LK NNN L   N+ LR EIN+LKLD +R + EI DL+ K   + ++I+ LN D+   +
Sbjct:   12 LNENICVDYPMNMKIAKLQVKCKEKSCDYVDELRKMEDHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEMLKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALR 164          
BLAST of TNF receptor associated factor 3 vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 5.480e-36
Identity = 70/168 (41.67%), Postives = 107/168 (63.69%), Query Frame = 1
Query:  139 NFHTVGEIEDEMMCLLCKKLLINAHSAPCGCRFCLTCISEYLDIENKICPGETEECQIELINMNGNIIIDRPMNVKISKLIVKCPEQSCEHACELRKIEDHVRICNYRAVECPYSNIGCDKYEISHHNVVDHLRSDTMIHTKLLMDFVGNLNNEMSILKTNNNELREE 642
            NF   G + D + C LCK LL+NA  + CGCRFC  CI EY+   N  CPG T EC+ E + +  NI  D  +N KI+K+ VKCPE++C+  CEL  IE+H+R+C  ++  CP+  +GC++ ++   ++ +HL++ T  H+KL++D + N+ N+   L T   ELRE+
Sbjct:   14 NFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSKLIIDIISNMRNDFFGLTTKEVELRED 181          
BLAST of TNF receptor associated factor 3 vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 2.944e-30
Identity = 86/303 (28.38%), Postives = 166/303 (54.79%), Query Frame = 1
Query:   94 MAAKLENVWEAIKNDNFHTVGE-IEDEMMCLLCKKLLINAHSAPCGCRFCLTCISEYLDIENKICPGETEECQIELINMNGNIIIDRPMNVKISKLIVKCPEQSCEHACELRKIEDHVRICNYRAVECPYSNIGCDKYEISHHNVVDHLRSDTMIHTKLLMDFVGNLNNEMSILKTNNNELREENKSLRTEINQLKLDVERSQGEIVDLES-KLNRKIQDIDELNTDVICFKIDIDSVKENLAKLILNEEKKQIEFADLQREFNNSTRDILSLNQGMETLGNRD-----KDVSEEVNGLKVKL 981
            + +KL+NV E +   N   V E + ++++C+LC KL+ +A  + CGC +C TCI  YL   +  CPG+  EC+ + +N+ G++  +  ++ +IS+++VKCP   C +  EL ++++H+  C   +VECP   IGC++  +    +  HL    + HT+L+M F   L +E++    +NNE  +E      +I+ LK +V R Q  + D ++ ++   I+++   +  ++    DI  VK  +  L+ ++E    E   L+ +     ++I  +   +E +G+ D     KD+ +E+ G+K+ +
Sbjct:    2 IPSKLDNVQELLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELKSEIN----HNNETTKE------DISHLK-EVLRVQKALNDEKTAQMEFLIEELRNKDNMILVLSQDIQEVKNEMITLLTSKES---ELKKLKSDIQIFRQEIEFMKNDLEVVGSTDIKNQVKDLKKEIFGIKMNI 290          
BLAST of TNF receptor associated factor 3 vs. TrEMBL
Match: A0A3P7HNV3 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS11362 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.670e-13
Identity = 60/213 (28.17%), Postives = 94/213 (44.13%), Query Frame = 1
Query: 1090 CQNIENRIKDENQHRK-DKEKDLMKNIAEMSKKKEINRLEMTKKLEKTCEILRNEVNDYKLKVDKNQEEIQDFDTKFQQQSKQIDQVNSKYNEMEGKYRNVDAQSVKRQRDLV--LSNKIEESVQRFFKS-LQIKKNQNKQINCE------FVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            CQ  + +I+  NQ    +  K  +       K+KEI R E+T  LE  C +                   Q     F +Q  Q      K  ++     N     +   RD V    N ++  +Q    S   +KK Q K   CE      FVWKID +R+K E+AQ G+K +++S  F++H+ GY++ L +CP G+      YL+V+ C+ +
Sbjct:   16 CQFCQEKIEMHNQPAHVEVCKRFLIPCPNGCKRKEIPREELTAHLECDCPL-------------------QVISCPFSEQGCQF---RGKKRQIRAHLDNELMLHILLLRDAVQAFHNLLDLQMQAVRDSQAAVKKMQLKLQRCETFFEPSFVWKIDGYREKFEEAQQGRKTTLFSNPFYSHRHGYRVCLSICPNGEQRHRGKYLAVFICICR 206          
BLAST of TNF receptor associated factor 3 vs. TrEMBL
Match: A0A0R3XCV3 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.705e-13
Identity = 60/213 (28.17%), Postives = 94/213 (44.13%), Query Frame = 1
Query: 1090 CQNIENRIKDENQHRK-DKEKDLMKNIAEMSKKKEINRLEMTKKLEKTCEILRNEVNDYKLKVDKNQEEIQDFDTKFQQQSKQIDQVNSKYNEMEGKYRNVDAQSVKRQRDLV--LSNKIEESVQRFFKS-LQIKKNQNKQINCE------FVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            CQ  + +I+  NQ    +  K  +       K+KEI R E+T  LE  C +                   Q     F +Q  Q      K  ++     N     +   RD V    N ++  +Q    S   +KK Q K   CE      FVWKID +R+K E+AQ G+K +++S  F++H+ GY++ L +CP G+      YL+V+ C+ +
Sbjct:   16 CQFCQEKIEMHNQPAHVEVCKRFLIPCPNGCKRKEIPREELTAHLECDCPL-------------------QVISCPFSEQGCQF---RGKKRQIRAHLDNELMLHILLLRDAVQAFHNLLDLQMQAVRDSQAAVKKMQLKLQRCETFFEPSFVWKIDGYREKFEEAQQGRKTTLFSNPFYSHRHGYRVCLSICPNGEQRHRGKYLAVFICICR 206          
BLAST of TNF receptor associated factor 3 vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 67.0106 bits (162), Expect = 2.463e-11
Identity = 28/62 (45.16%), Postives = 41/62 (66.13%), Query Frame = 1
Query: 1513 FVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            FVWKI  F  K +DA  G+ P+++S AF+T K GYKM L++   GD     T+LS++F +M+
Sbjct:  425 FVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMR 486          
BLAST of TNF receptor associated factor 3 vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 66.6254 bits (161), Expect = 2.505e-11
Identity = 28/62 (45.16%), Postives = 41/62 (66.13%), Query Frame = 1
Query: 1513 FVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            FVWKI  F  K +DA  G+ P+++S AF+T K GYKM L++   GD     T+LS++F +M+
Sbjct:  312 FVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMR 373          
BLAST of TNF receptor associated factor 3 vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 64.3142 bits (155), Expect = 1.889e-10
Identity = 26/62 (41.94%), Postives = 41/62 (66.13%), Query Frame = 1
Query: 1513 FVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            FVWKI  F  + +DA  G+ P+++S AF++ K GYKM L+L   GD     ++LS++F +M+
Sbjct:  384 FVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMR 445          
BLAST of TNF receptor associated factor 3 vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 58.151 bits (139), Expect = 1.542e-8
Identity = 30/81 (37.04%), Postives = 48/81 (59.26%), Query Frame = 1
Query: 1462 FKSLQ--IKKNQNKQINCEFVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
              SLQ  I   Q+   +  F+W+I     KL++A  GQK S YS AF+T + G+K+ ++L   GD   + T++S++F +MK
Sbjct:  375 ISSLQQSISAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMK 455          
BLAST of TNF receptor associated factor 3 vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 57.7658 bits (138), Expect = 1.747e-8
Identity = 30/81 (37.04%), Postives = 48/81 (59.26%), Query Frame = 1
Query: 1462 FKSLQ--IKKNQNKQINCEFVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
              SLQ  I   Q+   +  F+W+I     KL++A  GQK S YS AF+T + G+K+ ++L   GD   + T++S++F +MK
Sbjct:  352 ISSLQQSISAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMK 432          
BLAST of TNF receptor associated factor 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008091.1 (pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 gene:ENSPMAG00000007312.1 transcript:ENSPMAT00000008091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 3.535e-8
Identity = 37/132 (28.03%), Postives = 70/132 (53.03%), Query Frame = 1
Query: 1285 QEEIQDFDTKFQQQSKQIDQVNSKYNEMEGKYRNVDAQSVKRQRDLVLSNK---IEESVQRFFKSL-----QIKKNQNKQINCEFVWKIDKFRDKLEDAQNG--QKPSIYSKAFFTHKIGYKMRLKLCPGGD 1650
            + ++   D + ++ +K++++ + + +E   +  N+D     R     L NK   +E S Q   +S+     ++ + +N   N  F+WKI    ++L +A NG  + P I S AFFT + GY++RL+LC  G+
Sbjct:  249 EAQLATMDRRVEEVAKRVER-DVRVSEASTRQGNIDRDETAR-----LQNKMARVEHSDQETERSILGLTRRLAELENTAYNGMFLWKIKHVINRLREAGNGAERPPQIDSPAFFTTRYGYRLRLRLCRSGE 374          
BLAST of TNF receptor associated factor 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 5.497e-8
Identity = 24/76 (31.58%), Postives = 43/76 (56.58%), Query Frame = 1
Query: 1471 LQIKKNQNKQINCEFVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            L+ +  +    N + VWKI  +  + +DA +G+  S+YS+ F+T   GY+M  +    GD     T+LS++F +M+
Sbjct:  313 LRFQVLETASYNGKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMR 388          
BLAST of TNF receptor associated factor 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 8.578e-8
Identity = 26/93 (27.96%), Postives = 49/93 (52.69%), Query Frame = 1
Query: 1420 LVLSNKIEESVQRFFKSLQIKKNQNKQINCEFVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            L + + + ++ +R  + L+      K      VWKI  +  + ++A +G+  S+YS+ F+T   GYKM  +    GD     T+LS++F +M+
Sbjct:  244 LTMHDGLLDTAERRLQVLETAGYSGK-----LVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMR 331          
BLAST of TNF receptor associated factor 3 vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 51.9878 bits (123), Expect = 3.003e-7
Identity = 30/106 (28.30%), Postives = 47/106 (44.34%), Query Frame = 1
Query:  160 IEDEMMCLLCKKLLINAHSAPCGCRFCLTCISEYLDIENKICPGETEECQIE-LINMNGNIIIDRPMNVKISKLIVKCPEQSCEHACELRKIEDHVRICNYRAVEC 474
            +E +  C +C   L      PCG RFC  CI   + + +        +C ++  +   G +  D     +I  L V+CP + C H  ELR +++H   C Y  V C
Sbjct:   59 LESKYECPICLMALREPVQTPCGHRFCRACILHSMRLRDA-----GPKCPVDNAVLHEGQLFPDNFAKREILSLTVRCPNKPCGHRGELRALQEHQLRCEYAQVPC 159          
BLAST of TNF receptor associated factor 3 vs. Ensembl Sea Lamprey
Match: rnf41l (ring finger protein 41, like [Source:ZFIN;Acc:ZDB-GENE-030131-9441])

HSP 1 Score: 47.3654 bits (111), Expect = 6.059e-7
Identity = 31/114 (27.19%), Postives = 55/114 (48.25%), Query Frame = 1
Query:  151 VGEIEDEMMCLLCKKLLINAHSAPCGCRFCLTCISEYLDIENKICPGETEECQIELINMNGNIIIDRPMNVKISKLIVKCPEQS--CEHACELRKIEDHVRICNYRAVECPYSN 486
            VG ++D ++C +C+ +L +   APC   FC  CI  +L + N  CP + +      ++ +    + R M   ++ L + C  ++  CE  C L  I  H + C Y    CP++ 
Sbjct:    9 VGRVKDGLLCCVCRDVLEDPLQAPCEHAFCSACIHGWL-VHNHTCPEDRQP-----LDASELRPLFRYMRNDLNALRLHCTHRARGCEGVCALETIAIHEQQCPYTPTPCPHTG 116          
BLAST of TNF receptor associated factor 3 vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 72.7886 bits (177), Expect = 1.378e-13
Identity = 32/80 (40.00%), Postives = 49/80 (61.25%), Query Frame = 1
Query: 1459 FFKSLQIKKNQNKQINCEFVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            F + L+I+  Q    +  F+WKIDKF ++  +A++G   SIYS  F+TH+ GYK+  +L P GD      YLS++  LM+
Sbjct:  364 FQEDLRIQIQQAISYDGTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMR 443          
BLAST of TNF receptor associated factor 3 vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 62.003 bits (149), Expect = 3.460e-10
Identity = 22/62 (35.48%), Postives = 41/62 (66.13%), Query Frame = 1
Query: 1513 FVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            ++WKID++  + ++  +G+ PSIYS  F+  + GYK   ++ P GD   + ++LS++F LM+
Sbjct:  380 YIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMR 441          
BLAST of TNF receptor associated factor 3 vs. Ensembl Nematostella
Match: EDO43806 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXN6])

HSP 1 Score: 52.7582 bits (125), Expect = 2.172e-8
Identity = 36/133 (27.07%), Postives = 66/133 (49.62%), Query Frame = 1
Query:  157 EIEDEMMCLLCKKLLINAHSAPCGCRFCLTCISEYLDI---ENKICPGETEECQIELINMNGNIIIDRPMNVKISKLIVKCP--EQSCEHACELRKIEDHVRICNYRAVECPYSNIGCDKY----EIS-HHNV 525
            +++  ++C +C ++L  A   PCG  FC  C+  +++    EN+ CP     C+ +L    G+ I    +   +  LIV CP  +  C+   +L  +E H++ C++  V+C     GC  +    E++ HHN 
Sbjct:   11 KVDPNLLCGICAEVLERAVLTPCGHSFCGVCLETWMNAKLGENEKCPASCPSCRADL--YQGDTIPVLALRGIVDGLIVHCPNADNGCKLVLKLEGVEGHLKSCSHAPVQC----CGCSAFLKRGELAEHHNT 137          
BLAST of TNF receptor associated factor 3 vs. Ensembl Nematostella
Match: EDO41243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z7])

HSP 1 Score: 55.0694 bits (131), Expect = 4.150e-8
Identity = 37/127 (29.13%), Postives = 61/127 (48.03%), Query Frame = 1
Query:  160 IEDEMMCLLCKKLLINAHSAPCGCRFCLTCISEYLDIENKI-CPGETEECQIELINMNGNIIIDRPMNVKISKLIVKCPEQSCEHACELRKIEDHVRICNYRAVECPYSNIGCDKYEISHHNVVDHL 537
            + +E  C +C   L       CG RFC  C+ E    +++  CP + E      +++  ++ +D+     I   +VKCP + C+   ELR +E H R C+Y  V C  SN  C   ++   +V +HL
Sbjct:   19 VAEEYTCRICHLPLRVPVQTKCGHRFCKECLDEASRRKSRAECPMDREP-----LDLKKDVFLDKAAERTILSFLVKCPCKGCKWEAELRDLEAHARNCDYELVTC--SNPMCSA-QLPRMDVDEHL 137          

HSP 2 Score: 53.5286 bits (127), Expect = 1.482e-7
Identity = 28/80 (35.00%), Postives = 43/80 (53.75%), Query Frame = 1
Query: 1444 ESVQRFFKSLQIKKNQNKQINCEFVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVY 1683
            +S  +F +  Q     N+ +   FVW+I  F D L  A+ G K  + S+ FFT K GYK+R  L P G    ++T++S +
Sbjct:  297 DSGAQFHELQQGLGRVNELLKMRFVWRIPDFADSLRQAKLGLKVRLDSEPFFTEKNGYKLRATLYPNGTMSGKNTHISAF 376          
BLAST of TNF receptor associated factor 3 vs. Ensembl Nematostella
Match: EDO29145 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4G8])

HSP 1 Score: 50.447 bits (119), Expect = 4.628e-8
Identity = 24/66 (36.36%), Postives = 41/66 (62.12%), Query Frame = 1
Query: 1504 NCEFVWKIDKFRDKLEDA-QNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            N  F+WKI  ++ + + A  + ++ +I+S  F+T + GYK+RLK    G D  + T+LS+Y  +MK
Sbjct:    1 NGIFLWKISNYKHQYDQAVASPEELAIFSPPFYTSQYGYKLRLKAYLNGRDRGKGTHLSLYIIIMK 66          
BLAST of TNF receptor associated factor 3 vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 67.781 bits (164), Expect = 1.312e-11
Identity = 42/164 (25.61%), Postives = 77/164 (46.95%), Query Frame = 1
Query: 1207 MTKKLEKTCEILRNEVNDYKLKVDKNQEEIQDFDTKFQQQSKQIDQVNSKYNEMEGKYRNVDAQSVKRQRDLVLSNKIEESVQRFFKSLQIKKNQNKQINCEFVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            + ++LE++C  +      ++L    +Q++I+    K +Q  + +   +    EMEGK +++ A +     D +                             F+WKI  F  K +DA  G+ P+++S AF+T K GYKM L++   GD     T+LS++F +M+
Sbjct:  357 LNRELERSCATMEAYNRQHRL----DQDKIEILSNKVRQLERTVSLRDLSIVEMEGKMKDMSAATY----DGI-----------------------------FIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMR 483          
BLAST of TNF receptor associated factor 3 vs. Ensembl Medaka
Match: unm_sa808 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101155367])

HSP 1 Score: 65.4698 bits (158), Expect = 7.636e-11
Identity = 26/62 (41.94%), Postives = 41/62 (66.13%), Query Frame = 1
Query: 1513 FVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            F+W+I  F  K +DA  G+ P+++S AF+T K GYKM L++   GD     T+LS++F +M+
Sbjct:  449 FIWRISDFAKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMR 510          
BLAST of TNF receptor associated factor 3 vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 64.6994 bits (156), Expect = 1.413e-10
Identity = 26/62 (41.94%), Postives = 42/62 (67.74%), Query Frame = 1
Query: 1513 FVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            FVWKI  F  + ++A +G+ P+++S AF++ K GYKM L+L   GD     T+LS++F +M+
Sbjct:  376 FVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMR 437          
BLAST of TNF receptor associated factor 3 vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 64.6994 bits (156), Expect = 1.471e-10
Identity = 26/62 (41.94%), Postives = 42/62 (67.74%), Query Frame = 1
Query: 1513 FVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            FVWKI  F  + ++A +G+ P+++S AF++ K GYKM L+L   GD     T+LS++F +M+
Sbjct:  369 FVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMR 430          
BLAST of TNF receptor associated factor 3 vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 56.6102 bits (135), Expect = 4.291e-8
Identity = 31/121 (25.62%), Postives = 62/121 (51.24%), Query Frame = 1
Query: 1336 IDQVNSKYNEMEGKYRNVDAQSVKRQRDLVLSNKIEESVQRFFKSLQIKKNQNKQINCEFVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            +D V ++ + +E   R      + R  D++  ++I  +       L+ +  +    N   +WKI  ++ + +DA  G+  S+YS+ F+T   GYKM  ++   GD   + T+LS++F +M+
Sbjct:  245 LDTVRTRLSALEQGGRASLETQLNRHDDMLSVHEIRLADM----DLRFQVLETASYNGTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMR 361          

HSP 2 Score: 54.299 bits (129), Expect = 2.257e-7
Identity = 34/113 (30.09%), Postives = 51/113 (45.13%), Query Frame = 1
Query:  145 HTVGEIEDEMMCLLCKKLLINAHSAPCGCRFCLTCISEYLDIENKICPGETEECQIELINMNGNIIIDRPMNVKISKLIVKCPEQS--CEHACELRKIEDHVRICNYRAVECP 477
            H V   E +  C  C+ +L       CG RFC +CI++ L   N +CP + E            I  D   + +I  L V C  ++  C+    L++I DHV +C +  V CP
Sbjct:   37 HFVEAPEAKYCCEACRLVLCQPRQTECGHRFCYSCINDILSCPNPVCPADMEPL------FKDKIFRDVCCHREIMALKVYCRSEANGCQEQMSLQQIPDHVNVCPFFEVPCP 143          
BLAST of TNF receptor associated factor 3 vs. Planmine SMEST
Match: SMESG000026104.1 (SMESG000026104.1)

HSP 1 Score: 1011.13 bits (2613), Expect = 0.000e+0
Identity = 507/535 (94.77%), Postives = 508/535 (94.95%), Query Frame = 1
Query:   94 MAAKLENVWEAIKNDNFHTVGEIEDEMMCLLCKKLLINAHSAPCGCRFCLTCISEYLDIENKICPGETEECQIELINMNGNIIIDRPMNVKISKLIVKCPEQSCEHACELRKIEDHVRICNYRAVECPYSNIGCDKYEISHHNVVDHLRSDTMIHTKLLMDFVGNLNNEMSILKTNNNELREENKSLRTEINQLKLDVERSQGEIVDLESKLNRKIQDIDELNTDVICFKIDIDSVKENLAKLILNEEKKQIEFADLQREFNNSTRDILSLNQGMETLGNRDKDVSEEVNGLKVKLLMKELVI*CEFLQEAIRKSNTESLLQIKQIQQVISKCQNIENRIKDENQHRKDKEKDLMKNIAEMSKKKEINRLEMTKKLEKTCEILRNEVNDYKLKVDKNQEEIQDFDTKFQQQSKQIDQVNSKYNEMEGKYRNVDAQSVKRQRDLVLSNKIEESVQRFFKSLQIKKNQNKQINCEFVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            MAAKLENVWEAIKNDNFHTVGEIEDEMMCLLCKKLLINAHSAPCGCRFCLTCISEYLDIENKICPGETEECQIELINMNGNIIIDRPMNVKISKLIVKCPEQSCEH CELRKIEDHVRICNYRAVECPYSNIGCDKYEISHHNVVDHLRSDTMIHTKLLMDFVGNLNNEMSILKTNNNELREENKSLRTEINQLKLDVERSQGEIVDLESKLNRKIQDIDELN DVICFKIDIDSVKENLAKLILNEEKKQIEFADLQREFNNSTRDILSLNQGMETLGNRDKDVSEEVNGLK                EAIRKSNTESLLQIKQIQQVISKCQNIENRIKDENQHRKDKEKDLMKNIAEMSKKKEINRLEMTKKLEKTCEILRNEVNDYKLK     EEIQDFDTKFQQ SKQIDQVNSKYNEME +YRNVDAQSVKRQRDLVLSNKIEESVQRFFKSLQIK NQNKQIN EFVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK
Sbjct:    1 MAAKLENVWEAIKNDNFHTVGEIEDEMMCLLCKKLLINAHSAPCGCRFCLTCISEYLDIENKICPGETEECQIELINMNGNIIIDRPMNVKISKLIVKCPEQSCEHTCELRKIEDHVRICNYRAVECPYSNIGCDKYEISHHNVVDHLRSDTMIHTKLLMDFVGNLNNEMSILKTNNNELREENKSLRTEINQLKLDVERSQGEIVDLESKLNRKIQDIDELNADVICFKIDIDSVKENLAKLILNEEKKQIEFADLQREFNNSTRDILSLNQGMETLGNRDKDVSEEVNGLK----------------EAIRKSNTESLLQIKQIQQVISKCQNIENRIKDENQHRKDKEKDLMKNIAEMSKKKEINRLEMTKKLEKTCEILRNEVNDYKLK-----EEIQDFDTKFQQHSKQIDQVNSKYNEMESRYRNVDAQSVKRQRDLVLSNKIEESVQRFFKSLQIKTNQNKQINSEFVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 514          
BLAST of TNF receptor associated factor 3 vs. Planmine SMEST
Match: SMESG000026111.1 (SMESG000026111.1)

HSP 1 Score: 321.242 bits (822), Expect = 7.209e-104
Identity = 169/337 (50.15%), Postives = 233/337 (69.14%), Query Frame = 1
Query:   94 MAAKLENVWEAIKNDNFHTVGEIEDEMMCLLCKKLLINAHSAPCGCRFCLTCISEYLDIENKICPGETEECQIELINMNGNIIIDRPMNVKISKLIVKCPEQSCEHACELRKIEDHVRICNYRAVECPYSNIGCDKYEISHHNVVDHLRSDTMIHTKLLMDFVGNLNNEMSILKTNNNELREENKSLRTEINQLKLDVERSQGEIVDLESKLNRKIQDIDELNTDVICFKIDIDSVKENLAKLILNEEKKQIEFADLQREFNNSTRDILSLNQGMETLGNRDKDVSEEVNGLKVKLLMKELVI--*CEFLQEAIRKSNTESLLQIKQIQQVISKCQN 1098
            MA  LENVW+ +K  N  TV EIE+EM CLLCKK+L+NAHSAPCGCRFCLTCIS+YL      CPG+T++C++ELI+M+ NII+DRP+NV+ISKLIVKCPE  CE   ELRK+EDH+R+CNY++ +CPYSNIGCDK +IS   + DHL+S+ ++HTKLLMDFVGN +NEM+ LKTNNNELREENK LR EIN+LKL+ ER QGEI +L        ++ DE   D+IC K +   +++ + KLIL  E  + E A+L+      ++ + S NQ  + +G   K  ++E + LK+ +   +  +      ++ A++  N E + +I+ I   I   +N
Sbjct:    1 MAFNLENVWKFMKTYNLETVVEIENEMSCLLCKKVLVNAHSAPCGCRFCLTCISQYLCDRKIYCPGDTDDCKLELISMSENIIVDRPVNVRISKLIVKCPEILCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKSKISSDKIADHLQSEILMHTKLLMDFVGNFHNEMNTLKTNNNELREENKLLRIEINELKLNCERRQGEIAELR-------RESDEKTVDIICLKDENVLIRKTVDKLILGAENNKAELANLRGNREEDSKSMKSFNQ--DRMGR--KKFTDEFDSLKLNVEQNKFAVSDKASSMETAVQTINGEFVWKIENISDKIVGAKN 326          

HSP 2 Score: 83.5741 bits (205), Expect = 8.865e-17
Identity = 75/239 (31.38%), Postives = 108/239 (45.19%), Query Frame = 1
Query: 1042 TESLLQIKQIQQVISKCQNIENRIKDENQHRKDKEKDLMKNIAEMS-----KKKEINRLEMTKKLEKTCEIL---------RNEVNDYKLKVDKNQEEIQDFDTKFQQQSKQIDQVNSKYNEMEGKYRNVDAQSVK---RQRDLVLSNK---IEESVQRFFKSLQIKKNQNKQINCEFVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            +E L+  K +   +    N  N +K  N   +++ K L   I E+      ++ EI  L      EKT +I+         R  V+   L  + N+ E+ +     ++ SK +   N   + M  K    +  S+K    Q    +S+K   +E +VQ               IN EFVWKI+   DK+  A+NG   S YSKAF +H  GYKM L L P G D    T+LSVYFCLMK
Sbjct:  150 SEILMHTKLLMDFVGNFHNEMNTLKTNNNELREENKLLRIEINELKLNCERRQGEIAELRRESD-EKTVDIICLKDENVLIRKTVDKLILGAENNKAELANLRGNREEDSKSMKSFNQ--DRMGRKKFTDEFDSLKLNVEQNKFAVSDKASSMETAVQ--------------TINGEFVWKIENISDKIVGAKNGINQSFYSKAFISHSNGYKMILSLYPDGFDIGMGTHLSVYFCLMK 371          
BLAST of TNF receptor associated factor 3 vs. Planmine SMEST
Match: SMESG000026092.1 (SMESG000026092.1)

HSP 1 Score: 318.931 bits (816), Expect = 9.983e-103
Identity = 167/303 (55.12%), Postives = 229/303 (75.58%), Query Frame = 1
Query:   94 MAAKLENVWEAIKNDNFHTVGEIEDEMMCLLCKKLLINAHSAPCGCRFCLTCISEYLDIENKICPGETEECQIELINMNGNIIIDRPMNVKISKLIVKCPEQSCEHACELRKIEDHVRICNYRAVECPYSNIGCDKYEISHHNVVDHLRSDTMIHTKLLMDFVGNLNNEMSILKTNNNELREENKSLRTEINQLKLDVERSQGEIVDLESKLNRKIQDIDELNTDVICFKIDIDSVKENLAKLILNEEKKQIEFADLQREFNNSTRDILSLNQGMETLGNRDKDVSEEVNGLKVKLLMKELVI 1002
            MA KLEN+WE++K+ ++ T+GEIEDEM+CLLCKKLL+NAHSAPCGCRFC  C+SEYL  EN+ CPG+TE+C++ELI++  NI++DRPMNVKISKL+VKCPE  CE   ELRK+EDH+R+CNY++ +CPYSNIGCDK +IS   + DHL+S+ ++HTKLL+DFVGN NNEMS+LKT+NNELREENK LR EIN+LKL+ ER QGEI +L        ++ DE   D+IC K +   ++EN+ KL L  E  ++E A+L R  +  ++++ S+NQ    L    + ++EE + LK+ +   ++ I
Sbjct:    1 MATKLENIWESMKSYDYETIGEIEDEMLCLLCKKLLVNAHSAPCGCRFCFVCVSEYL-CENRYCPGDTEDCKLELISITENIMVDRPMNVKISKLLVKCPEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKSKISSDKISDHLQSEILMHTKLLIDFVGNFNNEMSMLKTSNNELREENKLLRMEINELKLNCERRQGEIAELR-------RESDEKTVDIICLKDENVLIRENVDKLTLGTENNKVELANLCRNRDKDSKEMKSINQDRTEL----RKLNEEFDALKLNVEQNKIAI 291          

HSP 2 Score: 90.1225 bits (222), Expect = 7.595e-19
Identity = 54/165 (32.73%), Postives = 88/165 (53.33%), Query Frame = 1
Query: 1237 ILRNEVNDYKLKVDKNQEEIQDFDTKFQQQSKQIDQVNSKYNEMEGKYRNVDAQSVKRQRDLV----------LSNKIEESVQRFFKSL-QIKKNQNKQINCEFVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            ++R  V+   L  + N+ E+ +      + SK++  +N    E+       DA  +  +++ +          +S KI  +V+   + L +++  QN+  N EFVW+I+  +DK+  A NG   S YSK F++HK GY M L + P G++ D  TYLSVYFCLMK
Sbjct:  227 LIRENVDKLTLGTENNKVELANLCRNRDKDSKEMKSINQDRTELRKLNEEFDALKLNVEQNKIAIRNKASTMEMSKKINNTVKNVDRRLLEMETIQNQMFNGEFVWRIENVKDKIVKAINGTNQSFYSKYFYSHKNGYNMCLLVYPDGNEVDNGTYLSVYFCLMK 391          
BLAST of TNF receptor associated factor 3 vs. Planmine SMEST
Match: SMESG000025869.1 (SMESG000025869.1)

HSP 1 Score: 316.62 bits (810), Expect = 2.506e-101
Identity = 178/400 (44.50%), Postives = 259/400 (64.75%), Query Frame = 1
Query:   97 AAKLENVWEAIKNDNFHTVGEIEDEMMCLLCKKLLINAHSAPCGCRFCLTCISEYLDIENKICPGETEECQIELINMNGNIIIDRPMNVKISKLIVKCPEQSCEHACELRKIEDHVRICNYRAVECPYSNIGCDKYEISHHNVVDHLRSDTMIHTKLLMDFVGNLNNEMSILKTNNNELREENKSLRTEINQLKLDVERSQGEIVDLESKLNRKIQDIDELNTDVICFKIDIDSVKENLAKLILNEEKKQIEFADLQREFNNSTRDILSLNQGMETLGNRDKDVSEEVNGLKVKLLMKELVI*CEFLQEAIRKSNTESLLQIKQIQQVISKCQNIENRIKDENQHRKDKEKDLMKNIAEMSKKKEINRLEMTKKLEKTCEILRNEVNDYKLKVDKNQEEI 1296
             +KLENV + ++N  +    +I+  M+CL+CK LLINA SAPCGCRFC TCIS YL   NK CPG+TE+C++E++N++GNI ++  +NV+ISKL VKCP   C++  ELRK+E+H R C YR+V+CPYSNIGC K  IS   V DHL+S+  +HTKLL+DFVGN NN+M  LK NNNEL   NK L+ EIN+LKLD ER + EI +L+ K + K   ID+LN D+IC   +  +++EN+ KLI   E+ ++E  DLQR+  +   +I  LN+ +  L N D++VS+ ++GL       +L+I  E  Q AIR  + E+  Q ++I Q    CQ  E            K+K+L++ I +M  K++++  EM+ K++K    LR  V+   L++  NQ ++
Sbjct:    3 VSKLENVCQIMRNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCPYSNIGCSKCNISQDKVTDHLQSEIFVHTKLLLDFVGNFNNKMDKLKANNNELSTVNKLLQNEINELKLDGERRREEIAELQWKFDEKSVKIDQLNADIICLNGEKVAMRENMDKLISGGERNRVEIGDLQRKCADQVEEIELLNEDIPALRNVDRNVSDRLDGL-------QLII--EGNQLAIR--SVENDFQ-QKIAQCTINCQQAE-----------IKQKELIEKINQMENKQKVDLTEMSNKIDK----LRGNVDTKLLEMAANQNQL 375          

HSP 2 Score: 98.2117 bits (243), Expect = 2.221e-21
Identity = 60/157 (38.22%), Postives = 96/157 (61.15%), Query Frame = 1
Query: 1240 LRNEVNDYKLKVDKNQEEIQDFDTKFQQQSKQIDQVNSKYNEMEGK--YRNVDAQSVKRQRDLV-LSNKIEESVQRF-FKSLQIKKNQNKQINCEFVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            + + ++  +L ++ NQ  I+  +  FQQ+  Q   +N +  E++ K     ++    K++ DL  +SNKI++       K L++  NQN+    EFVWK+DKF DK+ +A+NG    IYS++F THK GYKM L++ P G+ + + T+LSVYFCLMK
Sbjct:  286 VSDRLDGLQLIIEGNQLAIRSVENDFQQKIAQC-TINCQQAEIKQKELIEKINQMENKQKVDLTEMSNKIDKLRGNVDTKLLEMAANQNQLNYGEFVWKLDKFTDKMANAKNGINTDIYSESFLTHKNGYKMCLRVFPNGNKDAKGTHLSVYFCLMK 441          
BLAST of TNF receptor associated factor 3 vs. Planmine SMEST
Match: SMESG000027263.1 (SMESG000027263.1)

HSP 1 Score: 314.309 bits (804), Expect = 1.540e-100
Identity = 170/376 (45.21%), Postives = 244/376 (64.89%), Query Frame = 1
Query:  103 KLENVWEAIKNDNFHTVGEIEDEMMCLLCKKLLINAHSAPCGCRFCLTCISEYLDIENKICPGETEECQIELINMNGNIIIDRPMNVKISKLIVKCPEQSCEHACELRKIEDHVRICNYRAVECPYSNIGCDKYEISHHNVVDHLRSDTMIHTKLLMDFVGNLNNEMSILKTNNNELREENKSLRTEINQLKLDVERSQGEIVDLESKLNRKIQDIDELNTDVICFKIDIDSVKENLAKLILNEEKKQIEFADLQREFNNSTRDILSLNQGMETLGNRDKDVSEEVNGLKVKLLMKELVI*CEFLQEAIRKSNTESLLQIKQIQQVISKCQNIENRIKDENQHRKDKEKDLMKNIAEMSKKKEINRLEMTKKLEKT 1230
            KLENVW  IKN+NF  +  ++++M+CLLCK LLINA +APCGCRFC +CIS +LD ENK CPG TE C+ EL++MN NI++D+PMN+KISK+ VKCPE+SCE   EL K+EDH R+C YR+  CPYSNIGCDK  I    V DHL+S+ ++HTKLLMDF+G                      L  EIN LKLD ER + EIV+L+ K + K   ID+LN D+IC   +  +++EN+ KLI   E+  +E  DLQR+  +   +I  LN+ +  L N D+ +S+ ++GL       +L+I  +  Q A+R    E+ LQ +QI Q  + CQ  E++  + NQ R+ K+K+L+  I +M KK++ +  +++ K++K+
Sbjct:    5 KLENVWRMIKNNNFDHLAVVQNDMLCLLCKNLLINARNAPCGCRFCFSCISSFLDGENKTCPGNTEFCKSELLDMNINILVDQPMNIKISKIKVKCPEKSCEFVDELIKMEDHSRMCKYRSAACPYSNIGCDKCNIFQDKVADHLQSEILVHTKLLMDFIG----------------------LSAEINGLKLDGERRREEIVELQRKCDEKSAKIDQLNADIICLNGENVAMRENMDKLISAGERNLVEIGDLQRKCADQAEEIELLNEDIPALRNADRSMSDRLDGL-------QLII--DGSQVAMRA--CENNLQ-QQIAQCATNCQQAESKFHNANQMREIKQKELIDKIGQMEKKQKTDFAKISNKIDKS 346          

HSP 2 Score: 91.6633 bits (226), Expect = 2.700e-19
Identity = 85/277 (30.69%), Postives = 140/277 (50.54%), Query Frame = 1
Query:  946 VSEEVNGLKVKLLMKELVI*CEFLQEAIRKSNTESLLQIKQIQQVISKCQNIENRIKDENQHRKDKEKDLMKNIAEMS--KKKEINRLEMTKKLEKTCEILRNE-------VNDYKLKVDKNQEEIQDFDTKFQQQSKQIDQVNSKYNEMEGKYRNVDAQSVKRQRDLV----------------LSNKIEESVQRF-FKSLQIKKNQNKQINCEFVWKIDKFRDKLEDAQNGQKPSIYSKAFFTHKIGYKMRLKLCPGGDDEDESTYLSVYFCLMK 1698
            +S E+NGLK+    +      E + E  RK + +S  +I Q+   I  C N EN    EN  +     +  +N+ E+   ++K  ++ E  + L +    LRN        ++  +L +D +Q  ++  +   QQQ   I Q  +   + E K+ N +     +Q++L+                +SNKI++S+     K L++  NQN+    EFVWK+DKF +K+ DA+ G    IYS++F THK GYKM L + P G+ + + T+LSV+F LMK
Sbjct:  166 LSAEINGLKLDGERRR-----EEIVELQRKCDEKSA-KIDQLNADII-CLNGENVAMRENMDKLISAGE--RNLVEIGDLQRKCADQAEEIELLNEDIPALRNADRSMSDRLDGLQLIIDGSQVAMRACENNLQQQ---IAQCATNCQQAESKFHNANQMREIKQKELIDKIGQMEKKQKTDFAKISNKIDKSMANADRKLLEMAANQNQLNYGEFVWKLDKFTNKMADAKKGINSYIYSESFLTHKNGYKMCLGVDPDGNGDGKGTHLSVFFHLMK 430          
The following BLAST results are available for this feature:
BLAST of TNF receptor associated factor 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF23.350e-1043.55TNF receptor associated factor 2 [Source:HGNC Symb... [more]
TRAF61.358e-931.45TNF receptor associated factor 6 [Source:HGNC Symb... [more]
TRAF61.358e-931.45TNF receptor associated factor 6 [Source:HGNC Symb... [more]
TRAF11.845e-729.25TNF receptor associated factor 1 [Source:HGNC Symb... [more]
TRAF16.999e-729.25TNF receptor associated factor 1 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor associated factor 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
trf-12.166e-734.92TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
back to top
BLAST of TNF receptor associated factor 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Traf64.265e-726.35gene:FBgn0265464 transcript:FBtr0071188[more]
back to top
BLAST of TNF receptor associated factor 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX901915.13.241e-1245.16pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:2... [more]
AL844899.13.241e-1245.16pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28... [more]
unm_sa8083.575e-1226.62un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21... [more]
traf2a2.919e-1145.16Tnf receptor-associated factor 2a [Source:ZFIN;Acc... [more]
traf2b1.704e-1041.94Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
back to top
BLAST of TNF receptor associated factor 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF24.231e-1145.16TNF receptor associated factor 2 [Source:NCBI gene... [more]
TRAF24.698e-1145.16TNF receptor associated factor 2 [Source:NCBI gene... [more]
egf2.407e-929.20epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
hspb61.193e-841.94heat shock protein family B (small) member 6 [Sour... [more]
slc12a14.948e-728.70solute carrier family 12 member 1 [Source:Xenbase;... [more]
back to top
BLAST of TNF receptor associated factor 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf21.148e-1043.55TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf21.173e-1043.55TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf63.317e-830.65TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
Traf11.203e-722.34TNF receptor-associated factor 1 [Source:MGI Symbo... [more]
Traf11.203e-722.34TNF receptor-associated factor 1 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor associated factor 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P39429|TRAF2_MOUSE8.203e-1043.55TNF receptor-associated factor 2 OS=Mus musculus O... [more]
sp|Q12933|TRAF2_HUMAN1.609e-943.55TNF receptor-associated factor 2 OS=Homo sapiens O... [more]
sp|B6CJY5|TRAF6_MACMU2.249e-932.26TNF receptor-associated factor 6 OS=Macaca mulatta... [more]
sp|B6CJY4|TRAF6_CERAT2.391e-932.26TNF receptor-associated factor 6 OS=Cercocebus aty... [more]
sp|Q9Y4K3|TRAF6_HUMAN6.520e-931.45TNF receptor-associated factor 6 OS=Homo sapiens O... [more]
back to top
BLAST of TNF receptor associated factor 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0F7GWW36.802e-4656.21TNF receptor associated factor 4 (Fragment) OS=Sch... [more]
I1ZID85.480e-3641.67TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
T1E1012.944e-3028.38TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A3P7HNV33.670e-1328.17Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A0R3XCV33.705e-1328.17Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
back to top
BLAST of TNF receptor associated factor 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2a2.463e-1145.16TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2a2.505e-1145.16TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2b1.889e-1041.94TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf11.542e-837.04TNF receptor-associated factor 1-like [Source:NCBI... [more]
traf11.747e-837.04TNF receptor-associated factor 1-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor associated factor 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008091.13.535e-828.03pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 ... [more]
ENSPMAT00000000074.15.497e-831.58pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000002130.18.578e-827.96pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
traf63.003e-728.30TNF receptor-associated factor 6 [Source:NCBI gene... [more]
rnf41l6.059e-727.19ring finger protein 41, like [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of TNF receptor associated factor 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352371.378e-1340.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494643.460e-1035.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438062.172e-827.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412434.150e-829.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO291454.628e-836.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor associated factor 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000020861.21.312e-1125.61TNF receptor-associated factor 2 [Source:NCBI gene... [more]
unm_sa8087.636e-1141.94TNF receptor-associated factor 2 [Source:NCBI gene... [more]
traf2b1.413e-1041.94TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b1.471e-1041.94TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf34.291e-825.62TNF receptor associated factor 3 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor associated factor 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026104.10.000e+094.77SMESG000026104.1[more]
SMESG000026111.17.209e-10450.15SMESG000026111.1[more]
SMESG000026092.19.983e-10355.12SMESG000026092.1[more]
SMESG000025869.12.506e-10144.50SMESG000025869.1[more]
SMESG000027263.11.540e-10045.21SMESG000027263.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001818 ID=SMED30001818|Name=TNF receptor associated factor 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1698bp
CTCATAAAATCAATATTTCAATTGGAATAGTTAGATATTATTTTGTATTT
TAAAAAATTTGGACGTTGTGTTGAATCTAAATATAAATTTGAAATGGCTG
CCAAATTGGAAAATGTTTGGGAAGCGATAAAAAATGATAATTTCCATACA
GTTGGTGAAATTGAGGATGAAATGATGTGCTTGTTATGCAAGAAATTATT
GATCAATGCTCACAGTGCTCCATGCGGTTGCAGATTTTGTCTGACTTGCA
TTTCCGAATATCTAGATATTGAGAATAAAATATGTCCAGGAGAAACTGAG
GAATGTCAAATTGAATTGATAAATATGAATGGGAATATTATTATCGATCG
GCCAATGAATGTCAAAATATCCAAATTGATTGTGAAATGCCCAGAGCAAT
CATGCGAACATGCATGTGAATTGAGAAAAATTGAAGATCATGTGCGGATT
TGTAATTATCGAGCTGTCGAATGTCCGTATTCGAATATCGGATGTGATAA
ATATGAAATATCTCATCATAATGTTGTGGATCATTTGAGATCTGATACAA
TGATCCACACAAAACTGTTGATGGATTTTGTGGGGAATTTGAACAATGAG
ATGAGCATACTGAAGACCAATAATAATGAGTTGAGAGAAGAAAATAAATC
ATTGCGAACGGAAATCAACCAATTGAAATTGGATGTTGAAAGGAGTCAAG
GAGAAATTGTGGACTTGGAAAGCAAATTAAATAGGAAAATTCAAGATATT
GACGAGTTGAATACTGATGTGATTTGTTTTAAAATTGATATTGATTCGGT
AAAAGAAAACTTGGCCAAATTGATTTTAAACGAAGAAAAGAAACAAATAG
AATTTGCTGATTTACAGCGGGAATTCAACAATTCGACTCGGGATATTTTG
TCATTGAATCAAGGCATGGAGACATTGGGGAATAGAGATAAAGATGTGAG
CGAAGAAGTGAATGGATTAAAAGTGAAACTATTGATGAAAGAATTAGTTA
TTTGATGTGAATTCCTTCAGGAGGCGATTCGAAAGTCCAACACAGAATCT
CTGCTGCAAATCAAACAAATTCAACAAGTCATCAGCAAATGTCAAAATAT
TGAAAACAGAATCAAAGATGAAAATCAGCATAGAAAAGACAAAGAAAAAG
ATTTGATGAAAAATATTGCAGAAATGAGTAAAAAAAAAGAAATTAATCGG
TTGGAAATGACAAAGAAATTGGAAAAAACTTGTGAAATTTTGCGAAACGA
AGTGAACGATTACAAATTAAAAGTAGATAAAAATCAAGAGGAAATTCAAG
ACTTTGATACCAAATTCCAGCAACAGAGCAAGCAAATTGATCAAGTCAAC
AGCAAATATAATGAAATGGAAGGTAAATATCGCAATGTAGATGCGCAAAG
TGTAAAAAGACAAAGAGATCTCGTGTTGTCAAACAAGATTGAAGAATCAG
TACAAAGGTTCTTCAAATCTTTGCAAATAAAAAAAAATCAAAATAAACAA
ATAAATTGTGAATTTGTGTGGAAAATTGATAAATTCCGTGATAAATTGGA
AGATGCACAAAATGGACAGAAACCATCAATTTATAGCAAAGCGTTTTTCA
CTCATAAAATTGGTTACAAAATGCGATTAAAATTATGTCCTGGTGGAGAT
GATGAAGATGAGAGTACTTATTTATCCGTGTACTTTTGTTTGATGAAG
back to top

protein sequence of SMED30001818-orf-1

>SMED30001818-orf-1 ID=SMED30001818-orf-1|Name=SMED30001818-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=181bp
MKNIAEMSKKKEINRLEMTKKLEKTCEILRNEVNDYKLKVDKNQEEIQDF
DTKFQQQSKQIDQVNSKYNEMEGKYRNVDAQSVKRQRDLVLSNKIEESVQ
RFFKSLQIKKNQNKQINCEFVWKIDKFRDKLEDAQNGQKPSIYSKAFFTH
KIGYKMRLKLCPGGDDEDESTYLSVYFCLMK
back to top

protein sequence of SMED30001818-orf-2

>SMED30001818-orf-2 ID=SMED30001818-orf-2|Name=SMED30001818-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=304bp
MAAKLENVWEAIKNDNFHTVGEIEDEMMCLLCKKLLINAHSAPCGCRFCL
TCISEYLDIENKICPGETEECQIELINMNGNIIIDRPMNVKISKLIVKCP
EQSCEHACELRKIEDHVRICNYRAVECPYSNIGCDKYEISHHNVVDHLRS
DTMIHTKLLMDFVGNLNNEMSILKTNNNELREENKSLRTEINQLKLDVER
SQGEIVDLESKLNRKIQDIDELNTDVICFKIDIDSVKENLAKLILNEEKK
QIEFADLQREFNNSTRDILSLNQGMETLGNRDKDVSEEVNGLKVKLLMKE
LVI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0042981regulation of apoptotic process
GO:0016567protein ubiquitination
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR013083Znf_RING/FYVE/PHD
IPR001293Znf_TRAF
IPR013323SIAH-type
IPR001841Znf_RING
IPR008974TRAF-like
IPR002083MATH/TRAF_dom
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0005515protein binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 240..260
NoneNo IPR availableCOILSCoilCoilcoord: 163..225
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 16..128
NoneNo IPR availableCDDcd16449RING-HCcoord: 29..65
e-value: 1.07314E-5
score: 39.7581
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 18..66
IPR001293Zinc finger, TRAF-typePFAMPF02176zf-TRAFcoord: 94..147
e-value: 6.0E-7
score: 30.1
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 92..148
e-value: 5.5E-7
score: 31.7
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 20..86
e-value: 4.7E-8
score: 34.8
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 16..128
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 29..65
score: 8.801
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 94..157