Paramyosin

Overview
NameParamyosin
Smed IDSMED30001807
Length (bp)3112
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Paramyosin (SMED30001807) t-SNE clustered cells

Violin plots show distribution of expression levels for Paramyosin (SMED30001807) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Paramyosin (SMED30001807) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Paramyosin (SMED30001807) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001807

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30001807h1SMcG0021076 Contig26006uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001807h1SMcG0021076 Contig26006newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001807h1SMcG0021076 Contig23791newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30001807h1SMcG0021076 dd_Smed_v4_249_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001807h1SMcG0021076 dd_Smed_v4_249_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001807h1SMcG0021076 dd_Smed_v4_249_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001807h1SMcG0021076 dd_Smed_v4_249_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001807h1SMcG0021076 dd_Smed_v4_249_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001807h1SMcG0021076 Contig45276newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001807h1SMcG0021076 Contig45276uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001807h1SMcG0021076 Contig9443uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001807h1SMcG0021076 Contig9443newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynx musculatureSMED30001807h1SMcG0021076 dd_Smed_v6_249_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30001807h1SMcG0021076 dd_Smed_v6_249_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Paramyosin vs. Ensembl Human
Match: MYH7 (myosin heavy chain 7 [Source:HGNC Symbol;Acc:HGNC:7577])

HSP 1 Score: 351.673 bits (901), Expect = 6.580e-101
Identity = 291/815 (35.71%), Postives = 498/815 (61.10%), Query Frame = 3
Query:  351 LESRVKELEDLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGS 2795
            L++R++ELE+ ++ ER AR + E+L ++L+ +++ ++ R+EE         +  KKR+ + QK+R+DLE A LQ E+    LRKK+  S+ E+  +ID+LQ+ + K EK+KS   +EL+ V   ++ + KAK + E     LE Q++  +S  ++ QR VNDL   ++KL +EN EL+  + E E  I+   + K +   Q++DLK+ L+EE + +  L   LQ  + D D L+ +Y+EE+EA  +L+  +SK N+++A  + KY+ + + +TEE EE K+KL  ++ E  +      ++ S LEKTK +L  EI+DL  +V+   A  A L  + ++ + + AE +++ ++   EL S +     L+T+  +LK    E LE     +++N +L  ++ DL + L  + + I ELE +R QLEA++  L +A  +A+ +L+  E K         Q+KA++E++L EKD+E+E  +R+  R ++ L  ++     + ++E  R+KKK E  + E+EIQL +AN+  A+  K    L   + + + +L+D  RA++   E+++I ER+   LQ EL++LR  +E +ER+RK AE E  E   RV  L     +LIN K++++ DL  +Q ++++AV   + AE++A K   +   +A+EL++EQD     E ++K +E  I+++  +L+EAE  A + GK+ +QKL+ R+RELE + EAEQ+R  E+    RK ER+ KEL  Q E+DR+ ++ LQDL+DK QLK++AYKRQ EE E+ +   ++K+RK Q ++++AE+RAD+AE  +   R+ S
Sbjct: 1111 LQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGSSGKTIHELEKVRKQLEAEKMELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAE-TRSRNEALRVKKKMEGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKS 1924          
BLAST of Paramyosin vs. Ensembl Human
Match: MYH6 (myosin heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:7576])

HSP 1 Score: 350.132 bits (897), Expect = 2.414e-100
Identity = 281/800 (35.12%), Postives = 483/800 (60.38%), Query Frame = 3
Query:  396 RDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGS 2795
            R AR + E+L ++L+ +++ ++ R+EE         +  KKR+ + QK+R+DLE A LQ E+    LRKK+  S+ E+  +ID+LQ+ + K EK+KS   +EL+ V   ++ + KAK + E     LE Q +  +   ++ QR +ND    ++KL +EN EL   ++E E  I+   + K S   Q++DLK+ L+EE + +  L   LQ  + D D L+ +Y+EE+EA  +L+  +SK N+++A  + KY+ + + +TEE EE K+KL  ++ +  +      ++ S LEKTK +L  EI+DL  +V+   A  A L  + ++ + + AE +++ ++   EL S +     L+T+  +LK    E LE     +++N +L  ++ DL + L +  + + ELE +R QLE ++  L +A  +A+ +L+  E K         Q+KA++E++L EKD+E+E  +R+ QR ++ L  ++     + ++E+ R+KKK E  + E+EIQL +AN+  A+  K    L   + + + +L+D  RA++   E+++I ER+   LQ EL++LR  +E +ER+RK AE E  E   RV  L     +LIN K+++E DL  +Q ++++AV   + AE++A K   +   +A+EL++EQD     E ++K +E  I+++  +L+EAE  A + GK+ +QKL+ R+RELE + EAEQ+R  E+    RK ER+ KEL  Q E+D++ ++ LQDL+DK QLK++AYKRQ EE E+ +   ++K+RK Q ++++AE+RAD+AE  +   R+ S
Sbjct: 1128 RTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANEYRVKLEEAQRSLNDFTTQRAKLQTENGELARQLEEKEALISQLTRGKLSYTQQMEDLKRQLEEEGKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGEGGKNVHELEKVRKQLEVEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHQRVVDSLQTSLDAE-TRSRNEVLRVKKKMEGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMESDLTQLQSEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELEGELEAEQKRNAESVKGMRKSERRIKELTYQTEEDKKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKS 1926          
BLAST of Paramyosin vs. Ensembl Human
Match: MYH1 (myosin heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:7567])

HSP 1 Score: 347.436 bits (890), Expect = 1.943e-99
Identity = 267/798 (33.46%), Postives = 489/798 (61.28%), Query Frame = 3
Query:  402 ARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGS 2795
            +R ++E+  ++L+ +++ ++ R+EE         +  KKR+ + QK+R+DLE A LQ E+    LRKK+  S+ E+  +ID+LQ+ + K EK+KS + ME++ +   ++ V KAK + E     LE Q+  +K+  ++ QR +NDL   +++L +E+ E +  + E +T ++   + K +   Q+++LK+ L+EE + +  L   LQ  + D D L+ +Y+EE EA  +L+  +SK N+++A  + KY+ + + +TEE EE K+KL  ++ +  +      ++ + LEKTKQ+L  E++DL  +V+   A  A L  + ++ + + AE +++ ++   EL + +  +  L+T+  ++K    E L++   L+++N +L  ++ DL + + +  +RI ELE ++ Q+E ++  L AA  +A+ +L+  E K       L Q+K+++++++ EKD+E++ ++R+  R +E +  T+    ++ +++  RLKKK E  + E+EIQL++AN+  A+  ++  +    + + +  L+D  R+ E   E L++ ER+   LQ E+++LR  LE +ER+RK AE E  +   RV  L     +LIN K++LE D+  IQG+++D +   + AE++A K   +   +A+EL++EQD     E ++K LE  ++++  +L+EAE  A + GK+ +QKL+ R+RELE + E+EQ+R  EA    RK ER+ KEL  Q E+DR+ ++ LQDL+DK Q K+++YKRQ EE E+ S V ++K+R+ Q ++E+AE+RAD+AE  +   R  S
Sbjct: 1132 SRAKAEKQRSDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAATLRKKHADSVAELGEQIDNLQRVKQKLEKEKSEMKMEIDDLASNMETVSKAKGNLEKMCRALEDQLSEIKTKEEEQQRLINDLTAQRARLQTESGEYSRQLDEKDTLVSQLSRGKQAFTQQIEELKRQLEEEIKAKSALAHALQSSRHDCDLLREQYEEEQEAKAELQRAMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEHVEAVNAKCASLEKTKQRLQNEVEDLMIDVERTNAACAALDKKQRNFDKILAEWKQKCEETHAELEASQKESRSLSTELFKIKNAYEESLDQLETLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQVEQEKSELQAALEEAEASLEHEEGKILRIQLELNQVKSEVDRKIAEKDEEIDQMKRNHIRIVESMQSTLDAE-IRSRNDAIRLKKKMEGDLNEMEIQLNHANRMAAEALRNYRNTQAILKDTQLHLDDALRSQEDLKEQLAMVERRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLETDISQIQGEMEDIIQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKKQIQKLEARVRELEGEVESEQKRNVEAVKGLRKHERKVKELTYQTEEDRKNILRLQDLVDKLQAKVKSYKRQAEEAEEQSNVNLSKFRRIQHELEEAEERADIAESQVNKLRVKS 1928          
BLAST of Paramyosin vs. Ensembl Human
Match: MYH4 (myosin heavy chain 4 [Source:HGNC Symbol;Acc:HGNC:7574])

HSP 1 Score: 344.354 bits (882), Expect = 1.777e-98
Identity = 262/788 (33.25%), Postives = 481/788 (61.04%), Query Frame = 3
Query:  402 ARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAE 2765
            +R ++E+  ++L+ +++ ++ R+EE         +  KKR+ + QK+R+DLE + LQ E+    LRKK+  S+ E+  +IDSLQ+ + K EK+KS L ME+  +   ++ V KAK + E     LE Q+  +K+  ++ QR +N+L+  K++L +E+ E +  + E +  ++   + K +   Q+++LK+ L+EE++ + TL   LQ  + D D L+ +Y+EE EA  +L+  +SK N+++A  + KY+ + + +TEE EE K+KL  ++ +  +      S+ + LEKTKQ+L  E++DL  +V+   A    L  + ++ + + AE +++ ++   EL + +  +  L+T+  ++K    E L+    L+++N +L  ++ DL + + +  + I ELE ++ QL+ ++  L  +  +A+ +L+  E K       L Q+K+++++++ EKD+EL+ L+R+  R +E +  T+    ++ +++  R+KKK E  + E+EIQL++AN+  A+  ++  +    + + +  L+D  R  +   E L++ ER+   +Q E+++LR  LE +ER RK AE E  +   RV  L     +LIN K++LE D+  IQG+++D V   + AE++A K   +   +A+EL++EQD     E ++K +E  ++++ ++L+EAE  A + GK+ +QKL+ R+RELE++ E+EQ+   EA    RK ER+ KEL  Q E+DR+ ++ LQDL+DK Q K++AYKRQ EE E+ S V + K+RK Q ++E+A++RAD+AE
Sbjct: 1132 SRAKAEKQRSDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEESTLQHEATAAALRKKHADSVAELGEQIDSLQRVKQKLEKEKSELKMEINDLASNMETVSKAKANFEKMCRTLEDQLSEIKTKEEEQQRLINELSAQKARLHTESGEFSRQLDEKDAMVSQLSRGKQAFTQQIEELKRQLEEETKAKSTLAHALQSARHDCDLLREQYEEEQEAKAELQRGMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEHVEAVNSKCASLEKTKQRLQNEVEDLMIDVERSNAACIALDKKQRNFDKVLAEWKQKYEETQAELEASQKESRSLSTELFKVKNAYEESLDHLETLKRENKNLQQEISDLTEQIAEGGKHIHELEKVKKQLDHEKSELQTSLEEAEASLEHEEGKILRIQLELNQVKSEIDRKIAEKDEELDQLKRNHLRVVESMQSTLDAE-IRSRNDALRIKKKMEGDLNEMEIQLNHANRQAAEALRNLRNTQGILKDTQLHLDDAIRGQDDLKEQLAMVERRANLMQAEVEELRASLERTERGRKMAEQELLDASERVQLLHTQNTSLINTKKKLETDISQIQGEMEDIVQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQLRLDEAEQLALKGGKKQIQKLEARVRELESEVESEQKHNVEAVKGLRKHERRVKELTYQTEEDRKNILRLQDLVDKLQTKVKAYKRQAEEAEEQSNVNLAKFRKLQHELEEAKERADIAE 1918          
BLAST of Paramyosin vs. Ensembl Human
Match: MYH2 (myosin heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:7572])

HSP 1 Score: 343.199 bits (879), Expect = 4.509e-98
Identity = 267/798 (33.46%), Postives = 482/798 (60.40%), Query Frame = 3
Query:  402 ARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGS 2795
            +R ++E+  ++L+ +++ ++ R+EE         +  KKR+ + QK+R+DLE A LQ E+    LRKK+  S+ E+  +ID+LQ+ + K EK+KS + ME++ +   ++ V KAK + E     LE Q+  LKS  ++ QR +NDL   + +L +E+ E +  + E E  ++   + K +   Q+++LK+ L+EE + +  L   LQ  + D D L+ +Y+EE E+  +L+  +SK N ++A  + KY+ + + +TEE EE K+KL  ++    +      ++ + LEKTKQ+L  E++DL  +V+   A  A L  + ++ + + AE +++ ++   EL + +     L T+  ++K    E L++   L+++N +L  ++ DL + + +  +RI ELE ++ Q+E ++  L AA  +A+ +L+  E K       L Q+K+++++++ EKD+E++ L+R+  R +E +  T+    ++ +++  RLKKK E  + E+EIQL++AN+  A+  ++  +    + + +  L+D  R+ E   E L++ ER+   LQ E+++LR  LE +ER+RK AE E  +   RV  L     +LIN K++LE D+  +QG+++D +   + AE++A K   +   +A+EL++EQD     E ++K +E  ++++ ++L+EAE  A + GK+ +QKL+ R+RELE + E+EQ+R  EA    RK ER+ KEL  Q E+DR+ ++ LQDL+DK Q K+++YKRQ EE E+ S   + K+RK Q ++E+AE+RAD+AE  +   R  S
Sbjct: 1134 SRAKAEKQRSDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAATLRKKHADSVAELGEQIDNLQRVKQKLEKEKSEMKMEIDDLASNVETVSKAKGNLEKMCRTLEDQLSELKSKEEEQQRLINDLTAQRGRLQTESGEFSRQLDEKEALVSQLSRGKQAFTQQIEELKRQLEEEIKAKNALAHALQSSRHDCDLLREQYEEEQESKAELQRALSKANTEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQAAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVERTNAACAALDKKQRNFDKILAEWKQKCEETHAELEASQKEARSLGTELFKIKNAYEESLDQLETLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQVEQEKCELQAALEEAEASLEHEEGKILRIQLELNQVKSEVDRKIAEKDEEIDQLKRNHIRIVESMQSTLDAE-IRSRNDAIRLKKKMEGDLNEMEIQLNHANRMAAEALRNYRNTQGILKDTQIHLDDALRSQEDLKEQLAMVERRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLETDISQMQGEMEDILQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQLRLDEAEQLALKGGKKQIQKLEARVRELEGEVESEQKRNAEAVKGLRKHERRVKELTYQTEEDRKNILRLQDLVDKLQAKVKSYKRQAEEAEEQSNTNLAKFRKLQHELEEAEERADIAESQVNKLRVKS 1930          
BLAST of Paramyosin vs. Ensembl Celegans
Match: unc-54 (Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566])

HSP 1 Score: 332.028 bits (850), Expect = 9.843e-95
Identity = 292/842 (34.68%), Postives = 498/842 (59.14%), Query Frame = 3
Query:  354 ESRVKELEDLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLT-----VRRSGSVMPG-STYRAISVVRETSTLNSS 2861
            +SR+ ELE+ ++ ER +R +++R  ++L  +++ L  +++E         +  KKR+ ++ KLR+DLE AN+  E+   GLRKK+  ++ E++ ++D L K + K EKDK+  + + E +  +LD     K + E      E Q+  L+S  D+  RQ+ D    K +L SEN +L   +++ E+Q+N   ++KS L  Q+++ ++  DEE+R R T+  Q +  Q + + LQ   +EE E   ++  Q+SK NAD+   K +++ E ++K +E E+ KR+   KINEL +      S+ + LEKTK +L  ++ D Q +V+      + L  + K  + +  E +K+ DDL+ EL+  +      +TD  + K    EL E    L ++N SL+ ++KDL D L +  R + E++ +  +LE +++ L  A  +A+ AL+  E K       + Q+++++E+R++EK++E E+ R++  R   E      E E K K+E+ R+KKK E  I ELEI LD+ANK NA   K+      ++ EL+ ++E+E+R    T E    +E++   LQ E ++L    E++ERARK AE EA +   + +E    V++L + KR+LEG++  I  DLD+ +N  +AAE+R+ K   +  RLA+ELRQEQ++ +  + LRK LE +++EI V+L+EAEA A + GK+ + KL+ R+RELE++ + EQRR ++A     + +R+ +ELQ Q ++D++    LQDL+DK Q K++  K+Q+EE E+++ + + KY++   Q+EDAE+RAD AE  L+      R S SV PG  +  + +V+R  S   +S
Sbjct: 1121 QSRISELEEELENERQSRSKADRAKSDLQRELEELGEKLDEQGGATAAQVEVNKKREAELAKLRRDLEEANMNHENQLGGLRKKHTDAVAELTDQLDQLNKAKAKVEKDKAQAVRDAEDLAAQLDQETSGKLNNEKLAKQFELQLTELQSKADEQSRQLQDFTSLKGRLHSENGDLVRQLEDAESQVNQLTRLKSQLTSQLEEARRTADEEARERQTVAAQAKNYQHEAEQLQESLEEEIEGKNEILRQLSKANADIQQWKARFEGEGLLKADELEDAKRRQAQKINELQEALDAANSKNASLEKTKSRLVGDLDDAQVDVERANGVASALEKKQKGFDKIIDEWRKKTDDLAAELDGAQRDLRNTSTDLFKAKNAQEELAEVVEGLRRENKSLSQEIKDLTDQLGEGGRSVHEMQKIIRRLEIEKEELQHALDEAEAALEAEESKVLRAQVEVSQIRSEIEKRIQEKEEEFENTRKNHAR-ALESMQASLETEAKGKAELLRIKKKLEGDINELEIALDHANKANADAQKNLKRYQEQVRELQLQVEEEQRNGADTREQFFNAEKRATLLQSEKEELLVANEAAERARKQAEYEAADARDQANEANAQVSSLTSAKRKLEGEIQAIHADLDETLNEYKAAEERSKKAIADATRLAEELRQEQEHSQHVDRLRKGLEQQLKEIQVRLDEAEAAALKGGKKVIAKLEQRVRELESELDGEQRRFQDANKNLGRADRRVRELQFQVDEDKKNFERLQDLIDKLQQKLKTQKKQVEEAEELANLNLQKYKQLTHQLEDAEERADQAENSLSKMRSKSRASASVAPGLQSSASAAVIRSPSRARAS 1961          
BLAST of Paramyosin vs. Ensembl Celegans
Match: unc-54 (Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566])

HSP 1 Score: 332.028 bits (850), Expect = 9.843e-95
Identity = 292/842 (34.68%), Postives = 498/842 (59.14%), Query Frame = 3
Query:  354 ESRVKELEDLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLT-----VRRSGSVMPG-STYRAISVVRETSTLNSS 2861
            +SR+ ELE+ ++ ER +R +++R  ++L  +++ L  +++E         +  KKR+ ++ KLR+DLE AN+  E+   GLRKK+  ++ E++ ++D L K + K EKDK+  + + E +  +LD     K + E      E Q+  L+S  D+  RQ+ D    K +L SEN +L   +++ E+Q+N   ++KS L  Q+++ ++  DEE+R R T+  Q +  Q + + LQ   +EE E   ++  Q+SK NAD+   K +++ E ++K +E E+ KR+   KINEL +      S+ + LEKTK +L  ++ D Q +V+      + L  + K  + +  E +K+ DDL+ EL+  +      +TD  + K    EL E    L ++N SL+ ++KDL D L +  R + E++ +  +LE +++ L  A  +A+ AL+  E K       + Q+++++E+R++EK++E E+ R++  R   E      E E K K+E+ R+KKK E  I ELEI LD+ANK NA   K+      ++ EL+ ++E+E+R    T E    +E++   LQ E ++L    E++ERARK AE EA +   + +E    V++L + KR+LEG++  I  DLD+ +N  +AAE+R+ K   +  RLA+ELRQEQ++ +  + LRK LE +++EI V+L+EAEA A + GK+ + KL+ R+RELE++ + EQRR ++A     + +R+ +ELQ Q ++D++    LQDL+DK Q K++  K+Q+EE E+++ + + KY++   Q+EDAE+RAD AE  L+      R S SV PG  +  + +V+R  S   +S
Sbjct: 1121 QSRISELEEELENERQSRSKADRAKSDLQRELEELGEKLDEQGGATAAQVEVNKKREAELAKLRRDLEEANMNHENQLGGLRKKHTDAVAELTDQLDQLNKAKAKVEKDKAQAVRDAEDLAAQLDQETSGKLNNEKLAKQFELQLTELQSKADEQSRQLQDFTSLKGRLHSENGDLVRQLEDAESQVNQLTRLKSQLTSQLEEARRTADEEARERQTVAAQAKNYQHEAEQLQESLEEEIEGKNEILRQLSKANADIQQWKARFEGEGLLKADELEDAKRRQAQKINELQEALDAANSKNASLEKTKSRLVGDLDDAQVDVERANGVASALEKKQKGFDKIIDEWRKKTDDLAAELDGAQRDLRNTSTDLFKAKNAQEELAEVVEGLRRENKSLSQEIKDLTDQLGEGGRSVHEMQKIIRRLEIEKEELQHALDEAEAALEAEESKVLRAQVEVSQIRSEIEKRIQEKEEEFENTRKNHAR-ALESMQASLETEAKGKAELLRIKKKLEGDINELEIALDHANKANADAQKNLKRYQEQVRELQLQVEEEQRNGADTREQFFNAEKRATLLQSEKEELLVANEAAERARKQAEYEAADARDQANEANAQVSSLTSAKRKLEGEIQAIHADLDETLNEYKAAEERSKKAIADATRLAEELRQEQEHSQHVDRLRKGLEQQLKEIQVRLDEAEAAALKGGKKVIAKLEQRVRELESELDGEQRRFQDANKNLGRADRRVRELQFQVDEDKKNFERLQDLIDKLQQKLKTQKKQVEEAEELANLNLQKYKQLTHQLEDAEERADQAENSLSKMRSKSRASASVAPGLQSSASAAVIRSPSRARAS 1961          
BLAST of Paramyosin vs. Ensembl Celegans
Match: unc-54 (Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566])

HSP 1 Score: 332.028 bits (850), Expect = 9.843e-95
Identity = 292/842 (34.68%), Postives = 498/842 (59.14%), Query Frame = 3
Query:  354 ESRVKELEDLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLT-----VRRSGSVMPG-STYRAISVVRETSTLNSS 2861
            +SR+ ELE+ ++ ER +R +++R  ++L  +++ L  +++E         +  KKR+ ++ KLR+DLE AN+  E+   GLRKK+  ++ E++ ++D L K + K EKDK+  + + E +  +LD     K + E      E Q+  L+S  D+  RQ+ D    K +L SEN +L   +++ E+Q+N   ++KS L  Q+++ ++  DEE+R R T+  Q +  Q + + LQ   +EE E   ++  Q+SK NAD+   K +++ E ++K +E E+ KR+   KINEL +      S+ + LEKTK +L  ++ D Q +V+      + L  + K  + +  E +K+ DDL+ EL+  +      +TD  + K    EL E    L ++N SL+ ++KDL D L +  R + E++ +  +LE +++ L  A  +A+ AL+  E K       + Q+++++E+R++EK++E E+ R++  R   E      E E K K+E+ R+KKK E  I ELEI LD+ANK NA   K+      ++ EL+ ++E+E+R    T E    +E++   LQ E ++L    E++ERARK AE EA +   + +E    V++L + KR+LEG++  I  DLD+ +N  +AAE+R+ K   +  RLA+ELRQEQ++ +  + LRK LE +++EI V+L+EAEA A + GK+ + KL+ R+RELE++ + EQRR ++A     + +R+ +ELQ Q ++D++    LQDL+DK Q K++  K+Q+EE E+++ + + KY++   Q+EDAE+RAD AE  L+      R S SV PG  +  + +V+R  S   +S
Sbjct: 1121 QSRISELEEELENERQSRSKADRAKSDLQRELEELGEKLDEQGGATAAQVEVNKKREAELAKLRRDLEEANMNHENQLGGLRKKHTDAVAELTDQLDQLNKAKAKVEKDKAQAVRDAEDLAAQLDQETSGKLNNEKLAKQFELQLTELQSKADEQSRQLQDFTSLKGRLHSENGDLVRQLEDAESQVNQLTRLKSQLTSQLEEARRTADEEARERQTVAAQAKNYQHEAEQLQESLEEEIEGKNEILRQLSKANADIQQWKARFEGEGLLKADELEDAKRRQAQKINELQEALDAANSKNASLEKTKSRLVGDLDDAQVDVERANGVASALEKKQKGFDKIIDEWRKKTDDLAAELDGAQRDLRNTSTDLFKAKNAQEELAEVVEGLRRENKSLSQEIKDLTDQLGEGGRSVHEMQKIIRRLEIEKEELQHALDEAEAALEAEESKVLRAQVEVSQIRSEIEKRIQEKEEEFENTRKNHAR-ALESMQASLETEAKGKAELLRIKKKLEGDINELEIALDHANKANADAQKNLKRYQEQVRELQLQVEEEQRNGADTREQFFNAEKRATLLQSEKEELLVANEAAERARKQAEYEAADARDQANEANAQVSSLTSAKRKLEGEIQAIHADLDETLNEYKAAEERSKKAIADATRLAEELRQEQEHSQHVDRLRKGLEQQLKEIQVRLDEAEAAALKGGKKVIAKLEQRVRELESELDGEQRRFQDANKNLGRADRRVRELQFQVDEDKKNFERLQDLIDKLQQKLKTQKKQVEEAEELANLNLQKYKQLTHQLEDAEERADQAENSLSKMRSKSRASASVAPGLQSSASAAVIRSPSRARAS 1961          
BLAST of Paramyosin vs. Ensembl Celegans
Match: myo-5 (MYOsin heavy chain structural genes [Source:UniProtKB/TrEMBL;Acc:Q21000])

HSP 1 Score: 317.005 bits (811), Expect = 9.336e-90
Identity = 266/846 (31.44%), Postives = 494/846 (58.39%), Query Frame = 3
Query:  351 LESRVKELEDLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRR------SGSVMPGSTYRAISVVRETSTLNSSRGA 2870
            L +R++ELE+ +D ER++R ++E+   E+  +++ L  R++E         +  KKR+ ++ KLR+DLE A +  E+    LRKK+N ++ E+S ++D++QK RGK E++K++   E++ +    D   K + + E     LE Q+  +   +D+  R + +L   K+K+ +EN +L   +++ E Q+ +  +IK     Q+++LK+ LD+E+R R +L  Q+   Q + +  +   +EE +A   ++ Q+SK N+++   + K++ E + + EE EE +RKLT K+ E+ ++      +   LEK KQ+L  +++D Q + D   +  + L  + K  + +  E +++ + L  E+   +      AT+  RL+ Q+ E  E+   ++++N +LA +LKD+ D L +  + + +L+ +R +LE +++ L  A  +A+ AL+  E K       + Q+++++E+RL+EK++E E+ R++  RTIE + +++     + ++E+ + KKK E  + ELEI LD++NK N    K    L   I EL+ ++E+E+R+   + +  +++ER+   LQ E +DL    E SER R+ AE E  E+   V+EL+   + L+  KR++EGDL ++Q ++++A++  + ++++A K   + ++LADELR EQ++       +KTLE +++++ ++L+EAEA   + GKR + KL +R+ ELE + E E RR  E Q   R  +R+ +ELQ Q ++D++    + DL++K Q K++ YKRQ+E+ E +++  + KYR+ Q  +EDA++RAD AE  L   R      SG   P     ++S          SRGA
Sbjct: 1121 LLARIQELEEELDAERNSRSKAEKARNEMQMELEELGDRLDEAGGATQAQIELNKKREAELAKLRQDLEDAAINSETSMAALRKKHNDAVAELSDQLDTIQKMRGKLEREKNDKQREVDELQQSADVEAKQRQNCERMAKQLEAQLTDMTLKSDEQARLIQELTMGKNKVHNENQDLNRQLEDAEAQLCALNRIKQQQHSQLEELKRTLDQETRERQSLHSQVSNYQLECEQFRESLEEEQDAKTDVQRQLSKANSEIQQWRAKFEGEGVSRAEELEETRRKLTHKVQEMQEQLENANQKIGTLEKNKQRLAHDLEDAQVDADRANSIASSLEKKQKGFDKVLDEWRRKCEALVAEVEQSQRETRAAATETFRLRNQLEESGEQTEAVKRENKALAQELKDIADQLGEGGKSVHDLQKMRRRLEIEKEELQQALDEAECALEAEEAKVMRAQIEVSQIRSEIEKRLQEKEEEFENTRKNHSRTIESMQVSLETES-RGRAELLKTKKKLEGDVNELEIALDHSNKLNVDGQKSMKKLQDTIRELQYQVEEEQRSLSESRDHANLAERRSQVLQQEKEDLAIIYEQSERTRRQAELELAEVKDSVNELSNSNSLLLATKRKVEGDLQLLQSEIEEAMSDAKTSDEKAKKAIMDASKLADELRSEQEHASNLNQSKKTLESQVKDLQMRLDEAEAAGIKGGKRQLAKLDMRIHELETELEGENRRHAETQKVLRNKDRKCRELQFQVDEDKKSQERMYDLIEKLQQKIKTYKRQIEDAESLASGNLAKYRQLQHVVEDAQERADAAENALQKLRLKGRSTSGVFGPRGLAHSMSTTGVNMRRGGSRGA 1965          
BLAST of Paramyosin vs. Ensembl Celegans
Match: unc-15 (Paramyosin [Source:UniProtKB/Swiss-Prot;Acc:P10567])

HSP 1 Score: 304.679 bits (779), Expect = 7.489e-89
Identity = 275/834 (32.97%), Postives = 480/834 (57.55%), Query Frame = 3
Query:  348 RLESRVKELEDLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENA-DLLNRLK-HAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRS---GSVMPGSTYRAISVV 2834
            RLE +++ L++ ++ ER+ R R ER  A+L+ Q+ AL  R+E+         ++ +KR+ ++ KLRK LE + L+ E     LRKK+  S  +   +I+ LQK   K ++++  +  E+  +   +D ++K K++AE   +  E Q + L +  +DL + VNDL   + +L +EN +L   V + + Q+++ + +K +L  Q+++ ++ L++  R R  LQ QL  +Q + DS++   DEES A     ++++  N ++   K K+D E+ +  EE E++++K+  K  E  ++      + S LEK K +L  E++ L   VDL  A+N   LL R +   E    EL+ RID++++EL + +     +  +  ++K    + +E+   L ++N  L ++L + K+AL DANR++ EL+   A+L  +   L  A  +A    +D E + Q   + L  L+ +ME+RL+EK++E+E+LR++ Q  I+ L   + + E + KSEI+RLKKKY++ I ELE+ +DN N+ N +  K     S ++  L+  LED +R  +   +  ++++RK   L  EL++ +  L+++ RARK AE + +E  GR+S+L    N L + K +LE +L   Q DLD+      AA++RAN+   +  R  ++L +EQ++  K ++LRK+LE +++++ V+++EAEA A   GKR + KL+ R+R+LE   + E RR KE Q   RK +R+ KE+QQ  +++ +  V  QD  D+   K+   KRQL E E V+   + + R+ Q ++EDAE RAD AE  L + R+    SV+ G +   I V 
Sbjct:   37 RLEDKIRLLQEDLESERELRNRVERERADLSVQVIALTDRLEDAEGTTDSQIESNRKREGELSKLRKLLEESQLESEDAMNVLRKKHQDSCLDYQDQIEQLQKKNAKIDRERQRVQHEVIELTATIDQLQKDKHTAEKAAERFEAQANELANKVEDLNKHVNDLAQQRQRLQAENNDLLKEVHDQKVQLDNLQHVKYTLAQQLEEARRRLEDAERERSQLQSQLHQVQLELDSVRTALDEESIARSDAEHKLNLANTEITQWKSKFDAEVALHHEEVEDLRKKMLQKQAEYEEQIEIMLQKISQLEKAKSRLQSEVEVLI--VDLEKAQNTIALLERAREQLERQVGELKVRIDEITVELEAAQRELRAVNAELQKMKHLYEKAVEQKEALARENKKLHDELHEAKEALADANRKLHELDLENARLAGEIRELQTALKEADAQRRDAENRAQRALAELQALRIEMERRLQEKEEEMEALRKNLQFEIDRLIAALADAEARMKSEISRLKKKYQAEIAELEMTVDNLNRANIEAQKTIKKQSEQLKILQASLEDTQRQLQQVLDQYALAQRKVAALSAELEECKTALDNAIRARKQAEVDLEEANGRISDLISINNNLTSIKNKLETELSTAQADLDEVTKELHAADERANRALADAARAVEQLHEEQEHSMKIDALRKSLEEQVKQLQVQIQEAEAAALLGGKRVIAKLETRIRDLETALDEETRRHKETQNALRKKDRRIKEVQQLVDEEHKNFVMAQDTADRLTEKLNIQKRQLAESESVTMQNLQRVRRYQHELEDAEGRADQAESSLHLIRAKHRSSVVTGKSSSKIFVT 868          
BLAST of Paramyosin vs. Ensembl Fly
Match: Mhc (gene:FBgn0264695 transcript:FBtr0346712)

HSP 1 Score: 370.933 bits (951), Expect = 9.723e-108
Identity = 303/792 (38.26%), Postives = 489/792 (61.74%), Query Frame = 3
Query:  513 KKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGSVMPGSTYRAISVVRETSTLNSSRGARATSIR 2888
            KKR+ ++ KLR+DLE AN+Q ES    LRKK+N ++ EM+ ++D L K + KAE D+     EL       D + + K + E     L+  ++ ++S  D+  R +ND + +K KLS EN +L   ++E E+Q++   KIK SL  Q++D K+  DEESR R TL G+ + L+ D D+L+ + +EE+E    L+ Q+SK NA+    + KY+ + + ++EE EE KRKL  ++ E  +       +  GLEKTKQ+L+ E++DLQ EVD   A       + K  + +  E + ++DDL+ EL++ +      +T+  RLK    E  E+   + ++N +LA+++KDL D + +  R I E+E  R +LEA++D L AA  +A+ AL+  E K       L Q++ ++++R++EK++E E+ R++ QR ++ +  ++     K K+E  R+KKK E+ I ELEI LD+ANK NA+  K+     +++ +++  LE+E+RA +   E L ISER+   LQ EL++ R  LE ++R R+ AE E  +   +++E++    ++   KR+LE +L  +  DLD+ +N  + +E++A K   +  RLADELR EQD+ +  E LRK LE +I+E+ V+L+EAEA A + GK+A+QKL+ R+RELE + + EQRR  +AQ   RK ER+ KEL  Q+E+DR+    +QDL+DK Q K++ YKRQ+EE E+++ + + K+RKAQQ++E+AE+RAD+AE+ ++  R+         RA SV R      +S   RATS+R
Sbjct: 1164 KKREAELSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEHDRQTCHNELNQTRTACDQLGRDKAAQEKIAKQLQHTLNEVQSKLDETNRTLNDFDASKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESRERATLLGKFRNLEHDLDNLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQARLAEAEETIESLNQKCIGLEKTKQRLSTEVEDLQLEVDRANAIANAAEKKQKAFDKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKGAYEEGQEQLEAVRRENKNLADEVKDLLDQIGEGGRNIHEIEKARKRLEAEKDELQAALEEAEAALEQEENKVLRAQLELSQVRQEIDRRIQEKEEEFENTRKNHQRALDSMQASLEAE-AKGKAEALRMKKKLEADINELEIALDHANKANAEAQKNIKRYQQQLKDIQTALEEEQRARDDAREQLGISERRANALQNELEESRTLLEQADRGRRQAEQELADAHEQLNEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQKLEQRVRELENELDGEQRRHADAQKNLRKSERRVKELSFQSEEDRKNHERMQDLVDKLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAISKFRAKG-------RAGSVGR-----GASPAPRATSVR 1942          
BLAST of Paramyosin vs. Ensembl Fly
Match: Mhc (gene:FBgn0264695 transcript:FBtr0307494)

HSP 1 Score: 370.933 bits (951), Expect = 1.019e-107
Identity = 303/792 (38.26%), Postives = 489/792 (61.74%), Query Frame = 3
Query:  513 KKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGSVMPGSTYRAISVVRETSTLNSSRGARATSIR 2888
            KKR+ ++ KLR+DLE AN+Q ES    LRKK+N ++ EM+ ++D L K + KAE D+     EL       D + + K + E     L+  ++ ++S  D+  R +ND + +K KLS EN +L   ++E E+Q++   KIK SL  Q++D K+  DEESR R TL G+ + L+ D D+L+ + +EE+E    L+ Q+SK NA+    + KY+ + + ++EE EE KRKL  ++ E  +       +  GLEKTKQ+L+ E++DLQ EVD   A       + K  + +  E + ++DDL+ EL++ +      +T+  RLK    E  E+   + ++N +LA+++KDL D + +  R I E+E  R +LEA++D L AA  +A+ AL+  E K       L Q++ ++++R++EK++E E+ R++ QR ++ +  ++     K K+E  R+KKK E+ I ELEI LD+ANK NA+  K+     +++ +++  LE+E+RA +   E L ISER+   LQ EL++ R  LE ++R R+ AE E  +   +++E++    ++   KR+LE +L  +  DLD+ +N  + +E++A K   +  RLADELR EQD+ +  E LRK LE +I+E+ V+L+EAEA A + GK+A+QKL+ R+RELE + + EQRR  +AQ   RK ER+ KEL  Q+E+DR+    +QDL+DK Q K++ YKRQ+EE E+++ + + K+RKAQQ++E+AE+RAD+AE+ ++  R+         RA SV R      +S   RATS+R
Sbjct: 1164 KKREAELSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEHDRQTCHNELNQTRTACDQLGRDKAAQEKIAKQLQHTLNEVQSKLDETNRTLNDFDASKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESRERATLLGKFRNLEHDLDNLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQARLAEAEETIESLNQKCIGLEKTKQRLSTEVEDLQLEVDRANAIANAAEKKQKAFDKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKGAYEEGQEQLEAVRRENKNLADEVKDLLDQIGEGGRNIHEIEKARKRLEAEKDELQAALEEAEAALEQEENKVLRAQLELSQVRQEIDRRIQEKEEEFENTRKNHQRALDSMQASLEAE-AKGKAEALRMKKKLEADINELEIALDHANKANAEAQKNIKRYQQQLKDIQTALEEEQRARDDAREQLGISERRANALQNELEESRTLLEQADRGRRQAEQELADAHEQLNEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQKLEQRVRELENELDGEQRRHADAQKNLRKSERRVKELSFQSEEDRKNHERMQDLVDKLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAISKFRAKG-------RAGSVGR-----GASPAPRATSVR 1942          
BLAST of Paramyosin vs. Ensembl Fly
Match: Mhc (gene:FBgn0264695 transcript:FBtr0080897)

HSP 1 Score: 370.163 bits (949), Expect = 1.841e-107
Identity = 303/792 (38.26%), Postives = 489/792 (61.74%), Query Frame = 3
Query:  513 KKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGSVMPGSTYRAISVVRETSTLNSSRGARATSIR 2888
            KKR+ ++ KLR+DLE AN+Q ES    LRKK+N ++ EM+ ++D L K + KAE D+     EL       D + + K + E     L+  ++ ++S  D+  R +ND + +K KLS EN +L   ++E E+Q++   KIK SL  Q++D K+  DEESR R TL G+ + L+ D D+L+ + +EE+E    L+ Q+SK NA+    + KY+ + + ++EE EE KRKL  ++ E  +       +  GLEKTKQ+L+ E++DLQ EVD   A       + K  + +  E + ++DDL+ EL++ +      +T+  RLK    E  E+   + ++N +LA+++KDL D + +  R I E+E  R +LEA++D L AA  +A+ AL+  E K       L Q++ ++++R++EK++E E+ R++ QR ++ +  ++     K K+E  R+KKK E+ I ELEI LD+ANK NA+  K+     +++ +++  LE+E+RA +   E L ISER+   LQ EL++ R  LE ++R R+ AE E  +   +++E++    ++   KR+LE +L  +  DLD+ +N  + +E++A K   +  RLADELR EQD+ +  E LRK LE +I+E+ V+L+EAEA A + GK+A+QKL+ R+RELE + + EQRR  +AQ   RK ER+ KEL  Q+E+DR+    +QDL+DK Q K++ YKRQ+EE E+++ + + K+RKAQQ++E+AE+RAD+AE+ ++  R+         RA SV R      +S   RATS+R
Sbjct: 1164 KKREAELSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEHDRQTCHNELNQTRTACDQLGRDKAAQEKIAKQLQHTLNEVQSKLDETNRTLNDFDASKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESRERATLLGKFRNLEHDLDNLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQARLAEAEETIESLNQKCIGLEKTKQRLSTEVEDLQLEVDRANAIANAAEKKQKAFDKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKGAYEEGQEQLEAVRRENKNLADEVKDLLDQIGEGGRNIHEIEKARKRLEAEKDELQAALEEAEAALEQEENKVLRAQLELSQVRQEIDRRIQEKEEEFENTRKNHQRALDSMQASLEAE-AKGKAEALRMKKKLEADINELEIALDHANKANAEAQKNIKRYQQQLKDIQTALEEEQRARDDAREQLGISERRANALQNELEESRTLLEQADRGRRQAEQELADAHEQLNEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQKLEQRVRELENELDGEQRRHADAQKNLRKSERRVKELSFQSEEDRKNHERMQDLVDKLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAISKFRAKG-------RAGSVGR-----GASPAPRATSVR 1942          
BLAST of Paramyosin vs. Ensembl Fly
Match: Mhc (gene:FBgn0264695 transcript:FBtr0301829)

HSP 1 Score: 367.081 bits (941), Expect = 2.031e-106
Identity = 299/791 (37.80%), Postives = 488/791 (61.69%), Query Frame = 3
Query:  513 KKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGSVMPGSTYRAISVVRETSTLNSSRGARATSI 2885
            KKR+ ++ KLR+DLE AN+Q ES    LRKK+N ++ EM+ ++D L K + KAE D+     EL       D + + K + E     L+  ++ ++S  D+  R +ND + +K KLS EN +L   ++E E+Q++   KIK SL  Q++D K+  DEESR R TL G+ + L+ D D+L+ + +EE+E    L+ Q+SK NA+    + KY+ + + ++EE EE KRKL  ++ E  +       +  GLEKTKQ+L+ E++DLQ EVD   A       + K  + +  E + ++DDL+ EL++ +      +T+  RLK    E  E+   + ++N +LA+++KDL D + +  R I E+E  R +LEA++D L AA  +A+ AL+  E K       L Q++ ++++R++EK++E E+ R++ QR ++ +  ++     K K+E  R+KKK E+ I ELEI LD+ANK NA+  K+     +++ +++  LE+E+RA +   E L ISER+   LQ EL++ R  LE ++R R+ AE E  +   +++E++    ++   KR+LE +L  +  DLD+ +N  + +E++A K   +  RLADELR EQD+ +  E LRK LE +I+E+ V+L+EAEA A + GK+A+QKL+ R+RELE + + EQRR  +AQ   RK ER+ KEL  Q+E+DR+    +QDL+DK Q K++ YKRQ+EE E+++ + + K+RKAQQ++E+AE+RAD+AE+ ++  R+         RA SV R  S   ++   R +++
Sbjct: 1164 KKREAELSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEHDRQTCHNELNQTRTACDQLGRDKAAQEKIAKQLQHTLNEVQSKLDETNRTLNDFDASKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESRERATLLGKFRNLEHDLDNLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQARLAEAEETIESLNQKCIGLEKTKQRLSTEVEDLQLEVDRANAIANAAEKKQKAFDKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKGAYEEGQEQLEAVRRENKNLADEVKDLLDQIGEGGRNIHEIEKARKRLEAEKDELQAALEEAEAALEQEENKVLRAQLELSQVRQEIDRRIQEKEEEFENTRKNHQRALDSMQASLEAE-AKGKAEALRMKKKLEADINELEIALDHANKANAEAQKNIKRYQQQLKDIQTALEEEQRARDDAREQLGISERRANALQNELEESRTLLEQADRGRRQAEQELADAHEQLNEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQKLEQRVRELENELDGEQRRHADAQKNLRKSERRVKELSFQSEEDRKNHERMQDLVDKLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAISKFRAKG-------RAGSVGRGASPAPTASKGRKSAL 1946          
BLAST of Paramyosin vs. Ensembl Fly
Match: Mhc (gene:FBgn0264695 transcript:FBtr0080906)

HSP 1 Score: 366.696 bits (940), Expect = 2.332e-106
Identity = 296/771 (38.39%), Postives = 482/771 (62.52%), Query Frame = 3
Query:  513 KKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLT----VRRSGSVMPGST 2813
            KKR+ ++ KLR+DLE AN+Q ES    LRKK+N ++ EM+ ++D L K + KAE D+     EL       D + + K + E     L+  ++ ++S  D+  R +ND + +K KLS EN +L   ++E E+Q++   KIK SL  Q++D K+  DEESR R TL G+ + L+ D D+L+ + +EE+E    L+ Q+SK NA+    + KY+ + + ++EE EE KRKL  ++ E  +       +  GLEKTKQ+L+ E++DLQ EVD   A       + K  + +  E + ++DDL+ EL++ +      +T+  RLK    E  E+   + ++N +LA+++KDL D + +  R I E+E  R +LEA++D L AA  +A+ AL+  E K       L Q++ ++++R++EK++E E+ R++ QR ++ +  ++     K K+E  R+KKK E+ I ELEI LD+ANK NA+  K+     +++ +++  LE+E+RA +   E L ISER+   LQ EL++ R  LE ++R R+ AE E  +   +++E++    ++   KR+LE +L  +  DLD+ +N  + +E++A K   +  RLADELR EQD+ +  E LRK LE +I+E+ V+L+EAEA A + GK+A+QKL+ R+RELE + + EQRR  +AQ   RK ER+ KEL  Q+E+DR+    +QDL+DK Q K++ YKRQ+EE E+++ + + K+RKAQQ++E+AE+RAD+AE+ ++      R+GSV  G++
Sbjct: 1164 KKREAELSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEHDRQTCHNELNQTRTACDQLGRDKAAQEKIAKQLQHTLNEVQSKLDETNRTLNDFDASKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESRERATLLGKFRNLEHDLDNLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQARLAEAEETIESLNQKCIGLEKTKQRLSTEVEDLQLEVDRANAIANAAEKKQKAFDKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKGAYEEGQEQLEAVRRENKNLADEVKDLLDQIGEGGRNIHEIEKARKRLEAEKDELQAALEEAEAALEQEENKVLRAQLELSQVRQEIDRRIQEKEEEFENTRKNHQRALDSMQASLEAE-AKGKAEALRMKKKLEADINELEIALDHANKANAEAQKNIKRYQQQLKDIQTALEEEQRARDDAREQLGISERRANALQNELEESRTLLEQADRGRRQAEQELADAHEQLNEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQKLEQRVRELENELDGEQRRHADAQKNLRKSERRVKELSFQSEEDRKNHERMQDLVDKLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAISKFRAKGRAGSVGRGAS 1933          
BLAST of Paramyosin vs. Ensembl Zebrafish
Match: myhz1.1 (myosin, heavy polypeptide 1.1, skeletal muscle [Source:ZFIN;Acc:ZDB-GENE-000322-5])

HSP 1 Score: 360.147 bits (923), Expect = 2.229e-104
Identity = 269/795 (33.84%), Postives = 485/795 (61.01%), Query Frame = 3
Query:  411 RSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGS 2795
            + E+  A+L+ +++ ++ R+EE         +  KKR+ + QKLR+DLE + LQ E+    LRKK   S+ E+  +ID+LQ+ + K EK+KS   ME++ +   ++ V KAK + E     LE Q+  +K+ +D+  RQ+ND+N  +++L +EN E +  ++E E  ++   + K +   Q+++LK+ ++EE + +  L   +Q  + D D L+ +++EE EA  +L+  +SK N+++A  + KY+ + + +TEE EE K+KL  ++ +  +      S+ + LEKTKQ+L  E++DL  +V+   A  A+L  + ++ + + AE +++ ++   EL   +     L+T+  ++K    E L++   L+++N +L  ++ DL + L +  + I ELE  +  +E+++  +  A  +A+  L+  E K       L Q+K++++++L EKD+E+E ++R++QR ++ +  T+    V+ +++  R+KKK E  + E+EIQL +AN+  A+  K   ++  ++ + +  L++  R  E   E +++ ER+   +Q E+++LR  LE +ER RK AE E  +   RV  L     +LIN K++LE DL  IQG++DDAV   + AE++A K   +   +A+EL++EQD     E ++K LE+ ++++  +L+EAE  A + GK+ +QKL+ R+RELE++ EAEQRR  +A    RK+ER+ KEL  Q E+D++ V  LQDL+DK QLK++AYKRQ EE E+ +   +++YRK Q ++E+A++RAD+AE  +   R+ S
Sbjct:  833 KVEKQRADLSRELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEESTLQHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSEYKMEIDDLSSNMEAVAKAKANLEKMCRTLEDQLSEIKTKSDENIRQLNDMNAQRARLQTENGEFSRQLEEKEALVSQLTRGKQAYTQQIEELKRHVEEEVKAKNALAHAVQSARHDCDLLREQFEEEQEAKAELQRGMSKANSEVAQWRTKYETDAIQRTEELEESKKKLAQRLQDAEESIEAVNSKCASLEKTKQRLQGEVEDLMIDVERANALAANLDKKQRNFDKVLAEWKQKYEEGQAELEGAQKEARSLSTEIFKMKNSYEEALDQLETLKRENKNLQQEISDLTEQLGETGKSIHELEKAKKTVESEKVEIQTALEEAEGTLEHEESKILRVQLELNQVKSEIDRKLAEKDEEIEQIKRNSQRVLDAMQSTLDSE-VRSRNDALRVKKKMEGDLNEMEIQLSHANRQAAEAQKQLRNVQGQLKDAQLHLDEAVRGQEDMKEQVAMVERRNNLMQAEIEELRAALEQTERGRKVAEQELVDASERVGLLHSQNTSLINTKKKLEADLVQIQGEVDDAVQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEVTVKDLQHRLDEAENLAMKGGKKQLQKLESRVRELESEVEAEQRRGADAVKGVRKYERRVKELTYQTEEDKKNVTRLQDLVDKLQLKVKAYKRQAEEAEEQANTHLSRYRKVQHEMEEAQERADIAESQVNKLRAKS 1626          
BLAST of Paramyosin vs. Ensembl Zebrafish
Match: myhb (myosin, heavy chain b [Source:ZFIN;Acc:ZDB-GENE-081124-1])

HSP 1 Score: 359.377 bits (921), Expect = 8.910e-104
Identity = 268/795 (33.71%), Postives = 484/795 (60.88%), Query Frame = 3
Query:  411 RSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGS 2795
            + E+  ++L  +++ ++ R+EE         +  KKR+ + QKLR+DLE + LQ E+    LRKK   S+ E+  +ID+LQ+ + K EK+KS L ME++ V   ++ V K+K + E     LE Q+   KS +D+  R +NDL+  K++L +EN E+   ++E E+ ++   + K +   Q+++LK+ ++EE + + +L   +Q  + D D L+ +Y+EE EA  +L+  +SK N+++A  + KY+ + + +TEE EE K+KL  ++ +  +      ++ + LEKTKQ+L  E++DL  +V+   A  A+L  + ++ + + AE +++ ++   EL   +     L+T+  ++K    E L+    L+++N +L  ++ DL + L +  + I ELE  +   E ++  + AA  +A+  L+  E K       L Q+K +++++L EKD+E+E ++R++QR I+ +  T+    V+ +++  R+KKK E  + E+EIQL +AN+  A+  K   ++  ++ + +  L++  RA E   E +++ ER+   +Q E+++LR  LE +ER RK AE E  +   RV+ L     +LIN K++LE DL  IQG+++D V   + AE++A K   +   +A+EL++EQD     E ++K LE+ ++++  +L+EAE+ A + GK+ +QKL+ R+RELE++ EAEQRR  +A    RK+ER+ KEL  Q E+D++ ++ LQDL+DK QLK++AYKRQ E+ E+ +   + ++RK Q ++E+A++RAD+AE  +   R+ S
Sbjct: 1133 KVEKQRSDLARELEEISERLEEAGGATSAQIEMNKKREAEFQKLRRDLEESTLQHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSELKMEVDDVSSSMEAVAKSKTNLEKMCRTLEDQLSEFKSKHDEHVRHINDLSAQKARLQTENGEMGRQLEEKESLVSQLTRSKQAYTQQIEELKRQIEEEVKAKNSLAHAVQSSRHDCDLLREQYEEEQEAKAELQRSMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEESIEAVNAKCASLEKTKQRLQNEVEDLMIDVERANALAANLDKKQRNFDKVLAEWKQKYEETQAELEGAQKEARSLSTELFKMKNSYEETLDHLETLKRENKNLQQEITDLTEQLGETGKTIHELEKGKKTAEIEKSEIQAALEEAEATLEHEESKILRVQLELNQVKGEIDRKLAEKDEEIEQIKRNSQRIIDSMQSTLDAE-VRSRNDALRIKKKMEGDLNEMEIQLSHANRQAAEAQKQLRNVQGQLKDAQLHLDEALRAQEDMKEQVAMVERRNNLMQAEIEELRVALEQTERGRKVAEQELVDASERVTLLHSQNTSLINTKKKLEADLVQIQGEMEDVVQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEVTVKDLQHRLDEAESLAMKGGKKQLQKLEARVRELESEVEAEQRRGADAVKGVRKYERRVKELTYQTEEDKKNIIRLQDLVDKLQLKVKAYKRQSEDAEEQANTHLTRFRKVQHELEEAQERADIAESQVNKLRAKS 1926          
BLAST of Paramyosin vs. Ensembl Zebrafish
Match: myhb (myosin, heavy chain b [Source:ZFIN;Acc:ZDB-GENE-081124-1])

HSP 1 Score: 359.377 bits (921), Expect = 8.910e-104
Identity = 268/795 (33.71%), Postives = 484/795 (60.88%), Query Frame = 3
Query:  411 RSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGS 2795
            + E+  ++L  +++ ++ R+EE         +  KKR+ + QKLR+DLE + LQ E+    LRKK   S+ E+  +ID+LQ+ + K EK+KS L ME++ V   ++ V K+K + E     LE Q+   KS +D+  R +NDL+  K++L +EN E+   ++E E+ ++   + K +   Q+++LK+ ++EE + + +L   +Q  + D D L+ +Y+EE EA  +L+  +SK N+++A  + KY+ + + +TEE EE K+KL  ++ +  +      ++ + LEKTKQ+L  E++DL  +V+   A  A+L  + ++ + + AE +++ ++   EL   +     L+T+  ++K    E L+    L+++N +L  ++ DL + L +  + I ELE  +   E ++  + AA  +A+  L+  E K       L Q+K +++++L EKD+E+E ++R++QR I+ +  T+    V+ +++  R+KKK E  + E+EIQL +AN+  A+  K   ++  ++ + +  L++  RA E   E +++ ER+   +Q E+++LR  LE +ER RK AE E  +   RV+ L     +LIN K++LE DL  IQG+++D V   + AE++A K   +   +A+EL++EQD     E ++K LE+ ++++  +L+EAE+ A + GK+ +QKL+ R+RELE++ EAEQRR  +A    RK+ER+ KEL  Q E+D++ ++ LQDL+DK QLK++AYKRQ E+ E+ +   + ++RK Q ++E+A++RAD+AE  +   R+ S
Sbjct: 1133 KVEKQRSDLARELEEISERLEEAGGATSAQIEMNKKREAEFQKLRRDLEESTLQHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSELKMEVDDVSSSMEAVAKSKTNLEKMCRTLEDQLSEFKSKHDEHVRHINDLSAQKARLQTENGEMGRQLEEKESLVSQLTRSKQAYTQQIEELKRQIEEEVKAKNSLAHAVQSSRHDCDLLREQYEEEQEAKAELQRSMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEESIEAVNAKCASLEKTKQRLQNEVEDLMIDVERANALAANLDKKQRNFDKVLAEWKQKYEETQAELEGAQKEARSLSTELFKMKNSYEETLDHLETLKRENKNLQQEITDLTEQLGETGKTIHELEKGKKTAEIEKSEIQAALEEAEATLEHEESKILRVQLELNQVKGEIDRKLAEKDEEIEQIKRNSQRIIDSMQSTLDAE-VRSRNDALRIKKKMEGDLNEMEIQLSHANRQAAEAQKQLRNVQGQLKDAQLHLDEALRAQEDMKEQVAMVERRNNLMQAEIEELRVALEQTERGRKVAEQELVDASERVTLLHSQNTSLINTKKKLEADLVQIQGEMEDVVQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEVTVKDLQHRLDEAESLAMKGGKKQLQKLEARVRELESEVEAEQRRGADAVKGVRKYERRVKELTYQTEEDKKNIIRLQDLVDKLQLKVKAYKRQSEDAEEQANTHLTRFRKVQHELEEAQERADIAESQVNKLRAKS 1926          
BLAST of Paramyosin vs. Ensembl Zebrafish
Match: myh7l (myosin heavy chain 7-like [Source:ZFIN;Acc:ZDB-GENE-061027-393])

HSP 1 Score: 358.607 bits (919), Expect = 2.178e-103
Identity = 285/804 (35.45%), Postives = 479/804 (59.58%), Query Frame = 3
Query:  411 RSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGS--VMPGSTY 2816
            + E+  A+L  +++ ++ R+EE         +  KKR+ + QKLR+DLE A LQ E+    LRKK   S+ E+  +ID+LQ+ + K EK+KS L +EL+ V   ++ + K+K + E     LE Q++  ++  ++ QR +ND    K+KL +EN E +  ++E E+ ++   + K+S   Q++DLK+ LDEE + +  L   LQ  + D D L+ +Y+EE EA  +L+  +SK N ++A  + KY+ + + +TEE EE K+KL  ++ E  +      ++ S LEKTK +L  EI+DL  +V+      A L  + +H + + +E +++ ++   EL S +     L+T+  +LK    E ++    ++++N  L  ++ DL + L +  + I ELE +R QLE ++  + AA  +A+ +L+  E K   T     Q+KAD+E++L EKD+E+E ++R+ QRTI+ L   +     + ++E  R+KKK E  + E+EIQL  AN+  A+  K    +   + + + +L+D  R+++   E+ +I ER+   LQ EL++LR  LE +ER RK AE E  ++  RV  L     +LIN K++LE DL   Q ++++AV   + AE++A K   +   +A+EL++EQD     E ++K +E  I+++  +L+EAE  A + GK+ VQKL+ R+RELE + EAEQ+R  E+    RK+ER+ KEL  Q E+DR+ +  LQDL+DK QLK++AYKR  EE E+ + V + K+RK Q ++++AE+RAD+AE  +   R+ S  V P   +
Sbjct: 1158 KVEKQRADLARELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEEATLQHEATAATLRKKQADSVAELGEQIDNLQRVKQKLEKEKSELRLELDDVASSMEHIVKSKTNMEKVNRTLEDQMNEYRNKCEEYQRSLNDFTTQKAKLQAENDEFSRQLEEKESLVSQLTRGKNSFSQQLEDLKRQLDEEIKAKNALAHALQSARHDTDLLREQYEEEQEAKAELQRSMSKANTEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNTAAASLDKKQRHFDKIISEWKQKYEESQCELESSQKEARSLSTELFKLKNSYEESMDHLETMKRENKILQEEISDLTEQLGEGGKTIHELEKVRKQLEQEKAEIQAALEEAEGSLEHEEGKILRTQLEFNQIKADIERKLSEKDEEMEQVKRNQQRTIDTLQSALESE-TRSRNEALRIKKKMEGDLNEMEIQLSQANRQAAEAQKQLKSVQAHLKDSQLQLDDSLRSNDDLKENTAIVERRNALLQAELEELRAVLEQTERGRKLAEQELLDVTERVQLLHSQNTSLINQKKKLETDLSQFQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIAMKGGKKQVQKLEARVRELECEVEAEQKRSSESVKGIRKYERRIKELTYQTEEDRKNIARLQDLVDKLQLKVKAYKRAAEESEEQANVHLGKFRKLQHELDEAEERADIAESQVNKLRAKSRDVGPKKAF 1960          
BLAST of Paramyosin vs. Ensembl Zebrafish
Match: myh7l (myosin heavy chain 7-like [Source:ZFIN;Acc:ZDB-GENE-061027-393])

HSP 1 Score: 357.836 bits (917), Expect = 3.518e-103
Identity = 285/804 (35.45%), Postives = 479/804 (59.58%), Query Frame = 3
Query:  411 RSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGS--VMPGSTY 2816
            + E+  A+L  +++ ++ R+EE         +  KKR+ + QKLR+DLE A LQ E+    LRKK   S+ E+  +ID+LQ+ + K EK+KS L +EL+ V   ++ + K+K + E     LE Q++  ++  ++ QR +ND    K+KL +EN E +  ++E E+ ++   + K+S   Q++DLK+ LDEE + +  L   LQ  + D D L+ +Y+EE EA  +L+  +SK N ++A  + KY+ + + +TEE EE K+KL  ++ E  +      ++ S LEKTK +L  EI+DL  +V+      A L  + +H + + +E +++ ++   EL S +     L+T+  +LK    E ++    ++++N  L  ++ DL + L +  + I ELE +R QLE ++  + AA  +A+ +L+  E K   T     Q+KAD+E++L EKD+E+E ++R+ QRTI+ L   +     + ++E  R+KKK E  + E+EIQL  AN+  A+  K    +   + + + +L+D  R+++   E+ +I ER+   LQ EL++LR  LE +ER RK AE E  ++  RV  L     +LIN K++LE DL   Q ++++AV   + AE++A K   +   +A+EL++EQD     E ++K +E  I+++  +L+EAE  A + GK+ VQKL+ R+RELE + EAEQ+R  E+    RK+ER+ KEL  Q E+DR+ +  LQDL+DK QLK++AYKR  EE E+ + V + K+RK Q ++++AE+RAD+AE  +   R+ S  V P   +
Sbjct: 1131 KVEKQRADLARELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEEATLQHEATAATLRKKQADSVAELGEQIDNLQRVKQKLEKEKSELRLELDDVASSMEHIVKSKTNMEKVNRTLEDQMNEYRNKCEEYQRSLNDFTTQKAKLQAENDEFSRQLEEKESLVSQLTRGKNSFSQQLEDLKRQLDEEIKAKNALAHALQSARHDTDLLREQYEEEQEAKAELQRSMSKANTEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNTAAASLDKKQRHFDKIISEWKQKYEESQCELESSQKEARSLSTELFKLKNSYEESMDHLETMKRENKILQEEISDLTEQLGEGGKTIHELEKVRKQLEQEKAEIQAALEEAEGSLEHEEGKILRTQLEFNQIKADIERKLSEKDEEMEQVKRNQQRTIDTLQSALESE-TRSRNEALRIKKKMEGDLNEMEIQLSQANRQAAEAQKQLKSVQAHLKDSQLQLDDSLRSNDDLKENTAIVERRNALLQAELEELRAVLEQTERGRKLAEQELLDVTERVQLLHSQNTSLINQKKKLETDLSQFQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIAMKGGKKQVQKLEARVRELECEVEAEQKRSSESVKGIRKYERRIKELTYQTEEDRKNIARLQDLVDKLQLKVKAYKRAAEESEEQANVHLGKFRKLQHELDEAEERADIAESQVNKLRAKSRDVGPKKAF 1933          
BLAST of Paramyosin vs. Ensembl Xenopus
Match: kcmf1 (potassium channel modulatory factor 1 [Source:Xenbase;Acc:XB-GENE-1021676])

HSP 1 Score: 363.614 bits (932), Expect = 4.685e-105
Identity = 265/782 (33.89%), Postives = 486/782 (62.15%), Query Frame = 3
Query:  429 AELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHL 2774
            ++L+ +++ ++ R+EE         +  KKR+ + QK+R+DLE A LQ E+    LRKK+  S+ E   +ID+LQ+ + K EK+KS L ME++ +   ++ V K+K++ E     LE Q   +K+  ++  R +ND+N  +++L +EN E    ++E E+ I+   + K +   Q ++LK+ L+EE++ +  L   LQ  + D D L+ +Y+EE EA G+L+  +SK N ++A  + KY+ + + +TEE EE K+KL  ++ E  ++     S+ + LEKTKQ+L  E++DL  +V+   A  A L  + K+ + + AE +++ ++   EL + +  +  L+T+  ++K    E L++   L+++N +L  ++ DL + + +  + + ELE  + Q+E+++ +L ++  +A+ +L+  E K       L Q+K++++++L EKD+E+E ++R++QR +E +  T+    ++ +++  RLKKK E  + E+EIQL +AN+  A+  K   ++     + +  L+D  R  +   E L++SER+   +  E++++R+ LE +ERARK AE E  ++  RV  L     +LIN K++LE D+  +Q ++++A+   + AE++A K   +   +A+EL++EQD     E ++K LE  ++++  +L+EAE  A + GK+ +QKL+ R+RELE + +AEQ+R  +A    RK+ER+ KEL  Q+E+D++ V  LQDL+DK QLK++AYKRQ EE+E+ + V ++++RKAQ ++E+AE+RAD+AE  +
Sbjct: 1137 SDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATASALRKKHADSVAEFGEQIDNLQRVKQKLEKEKSELKMEIDDLASNMESVSKSKSNLEKMCRTLEDQFSEIKTKEEEHLRVINDINAQRARLQTENGEFARQLEEKESLISQLTRGKQAFTQQTEELKRQLEEETKAKNALAHALQSSRHDCDLLREQYEEEQEAKGELQRSLSKANGEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEQIEAVNSKCASLEKTKQRLQNEVEDLMVDVERSNAACAALDKKQKNFDKVLAEWKQKFEESQAELEASQKESRSLSTEVFKMKNSYEEALDQLETLKRENKNLQQEIADLTEQIAETGKTMHELEKAKKQIESEKSDLQSSLEEAEASLEHEEAKILRIQLELTQVKSEIDRKLAEKDEEIEQIKRNSQRALESMQSTLDAE-IRSRNDALRLKKKMEGDLNEMEIQLSHANRQAAESQKQLRNVQGLYKDAQLHLDDALRGIDDLKEQLAMSERRNNLMTAEIEEMRSALEQTERARKVAEQELLDVTERVQLLHSQNTSLINTKKKLETDVSQLQSEVEEAIQESRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLAMKGGKKQLQKLEARVRELENELDAEQKRSSDAVKGVRKYERRVKELSYQSEEDKKNVFRLQDLVDKLQLKVKAYKRQSEEVEEQANVHLSRFRKAQHELEEAEERADIAESQV 1917          
BLAST of Paramyosin vs. Ensembl Xenopus
Match: kcmf1 (potassium channel modulatory factor 1 [Source:Xenbase;Acc:XB-GENE-1021676])

HSP 1 Score: 363.229 bits (931), Expect = 7.285e-105
Identity = 265/779 (34.02%), Postives = 485/779 (62.26%), Query Frame = 3
Query:  429 AELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAE 2765
            ++L+ +++ ++ R+EE         +  KKR+ + QK+R+DLE A LQ E+    LRKK+  S+ E   +ID+LQ+ + K EK+KS L ME++ +   ++ V K+K++ E     LE Q   +K+  ++  R +ND+N  +++L +EN E    ++E E+ I+   + K +   Q ++LK+ L+EE++ +  L   LQ  + D D L+ +Y+EE EA G+L+  +SK N ++A  + KY+ + + +TEE EE K+KL  ++ E  ++     S+ + LEKTKQ+L  E++DL  +V+   A  A L  + K+ + + AE +++ ++   EL + +  +  L+T+  ++K    E L++   L+++N +L  ++ DL + + +  + + ELE  + Q+E+++ +L ++  +A+ +L+  E K       L Q+K++++++L EKD+E+E ++R++QR +E +  T+    ++ +++  RLKKK E  + E+EIQL +AN+  A+  K   ++     + +  L+D  R  +   E L++SER+   +  E++++R+ LE +ERARK AE E  ++  RV  L     +LIN K++LE D+  +Q ++++A+   + AE++A K   +   +A+EL++EQD     E ++K LE  ++++  +L+EAE  A + GK+ +QKL+ R+RELE + +AEQ+R  +A    RK+ER+ KEL  Q+E+D++ V  LQDL+DK QLK++AYKRQ EE+E+ + V ++++RKAQ ++E+AE+RAD+AE
Sbjct: 1115 SDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATASALRKKHADSVAEFGEQIDNLQRVKQKLEKEKSELKMEIDDLASNMESVSKSKSNLEKMCRTLEDQFSEIKTKEEEHLRVINDINAQRARLQTENGEFARQLEEKESLISQLTRGKQAFTQQTEELKRQLEEETKAKNALAHALQSSRHDCDLLREQYEEEQEAKGELQRSLSKANGEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEQIEAVNSKCASLEKTKQRLQNEVEDLMVDVERSNAACAALDKKQKNFDKVLAEWKQKFEESQAELEASQKESRSLSTEVFKMKNSYEEALDQLETLKRENKNLQQEIADLTEQIAETGKTMHELEKAKKQIESEKSDLQSSLEEAEASLEHEEAKILRIQLELTQVKSEIDRKLAEKDEEIEQIKRNSQRALESMQSTLDAE-IRSRNDALRLKKKMEGDLNEMEIQLSHANRQAAESQKQLRNVQGLYKDAQLHLDDALRGIDDLKEQLAMSERRNNLMTAEIEEMRSALEQTERARKVAEQELLDVTERVQLLHSQNTSLINTKKKLETDVSQLQSEVEEAIQESRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLAMKGGKKQLQKLEARVRELENELDAEQKRSSDAVKGVRKYERRVKELSYQSEEDKKNVFRLQDLVDKLQLKVKAYKRQSEEVEEQANVHLSRFRKAQHELEEAEERADIAE 1892          
BLAST of Paramyosin vs. Ensembl Xenopus
Match: kcmf1 (potassium channel modulatory factor 1 [Source:Xenbase;Acc:XB-GENE-1021676])

HSP 1 Score: 363.229 bits (931), Expect = 8.240e-105
Identity = 265/782 (33.89%), Postives = 486/782 (62.15%), Query Frame = 3
Query:  429 AELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHL 2774
            ++L+ +++ ++ R+EE         +  KKR+ + QK+R+DLE A LQ E+    LRKK+  S+ E   +ID+LQ+ + K EK+KS L ME++ +   ++ V K+K++ E     LE Q   +K+  ++  R +ND+N  +++L +EN E    ++E E+ I+   + K +   Q ++LK+ L+EE++ +  L   LQ  + D D L+ +Y+EE EA G+L+  +SK N ++A  + KY+ + + +TEE EE K+KL  ++ E  ++     S+ + LEKTKQ+L  E++DL  +V+   A  A L  + K+ + + AE +++ ++   EL + +  +  L+T+  ++K    E L++   L+++N +L  ++ DL + + +  + + ELE  + Q+E+++ +L ++  +A+ +L+  E K       L Q+K++++++L EKD+E+E ++R++QR +E +  T+    ++ +++  RLKKK E  + E+EIQL +AN+  A+  K   ++     + +  L+D  R  +   E L++SER+   +  E++++R+ LE +ERARK AE E  ++  RV  L     +LIN K++LE D+  +Q ++++A+   + AE++A K   +   +A+EL++EQD     E ++K LE  ++++  +L+EAE  A + GK+ +QKL+ R+RELE + +AEQ+R  +A    RK+ER+ KEL  Q+E+D++ V  LQDL+DK QLK++AYKRQ EE+E+ + V ++++RKAQ ++E+AE+RAD+AE  +
Sbjct: 1151 SDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATASALRKKHADSVAEFGEQIDNLQRVKQKLEKEKSELKMEIDDLASNMESVSKSKSNLEKMCRTLEDQFSEIKTKEEEHLRVINDINAQRARLQTENGEFARQLEEKESLISQLTRGKQAFTQQTEELKRQLEEETKAKNALAHALQSSRHDCDLLREQYEEEQEAKGELQRSLSKANGEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEQIEAVNSKCASLEKTKQRLQNEVEDLMVDVERSNAACAALDKKQKNFDKVLAEWKQKFEESQAELEASQKESRSLSTEVFKMKNSYEEALDQLETLKRENKNLQQEIADLTEQIAETGKTMHELEKAKKQIESEKSDLQSSLEEAEASLEHEEAKILRIQLELTQVKSEIDRKLAEKDEEIEQIKRNSQRALESMQSTLDAE-IRSRNDALRLKKKMEGDLNEMEIQLSHANRQAAESQKQLRNVQGLYKDAQLHLDDALRGIDDLKEQLAMSERRNNLMTAEIEEMRSALEQTERARKVAEQELLDVTERVQLLHSQNTSLINTKKKLETDVSQLQSEVEEAIQESRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLAMKGGKKQLQKLEARVRELENELDAEQKRSSDAVKGVRKYERRVKELSYQSEEDKKNVFRLQDLVDKLQLKVKAYKRQSEEVEEQANVHLSRFRKAQHELEEAEERADIAESQV 1931          
BLAST of Paramyosin vs. Ensembl Xenopus
Match: kcmf1 (potassium channel modulatory factor 1 [Source:Xenbase;Acc:XB-GENE-1021676])

HSP 1 Score: 362.844 bits (930), Expect = 8.327e-105
Identity = 265/779 (34.02%), Postives = 485/779 (62.26%), Query Frame = 3
Query:  429 AELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAE 2765
            ++L+ +++ ++ R+EE         +  KKR+ + QK+R+DLE A LQ E+    LRKK+  S+ E   +ID+LQ+ + K EK+KS L ME++ +   ++ V K+K++ E     LE Q   +K+  ++  R +ND+N  +++L +EN E    ++E E+ I+   + K +   Q ++LK+ L+EE++ +  L   LQ  + D D L+ +Y+EE EA G+L+  +SK N ++A  + KY+ + + +TEE EE K+KL  ++ E  ++     S+ + LEKTKQ+L  E++DL  +V+   A  A L  + K+ + + AE +++ ++   EL + +  +  L+T+  ++K    E L++   L+++N +L  ++ DL + + +  + + ELE  + Q+E+++ +L ++  +A+ +L+  E K       L Q+K++++++L EKD+E+E ++R++QR +E +  T+    ++ +++  RLKKK E  + E+EIQL +AN+  A+  K   ++     + +  L+D  R  +   E L++SER+   +  E++++R+ LE +ERARK AE E  ++  RV  L     +LIN K++LE D+  +Q ++++A+   + AE++A K   +   +A+EL++EQD     E ++K LE  ++++  +L+EAE  A + GK+ +QKL+ R+RELE + +AEQ+R  +A    RK+ER+ KEL  Q+E+D++ V  LQDL+DK QLK++AYKRQ EE+E+ + V ++++RKAQ ++E+AE+RAD+AE
Sbjct: 1111 SDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATASALRKKHADSVAEFGEQIDNLQRVKQKLEKEKSELKMEIDDLASNMESVSKSKSNLEKMCRTLEDQFSEIKTKEEEHLRVINDINAQRARLQTENGEFARQLEEKESLISQLTRGKQAFTQQTEELKRQLEEETKAKNALAHALQSSRHDCDLLREQYEEEQEAKGELQRSLSKANGEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEQIEAVNSKCASLEKTKQRLQNEVEDLMVDVERSNAACAALDKKQKNFDKVLAEWKQKFEESQAELEASQKESRSLSTEVFKMKNSYEEALDQLETLKRENKNLQQEIADLTEQIAETGKTMHELEKAKKQIESEKSDLQSSLEEAEASLEHEEAKILRIQLELTQVKSEIDRKLAEKDEEIEQIKRNSQRALESMQSTLDAE-IRSRNDALRLKKKMEGDLNEMEIQLSHANRQAAESQKQLRNVQGLYKDAQLHLDDALRGIDDLKEQLAMSERRNNLMTAEIEEMRSALEQTERARKVAEQELLDVTERVQLLHSQNTSLINTKKKLETDVSQLQSEVEEAIQESRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLAMKGGKKQLQKLEARVRELENELDAEQKRSSDAVKGVRKYERRVKELSYQSEEDKKNVFRLQDLVDKLQLKVKAYKRQSEEVEEQANVHLSRFRKAQHELEEAEERADIAE 1888          
BLAST of Paramyosin vs. Ensembl Xenopus
Match: kcmf1 (potassium channel modulatory factor 1 [Source:Xenbase;Acc:XB-GENE-1021676])

HSP 1 Score: 360.533 bits (924), Expect = 4.716e-104
Identity = 260/782 (33.25%), Postives = 478/782 (61.13%), Query Frame = 3
Query:  429 AELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHL 2774
            ++L+ +++ ++ R+EE         +  KKR+ + QK+R+DLE A LQ E+    LRKK+  S+ E   +ID+LQ+ + K EK+KS L ME++ +   ++ V K+K++ E     LE Q   +K+  ++  R +ND+N  +++L +EN E    ++E E+ I+   + K +   Q ++LK+ L+EE++ +  L   LQ  + D D L+ +Y+EE EA G+L+  +SK N ++A  + KY+ + + +TEE EE K+KL  ++ E  ++     S+ + LEKTKQ+L  E++DL  +V+   A  A L  + K+ + + AE +++ ++   EL + +  +  L+T+  ++K    E L++   L+++N +L  ++ DL + + +  + + ELE  + Q+E+++ +L ++            ++ + +   L Q+K++++++L EKD+E+E ++R++QR +E +  T+    ++ +++  RLKKK E  + E+EIQL +AN+ +A+L  D+                  R  +   E L++SER+   +  E++++R+ LE +ERARK AE E  ++  RV  L     +LIN K++LE D+  +Q ++++A+   + AE++A K   +   +A+EL++EQD     E ++K LE  ++++  +L+EAE  A + GK+ +QKL+ R+RELE + +AEQ+R  +A    RK+ER+ KEL  Q+E+D++ V  LQDL+DK QLK++AYKRQ EE+E+ + V ++++RKAQ ++E+AE+RAD+AE  +
Sbjct: 1068 SDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATASALRKKHADSVAEFGEQIDNLQRVKQKLEKEKSELKMEIDDLASNMESVSKSKSNLEKMCRTLEDQFSEIKTKEEEHLRVINDINAQRARLQTENGEFARQLEEKESLISQLTRGKQAFTQQTEELKRQLEEETKAKNALAHALQSSRHDCDLLREQYEEEQEAKGELQRSLSKANGEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEQIEAVNSKCASLEKTKQRLQNEVEDLMVDVERSNAACAALDKKQKNFDKVLAEWKQKFEESQAELEASQKESRSLSTEVFKMKNSYEEALDQLETLKRENKNLQQEIADLTEQIAETGKTMHELEKAKKQIESEKSDLQSSL-----------EEAEVSRLELTQVKSEIDRKLAEKDEEIEQIKRNSQRALESMQSTLDAE-IRSRNDALRLKKKMEGDLNEMEIQLSHANRQDAQLHLDD----------------ALRGIDDLKEQLAMSERRNNLMTAEIEEMRSALEQTERARKVAEQELLDVTERVQLLHSQNTSLINTKKKLETDVSQLQSEVEEAIQESRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLAMKGGKKQLQKLEARVRELENELDAEQKRSSDAVKGVRKYERRVKELSYQSEEDKKNVFRLQDLVDKLQLKVKAYKRQSEEVEEQANVHLSRFRKAQHELEEAEERADIAESQV 1821          
BLAST of Paramyosin vs. Ensembl Mouse
Match: Myh7 (myosin, heavy polypeptide 7, cardiac muscle, beta [Source:MGI Symbol;Acc:MGI:2155600])

HSP 1 Score: 349.747 bits (896), Expect = 1.778e-100
Identity = 290/815 (35.58%), Postives = 497/815 (60.98%), Query Frame = 3
Query:  351 LESRVKELEDLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGS 2795
            L++R++ELE+ ++ ER AR + E+L ++L+ +++ ++ R+EE         +  KKR+ + QK+R+DLE A LQ E+    LRKK+  S+ E+  +ID+LQ+ + K EK+KS   +EL+ V   ++ + KAK + E     LE Q++  +S  ++ QR VNDL   ++KL +EN EL+  + E E  I+   + K +   Q++DLK+ L+EE + +  L   LQ  + D D L+ +Y+EE+EA  +L+  +SK N+++A  + KY+ + + +TEE EE K+KL  ++ +  +      ++ S LEKTK +L  EI+DL  +V+   A  A L  + ++ + + AE +++ ++   EL S +     L+T+  +LK    E LE     +++N +L  ++ DL + L    + I ELE +R QLEA++  L +A  +A+ +L+  E K         Q+KA++E++L EKD+E+E  +R+  R ++ L  ++     + ++E  R+KKK E  + E+EIQL +AN+  A+  K    L   + + + +L+D  RA++   E+++I ER+   LQ EL++LR  +E +ER+RK AE E  E   RV  L     +LIN K++++ DL  +Q ++++AV   + AE++A K   +   +A+EL++EQD     E ++K +E  I+++  +L+EAE  A + GK+ +QKL+ R+RELE + EAEQ+R  E+    RK ER+ KEL  Q E+DR+ ++ LQDL+DK QLK++AYKRQ EE E+ +   ++K+RK Q ++++AE+RAD+AE  +   R+ S
Sbjct: 1111 LQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGSTGKSIHELEKIRKQLEAEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRMVDSLQTSLDAE-TRSRNEALRVKKKMEGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKS 1924          
BLAST of Paramyosin vs. Ensembl Mouse
Match: Myh7 (myosin, heavy polypeptide 7, cardiac muscle, beta [Source:MGI Symbol;Acc:MGI:2155600])

HSP 1 Score: 349.747 bits (896), Expect = 1.778e-100
Identity = 290/815 (35.58%), Postives = 497/815 (60.98%), Query Frame = 3
Query:  351 LESRVKELEDLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGS 2795
            L++R++ELE+ ++ ER AR + E+L ++L+ +++ ++ R+EE         +  KKR+ + QK+R+DLE A LQ E+    LRKK+  S+ E+  +ID+LQ+ + K EK+KS   +EL+ V   ++ + KAK + E     LE Q++  +S  ++ QR VNDL   ++KL +EN EL+  + E E  I+   + K +   Q++DLK+ L+EE + +  L   LQ  + D D L+ +Y+EE+EA  +L+  +SK N+++A  + KY+ + + +TEE EE K+KL  ++ +  +      ++ S LEKTK +L  EI+DL  +V+   A  A L  + ++ + + AE +++ ++   EL S +     L+T+  +LK    E LE     +++N +L  ++ DL + L    + I ELE +R QLEA++  L +A  +A+ +L+  E K         Q+KA++E++L EKD+E+E  +R+  R ++ L  ++     + ++E  R+KKK E  + E+EIQL +AN+  A+  K    L   + + + +L+D  RA++   E+++I ER+   LQ EL++LR  +E +ER+RK AE E  E   RV  L     +LIN K++++ DL  +Q ++++AV   + AE++A K   +   +A+EL++EQD     E ++K +E  I+++  +L+EAE  A + GK+ +QKL+ R+RELE + EAEQ+R  E+    RK ER+ KEL  Q E+DR+ ++ LQDL+DK QLK++AYKRQ EE E+ +   ++K+RK Q ++++AE+RAD+AE  +   R+ S
Sbjct: 1111 LQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGSTGKSIHELEKIRKQLEAEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRMVDSLQTSLDAE-TRSRNEALRVKKKMEGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKS 1924          
BLAST of Paramyosin vs. Ensembl Mouse
Match: Myh13 (myosin, heavy polypeptide 13, skeletal muscle [Source:MGI Symbol;Acc:MGI:1339967])

HSP 1 Score: 347.436 bits (890), Expect = 1.226e-99
Identity = 269/825 (32.61%), Postives = 507/825 (61.45%), Query Frame = 3
Query:  342 SLRLESRVKELE-------DLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGS 2795
            SL+L+ ++KEL+       + I+ E   R + E+  ++L  +++ ++ R+EE S       +  KKR+ + QKLR+DLE A LQ E+    LRKK+  ++ E+  +ID+LQ+ + K EK+KS L ME++ +   ++ V K+K++ E    ++E Q + +K+ +D   + ++DLN  K++L ++N EL+  V+E E+ ++   K K +L  Q+++LK+ L+EE++ +  L   LQ  + D D L+ +Y+EE E   +L+  +SK N+++A  + KY+ + + +TEE EE K+KL  ++ E  +      S+ + LEKTKQ+L  E+ DL  +++      A L  + ++ + + AE ++++D+   EL + +  +  L+T+  +++    E++++   L ++N +L  ++ DL + + +  + + E+E  + Q+E ++ +L AA  + + +L+  E K       L Q+K+++++++ EKD+E+E ++R++QR   E   ++ + E++ +++  RLKKK E  + E+EIQL +AN+  A+  K    +  ++ + +  L+D +R++E   E L+I ER+   LQ EL++++  LE +ER R+ +E E  +   RV  L     +LIN K++LE DL   Q ++++++   + AE++A K   +   +A+EL++EQD     E ++K LE  ++++  +L+EAE  A + GK+ +QKL+ R+RELE++ +AEQ+R  EA   A K+ER+ KE+  QAE+DR+ ++ LQDL+DK Q K+++YKRQ EE E+ +   +++ R+ Q ++E+AE+RAD+AE  +   R+ S
Sbjct: 1105 SLQLQKKIKELQARTEELEEEIEAEHTVRAKIEKQRSDLARELEEISERLEEASGATSAQIEMNKKRESEFQKLRRDLEEATLQHEATAATLRKKHADTVAELGEQIDNLQRVKQKLEKEKSELKMEIDDMASNIETVSKSKSNMERMCRSVEDQFNEIKAKDDQQTQLIHDLNMQKARLQTQNGELSHQVEEKESLVSQLTKSKQALTQQLEELKRQLEEETKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEENTEASNSKCASLEKTKQRLQGEVDDLMLDLERANTACATLDKKQRNFDKVLAEWKQKLDESQAELEAAQKESRSLSTEIFKMRNAYEEVVDQLETLRRENKNLQEEISDLTEQIAETGKNLQEVEKTKKQVEQEKSDLQAALEEVEGSLEHEESKILRVQLELSQVKSELDRKVTEKDEEIEQIKRNSQR-AVEAMQSVLDAEIRSRNDALRLKKKMEGDLNEMEIQLSHANRQVAETQKHLRTVQGQLKDSQLHLDDAQRSNEDLKEQLAIVERRNGLLQEELEEMKVALEQTERTRRLSEQELLDSSDRVQLLHSQNTSLINTKKKLEADLAQCQAEVENSIQESRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKKQIQKLEARVRELESELDAEQKRGAEALKGAHKYERKVKEMTYQAEEDRKNILRLQDLVDKLQAKVKSYKRQAEEAEEQANTQLSRCRRVQHELEEAEERADIAESQVNKLRAKS 1928          
BLAST of Paramyosin vs. Ensembl Mouse
Match: Myh13 (myosin, heavy polypeptide 13, skeletal muscle [Source:MGI Symbol;Acc:MGI:1339967])

HSP 1 Score: 347.436 bits (890), Expect = 1.226e-99
Identity = 269/825 (32.61%), Postives = 507/825 (61.45%), Query Frame = 3
Query:  342 SLRLESRVKELE-------DLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGS 2795
            SL+L+ ++KEL+       + I+ E   R + E+  ++L  +++ ++ R+EE S       +  KKR+ + QKLR+DLE A LQ E+    LRKK+  ++ E+  +ID+LQ+ + K EK+KS L ME++ +   ++ V K+K++ E    ++E Q + +K+ +D   + ++DLN  K++L ++N EL+  V+E E+ ++   K K +L  Q+++LK+ L+EE++ +  L   LQ  + D D L+ +Y+EE E   +L+  +SK N+++A  + KY+ + + +TEE EE K+KL  ++ E  +      S+ + LEKTKQ+L  E+ DL  +++      A L  + ++ + + AE ++++D+   EL + +  +  L+T+  +++    E++++   L ++N +L  ++ DL + + +  + + E+E  + Q+E ++ +L AA  + + +L+  E K       L Q+K+++++++ EKD+E+E ++R++QR   E   ++ + E++ +++  RLKKK E  + E+EIQL +AN+  A+  K    +  ++ + +  L+D +R++E   E L+I ER+   LQ EL++++  LE +ER R+ +E E  +   RV  L     +LIN K++LE DL   Q ++++++   + AE++A K   +   +A+EL++EQD     E ++K LE  ++++  +L+EAE  A + GK+ +QKL+ R+RELE++ +AEQ+R  EA   A K+ER+ KE+  QAE+DR+ ++ LQDL+DK Q K+++YKRQ EE E+ +   +++ R+ Q ++E+AE+RAD+AE  +   R+ S
Sbjct: 1105 SLQLQKKIKELQARTEELEEEIEAEHTVRAKIEKQRSDLARELEEISERLEEASGATSAQIEMNKKRESEFQKLRRDLEEATLQHEATAATLRKKHADTVAELGEQIDNLQRVKQKLEKEKSELKMEIDDMASNIETVSKSKSNMERMCRSVEDQFNEIKAKDDQQTQLIHDLNMQKARLQTQNGELSHQVEEKESLVSQLTKSKQALTQQLEELKRQLEEETKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEENTEASNSKCASLEKTKQRLQGEVDDLMLDLERANTACATLDKKQRNFDKVLAEWKQKLDESQAELEAAQKESRSLSTEIFKMRNAYEEVVDQLETLRRENKNLQEEISDLTEQIAETGKNLQEVEKTKKQVEQEKSDLQAALEEVEGSLEHEESKILRVQLELSQVKSELDRKVTEKDEEIEQIKRNSQR-AVEAMQSVLDAEIRSRNDALRLKKKMEGDLNEMEIQLSHANRQVAETQKHLRTVQGQLKDSQLHLDDAQRSNEDLKEQLAIVERRNGLLQEELEEMKVALEQTERTRRLSEQELLDSSDRVQLLHSQNTSLINTKKKLEADLAQCQAEVENSIQESRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKKQIQKLEARVRELESELDAEQKRGAEALKGAHKYERKVKEMTYQAEEDRKNILRLQDLVDKLQAKVKSYKRQAEEAEEQANTQLSRCRRVQHELEEAEERADIAESQVNKLRAKS 1928          
BLAST of Paramyosin vs. Ensembl Mouse
Match: Myh13 (myosin, heavy polypeptide 13, skeletal muscle [Source:MGI Symbol;Acc:MGI:1339967])

HSP 1 Score: 347.436 bits (890), Expect = 1.226e-99
Identity = 269/825 (32.61%), Postives = 507/825 (61.45%), Query Frame = 3
Query:  342 SLRLESRVKELE-------DLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGS 2795
            SL+L+ ++KEL+       + I+ E   R + E+  ++L  +++ ++ R+EE S       +  KKR+ + QKLR+DLE A LQ E+    LRKK+  ++ E+  +ID+LQ+ + K EK+KS L ME++ +   ++ V K+K++ E    ++E Q + +K+ +D   + ++DLN  K++L ++N EL+  V+E E+ ++   K K +L  Q+++LK+ L+EE++ +  L   LQ  + D D L+ +Y+EE E   +L+  +SK N+++A  + KY+ + + +TEE EE K+KL  ++ E  +      S+ + LEKTKQ+L  E+ DL  +++      A L  + ++ + + AE ++++D+   EL + +  +  L+T+  +++    E++++   L ++N +L  ++ DL + + +  + + E+E  + Q+E ++ +L AA  + + +L+  E K       L Q+K+++++++ EKD+E+E ++R++QR   E   ++ + E++ +++  RLKKK E  + E+EIQL +AN+  A+  K    +  ++ + +  L+D +R++E   E L+I ER+   LQ EL++++  LE +ER R+ +E E  +   RV  L     +LIN K++LE DL   Q ++++++   + AE++A K   +   +A+EL++EQD     E ++K LE  ++++  +L+EAE  A + GK+ +QKL+ R+RELE++ +AEQ+R  EA   A K+ER+ KE+  QAE+DR+ ++ LQDL+DK Q K+++YKRQ EE E+ +   +++ R+ Q ++E+AE+RAD+AE  +   R+ S
Sbjct: 1105 SLQLQKKIKELQARTEELEEEIEAEHTVRAKIEKQRSDLARELEEISERLEEASGATSAQIEMNKKRESEFQKLRRDLEEATLQHEATAATLRKKHADTVAELGEQIDNLQRVKQKLEKEKSELKMEIDDMASNIETVSKSKSNMERMCRSVEDQFNEIKAKDDQQTQLIHDLNMQKARLQTQNGELSHQVEEKESLVSQLTKSKQALTQQLEELKRQLEEETKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEENTEASNSKCASLEKTKQRLQGEVDDLMLDLERANTACATLDKKQRNFDKVLAEWKQKLDESQAELEAAQKESRSLSTEIFKMRNAYEEVVDQLETLRRENKNLQEEISDLTEQIAETGKNLQEVEKTKKQVEQEKSDLQAALEEVEGSLEHEESKILRVQLELSQVKSELDRKVTEKDEEIEQIKRNSQR-AVEAMQSVLDAEIRSRNDALRLKKKMEGDLNEMEIQLSHANRQVAETQKHLRTVQGQLKDSQLHLDDAQRSNEDLKEQLAIVERRNGLLQEELEEMKVALEQTERTRRLSEQELLDSSDRVQLLHSQNTSLINTKKKLEADLAQCQAEVENSIQESRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKKQIQKLEARVRELESELDAEQKRGAEALKGAHKYERKVKEMTYQAEEDRKNILRLQDLVDKLQAKVKSYKRQAEEAEEQANTQLSRCRRVQHELEEAEERADIAESQVNKLRAKS 1928          
BLAST of Paramyosin vs. UniProt/SwissProt
Match: sp|Q05870|MYSP_SCHJA (Paramyosin OS=Schistosoma japonicum OX=6182 PE=2 SV=2)

HSP 1 Score: 926.776 bits (2394), Expect = 0.000e+0
Identity = 546/871 (62.69%), Postives = 720/871 (82.66%), Query Frame = 3
Query:  273 MNSNSSESHVKIVRQFYRGSSPTSLRLESRVKELEDLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGSVMPGSTYRAISVVRETSTLNSSRGARATSI 2885
            M ++ +ESHVKI R  YRG SP++ RLESRV+ELED++DLERDAR+R+ER  A+L+YQ+DAL+ R++E      Q Q+ +K+R+M+I KLRKDLE AN  LE  E  +R+++  ++ E+S E+++LQK +GKAEKDKS+L+ME+++V+G+LDG  KAK SAE+KL+ L+ Q++RLK++ DDLQRQ+ +LN AKS+L+SEN+EL  + Q+YE QI ++ K KSSLE QVDDLK++LD+ESR R  LQ QL  LQ D+D+LQA+YDEESE A  LRNQ+SK NAD+A LK K+++E+M KTEE+EE+KRKLT++I EL D A RER +A  LEK K +LT+EIKDLQ+E++ L  EN +L+ R K AE LA+ELQ+R+D+L++E+N+L S NNQL ++NMRLK+ V++L ++N+ LE++N  + +Q+K+LK +LRDANRR+ +LEALR+QLEA+RDNL++A  DA++AL+D++QKYQ++ +AL  LK++MEQRLRE+D+ELESLR+ST RTIEELT+TITE+EVKYKSE++RLKK+YES+I +LEIQLD  NK NA L K+N +L++R+ +LE  L+DERR  EA   +L I+E KR+QL  E+++LR+ +E+ ER RK+AE E +E   RVSELT+ VNTL NDKRRLEGD+GV+Q D+DDA+NA+QAAEDRA +LNNEV RLADELRQEQ+NYK AE+LRK LEIEIREITVKLEEAEA+ATREG+R VQKLQ R+RELEA+F+ E RRCK+A AQARKFERQ+KELQ QAEDDRRMV+ELQDLLDKTQ+KM+AYKRQLEE+E+VS + MNKYRKAQQQIE+AE RADMAER +TVRR G   PG   RA+SV RE S + S+RG RATS+
Sbjct:    1 MMNHDTESHVKISRTIYRGVSPSTTRLESRVRELEDILDLERDARVRAERHAADLSYQVDALSERLDEAGGSTTQTQELLKRREMEINKLRKDLENANASLELAETSMRRRHQTALNELSLEVENLQKQKGKAEKDKSHLIMEVDNVLGQLDGALKAKQSAESKLEGLDSQLNRLKTLTDDLQRQLTELNNAKSRLTSENFELLHINQDYEAQILNYSKAKSSLESQVDDLKRSLDDESRNRFNLQAQLTSLQMDYDNLQAKYDEESEEASNLRNQVSKFNADIAALKSKFERELMSKTEEFEEMKRKLTMRITELEDVAERERLKAVSLEKLKTKLTLEIKDLQSEIESLSLENGELIRRAKSAESLASELQRRVDELTIEVNTLTSQNNQLESENMRLKSLVNDLTDKNNALERENRQMNDQVKELKSSLRDANRRLTDLEALRSQLEAERDNLASALHDAEEALRDMDQKYQASQAALNHLKSEMEQRLRERDEELESLRKSTTRTIEELTVTITEMEVKYKSELSRLKKRYESSIADLEIQLDATNKANANLMKENKNLAQRVKDLETFLDDERRLREAAENNLQITEHKRIQLANEVEELRSAMENLERLRKHAETELEETQSRVSELTIQVNTLSNDKRRLEGDIGVMQADMDDAINAKQAAEDRATRLNNEVLRLADELRQEQENYKHAEALRKQLEIEIREITVKLEEAEAFATREGRRMVQKLQARVRELEAEFDGESRRCKDALAQARKFERQYKELQTQAEDDRRMVLELQDLLDKTQMKMKAYKRQLEEMEEVSQITMNKYRKAQQQIEEAEHRADMAERTVTVRRVG---PGG--RAVSVARELS-VTSNRGMRATSM 865          
BLAST of Paramyosin vs. UniProt/SwissProt
Match: sp|P06198|MYSP_SCHMA (Paramyosin OS=Schistosoma mansoni OX=6183 PE=2 SV=2)

HSP 1 Score: 909.442 bits (2349), Expect = 0.000e+0
Identity = 538/871 (61.77%), Postives = 716/871 (82.20%), Query Frame = 3
Query:  273 MNSNSSESHVKIVRQFYRGSSPTSLRLESRVKELEDLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGSVMPGSTYRAISVVRETSTLNSSRGARATSI 2885
            M ++ +ESHVKI R  YRG SP++ RLESRV+ELEDL+DLERDAR+R+ER  A+L +Q+DAL+ R++E      Q Q+ +K+R+M+I KLRKDLE AN  LE  E  +R+++  ++ E++ E+++LQK +GKAEKDKS+L+ME+++V+G+LDG  KAK SAE+KL+ L+ Q++RLKS+ DDLQRQ+ +LN AKS+L+SEN+EL  + Q+YE QI ++ K KSSLE QVDDLK++LD+E++ R  LQ QL  LQ D+D+LQA+YDEESE A  LR+Q+SK NAD+A LK K+++E+M KTEE+EE+KRK T++I EL D A RER +A  LEK K +LT+EIKDLQ+E++ L  EN++L+ R K AE LA++LQ+R+D+L++E+N+L S N+QL ++N+RLK+ V++L ++N+ LE++N  + +Q+K+LK +LRDANRR+ +LEALR+QLEA+RDNL++A  DA++AL D++QKYQ++ +AL  LK++MEQRLRE+D+ELESLR+ST RTIEELT+TITE+EVKYKSE++RLKK+YES I +LEIQLD ANK NA L K+N +LS+R+ +LE  L++ERR  EA   +L I+E KR+QL  E++++R+ LE+ ER RK+AE E +E   RVSELT+ VNTL NDKRRLEGD+GV+Q D+DDA+NA+QA+EDRA +LNNEV RLADELRQEQ NYK AE+LRK LEIEIREITVKLEEAEA ATREG+R VQKLQ R+RELE++F+ E RRCK+A AQARKFERQ+KELQ QAEDDRRMV+ELQDLLDKTQ+KM+AYKRQLEE+E+VS + MNKYRKAQQQIE+AE RADMAER +TVRR G   PG   RA+SV RE S + S+RG RATS+
Sbjct:    1 MMNHDTESHVKISRTIYRGVSPSTTRLESRVRELEDLLDLERDARVRAERHAADLGFQVDALSERLDEAGGSTTQTQELLKRREMEINKLRKDLENANASLELAETSMRRRHQTALNELALEVENLQKQKGKAEKDKSHLIMEVDNVLGQLDGALKAKQSAESKLEGLDSQLNRLKSLTDDLQRQLTELNNAKSRLTSENFELLHINQDYEAQILNYSKAKSSLESQVDDLKRSLDDEAKNRFNLQAQLTSLQMDYDNLQAKYDEESEEASNLRSQVSKFNADIAALKSKFERELMSKTEEFEEMKRKFTMRITELEDTAERERLKAVSLEKLKTKLTLEIKDLQSEIESLSLENSELIRRAKAAESLASDLQRRVDELTIEVNTLTSQNSQLESENLRLKSLVNDLTDKNNLLERENRQMNDQVKELKSSLRDANRRLTDLEALRSQLEAERDNLASALHDAEEALHDMDQKYQASQAALNHLKSEMEQRLRERDEELESLRKSTTRTIEELTVTITEMEVKYKSELSRLKKRYESNIADLEIQLDTANKANANLMKENKNLSQRVKDLETFLDEERRLREAAENNLQITEHKRLQLANEIEEIRSTLENLERLRKHAETELEEAQSRVSELTIQVNTLTNDKRRLEGDIGVMQADMDDAINAKQASEDRAIRLNNEVLRLADELRQEQGNYKHAEALRKQLEIEIREITVKLEEAEASATREGRRMVQKLQARVRELESEFDGESRRCKDALAQARKFERQYKELQTQAEDDRRMVLELQDLLDKTQMKMKAYKRQLEEMEEVSQITMNKYRKAQQQIEEAEHRADMAERTVTVRRVG---PGG--RAVSVARELS-VTSNRGMRATSM 865          
BLAST of Paramyosin vs. UniProt/SwissProt
Match: sp|P35418|MYSP_TAESO (Paramyosin OS=Taenia solium OX=6204 GN=PMY PE=1 SV=2)

HSP 1 Score: 895.96 bits (2314), Expect = 0.000e+0
Identity = 541/867 (62.40%), Postives = 716/867 (82.58%), Query Frame = 3
Query:  288 SESHVKIVRQFYRGSSPTSLRLESRVKELEDLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRS-GSVMPGSTYRAISVVRETSTLNSSRGARATSI 2885
            SESHVKI R   RG+SP+++RLESRV+ELEDL+DLERDAR+R+ER   E++ Q+D +  R++E S    Q  DAI+++DM+I KLRKDLE AN   E+ E  LR+K+N  I+E+SSE+++LQK +G+AEKDKS LM+E+++V+G+LDG  KAK SAE+KL+ L+ Q+ RLK++ DDLQRQ+ D N AKS+L++EN+EL  V QEYE Q+ +F K K++LE Q+DDLK+A+DE++R R++LQ QL  LQ D+D+LQARY+EE+EAAG LRNQ++K NAD+A LK + ++E+M KTEE+EE+KRKLT++I EL D A  ER+RA+ LEKTK +LT+EIKDLQ E + L AEN +L +R K AE LA ELQ+RID++++E+N+L S+N+ L  DNMRLK QV +L +R ++L+++N  L +QLK+ K ALRDANRR+ +LEALR+QLEA+RDNL++A  DA++ALK++E KY ++ +AL  LK++MEQRLREKD+ELE+LR+ST RTIEELT TI+E+EV++KS+++RLKKKYE+TI+ELE+QLD ANK N  L ++N  L++R+ EL+  LEDERRA EA   +L +SERKR+ L  E++++R+QLE S+RARKNAE+E  +  GR+SELTL VNTL NDKRRLEGD+GV+QGDLD+AVNAR+AAEDRA++LN EV RLADELRQEQ+NYK+AE+LRK LEIEIREITVKLEEAEA+ATREG+R VQKLQ R+RELEA+ + E RR KEA A ARK+ERQFKELQ Q+EDD+RM++ELQDLLDKTQ+KM+AYKRQLEE E+VS + M+KYRKAQQQIE+AE RADMAER +T++R+ G   PGS  RA+SVVRE +++  SRG RATSI
Sbjct:    2 SESHVKISRTIIRGTSPSTVRLESRVRELEDLLDLERDARVRAERNANEMSIQLDTMAERLDELSGTSSQTHDAIRRKDMEISKLRKDLENANAAFETAEATLRRKHNTMISEISSEVENLQKQKGRAEKDKSQLMLEIDNVLGQLDGALKAKASAESKLEGLDSQLTRLKALTDDLQRQMADANSAKSRLAAENFELVRVNQEYEAQVVTFSKTKAALESQLDDLKRAMDEDARNRLSLQTQLSSLQMDYDNLQARYEEEAEAAGNLRNQVAKFNADMAALKTRLERELMAKTEEFEELKRKLTVRITELEDMAEHERTRANNLEKTKVKLTLEIKDLQAENEALAAENGELTHRAKQAENLANELQRRIDEMTVEINTLNSANSALEADNMRLKGQVGDLTDRIANLDRENRQLGDQLKETKSALRDANRRLTDLEALRSQLEAERDNLASALHDAEEALKEMEAKYVASQNALNHLKSEMEQRLREKDEELENLRKSTTRTIEELTTTISEMEVRFKSDMSRLKKKYEATISELEVQLDVANKANVNLNRENKTLAQRVQELQAALEDERRAREAAESNLQVSERKRIALASEVEEIRSQLELSDRARKNAESELNDANGRISELTLSVNTLTNDKRRLEGDIGVMQGDLDEAVNARKAAEDRADRLNAEVLRLADELRQEQENYKRAETLRKQLEIEIREITVKLEEAEAFATREGRRMVQKLQNRVRELEAELDGEIRRAKEAFANARKYERQFKELQTQSEDDKRMILELQDLLDKTQIKMKAYKRQLEEQEEVSQLTMSKYRKAQQQIEEAEHRADMAERTITIKRTIGG--PGS--RAVSVVREINSV--SRGNRATSI 862          
BLAST of Paramyosin vs. UniProt/SwissProt
Match: sp|Q8T305|MYSP_TAESA (Paramyosin OS=Taenia saginata OX=6206 GN=PMY PE=2 SV=1)

HSP 1 Score: 894.419 bits (2310), Expect = 0.000e+0
Identity = 540/867 (62.28%), Postives = 715/867 (82.47%), Query Frame = 3
Query:  288 SESHVKIVRQFYRGSSPTSLRLESRVKELEDLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRS-GSVMPGSTYRAISVVRETSTLNSSRGARATSI 2885
            SESHVKI R   RG+SP+++RLESRV+ELEDL+DLERDAR+R+ER   E++ Q+D +  R++E S    Q  DAI+++DM+I KLRKDLE AN   E+ E  LR+K+N  I+E+SSE+++LQK +G+AEKDKS LM+E+++V+G+LDG  KAK SAE+KL+ L+ Q+ RLK++ DDLQRQ+ D N AKS+L++EN+EL    QEYE Q+ +F K K++LE Q+DDLK+A+DE++R R+ LQ QL  LQ D+D+LQARY+EE+EAAG LRNQ++K NAD+A LK + ++E+M KTEE+EE+KRKLT++I EL D A  ER+RA+ LEKTK +LT+EIKDLQ E + L AEN +L +R+K AE LA ELQ+RID++++E+N+L S+N+ L  DNMRLK QV +L +R ++L+++N  L +QLK+ K ALRDANRR+ +LEALR+QLEA+RDNL++A  DA++ALK++E KY ++ +AL  LK++MEQRLREKD+ELE+LR+ST RTIEELT TI+E+EV++KS+++RLKKKYE+TI+ELE+QLD ANK NA L ++N  L++R+ EL+  LEDERRA EA   +L +SERKR+ L  E++++R+QLE S+RARKNAE+E  +  GR+SELTL VNTL NDKRRLEGD+GV+QGDLD+AVNAR+AAEDRA++LN EV RLADELRQEQ+NY +AE+LRK LEIEIREITVKLEEAEA+ATREG+R VQKLQ R+RELEA+ + E RR KEA A ARK+ERQFKELQ Q+EDD+RM++ELQDLLDKTQ+KM+AYKRQLEE E+VS + M+KYRKAQQQIE+AE RADMAER +T++R+ G   PGS  RA+SVVRE +++  SRG RATSI
Sbjct:    2 SESHVKISRTIIRGTSPSTVRLESRVRELEDLLDLERDARVRAERNANEMSIQLDTMAERLDELSGTSSQTHDAIRRKDMEISKLRKDLENANAAFETAEATLRRKHNTMISEISSEVENLQKQKGRAEKDKSQLMLEIDNVLGQLDGALKAKASAESKLEGLDSQLTRLKALTDDLQRQMADANSAKSRLAAENFELVRANQEYEAQVVTFSKTKAALESQLDDLKRAMDEDARNRLNLQTQLSSLQMDYDNLQARYEEEAEAAGNLRNQVAKFNADMAALKTRLERELMAKTEEFEELKRKLTVRITELEDMAEHERTRANNLEKTKVKLTLEIKDLQAENEALAAENGELTHRVKQAENLANELQRRIDEMTVEINTLNSANSALEADNMRLKGQVGDLTDRIANLDRENRQLGDQLKETKSALRDANRRLTDLEALRSQLEAERDNLASALHDAEEALKEMEAKYVASQNALNHLKSEMEQRLREKDEELENLRKSTTRTIEELTTTISEMEVRFKSDMSRLKKKYEATISELEVQLDVANKANANLNRENKTLAQRVQELQAALEDERRAREAAESNLQVSERKRIALASEVEEIRSQLELSDRARKNAESELNDANGRISELTLSVNTLTNDKRRLEGDIGVMQGDLDEAVNARKAAEDRADRLNAEVLRLADELRQEQENYXRAETLRKQLEIEIREITVKLEEAEAFATREGRRMVQKLQNRVRELEAELDGEIRRAKEAFANARKYERQFKELQTQSEDDKRMILELQDLLDKTQIKMKAYKRQLEEQEEVSQLTMSKYRKAQQQIEEAEHRADMAERTITIKRTIGG--PGS--RAVSVVREINSV--SRGNRATSI 862          
BLAST of Paramyosin vs. UniProt/SwissProt
Match: sp|P35417|MYSP_ECHGR (Paramyosin OS=Echinococcus granulosus OX=6210 PE=2 SV=1)

HSP 1 Score: 892.108 bits (2304), Expect = 0.000e+0
Identity = 544/867 (62.75%), Postives = 714/867 (82.35%), Query Frame = 3
Query:  288 SESHVKIVRQFYRGSSPTSLRLESRVKELEDLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRS-GSVMPGSTYRAISVVRETSTLNSSRGARATSI 2885
            SESHVKI R   RG+SP+++RLES V+ELEDL+DLERDAR+RSER   EL+ Q+D +  R++E S    Q QDAI+++DM+I  +RKDLE AN   E+ E  LR+K+N  I+E+SSE+++LQK +G+AEKDKS LM+E+++V+G+LDG  KAK SAE+KL+ L+ Q+ RLK++ DDLQRQ+ D+N AKS+L++EN+EL  V QEYE Q+ +F K KS LE Q+DDLK+A+DE++R R+ LQ QL  LQ D+D+LQARY+EE+EAAG LRNQ++K NAD+A LK + ++E+M KTEE+EE+KRKLT++I EL D A  ER+RA+ LEKTK +LTIEIKDLQ E + L AEN +L +R K AE LA ELQ+R+D++++E+N+L S+NN L  DNMRLK QV +L +R ++L+++N  L +QLK+ K ALRDANRR+ +LEALR+QLEAD DNL++A  DA++ALK+LE KY ++ +AL  LK++MEQRLREKD+ELE+LR+ST RTIEELT TI+E+EV++KS+++RLKKKYE+TI+ELE+QLD ANK NA L ++N  L++R+ EL+  LEDERRA EA   +L +SERKR+ L  E++++R+QLE S+RARKNAE+E  +  GR+SELT+ VNTL NDKRRLEGD+GV+QGDLD+AVNAR+AAEDRA++LN EV RLADELRQEQ+NYK+AE+LRK LEIEIREITVKLEEAEA+ATREG+R VQKLQ R+RELEA+ + E RR KEA A ARK+ERQFKELQ Q+EDD+RM++ELQDLLDKTQ+KM+AYKRQLEE E+VS + M+KYRKAQQQIE+AE RADMAER +T++R+ G   PGS  RA+SVVRE +++  SRG RATSI
Sbjct:    2 SESHVKISRTIIRGTSPSTVRLESPVRELEDLLDLERDARVRSERNANELSIQLDTMTERLDELSGTSSQTQDAIRRKDMEIANVRKDLENANAAFETAEATLRRKHNTMISEISSEVENLQKQKGRAEKDKSQLMLEIDNVLGQLDGALKAKASAESKLEGLDSQLTRLKALTDDLQRQMADVNSAKSRLAAENFELVRVNQEYEAQVVNFSKTKSVLEGQLDDLKRAMDEDARNRLNLQTQLSSLQMDYDNLQARYEEEAEAAGNLRNQVAKFNADMAALKTRLERELMAKTEEFEELKRKLTVRITELEDIAEHERTRANNLEKTKVKLTIEIKDLQAENEALAAENGELTHRAKQAENLANELQRRVDEMTVEINTLNSANNALEGDNMRLKGQVGDLTDRIANLDRENRQLGDQLKETKSALRDANRRLTDLEALRSQLEADGDNLASALHDAEEALKELEVKYVASQNALNHLKSEMEQRLREKDEELENLRKSTTRTIEELTTTISEMEVRFKSDMSRLKKKYEATISELEVQLDVANKANASLNRENKALAQRVQELQTALEDERRAREAAESNLQVSERKRIALTSEVEEIRSQLELSDRARKNAESELNDANGRISELTMSVNTLTNDKRRLEGDIGVMQGDLDEAVNARKAAEDRADRLNAEVLRLADELRQEQENYKRAETLRKQLEIEIREITVKLEEAEAFATREGRRMVQKLQNRVRELEAELDGEIRRAKEAFASARKYERQFKELQTQSEDDKRMILELQDLLDKTQIKMKAYKRQLEEQEEVSQLTMSKYRKAQQQIEEAEHRADMAERTITIKRTIGG--PGS--RAVSVVREINSV--SRGNRATSI 862          
BLAST of Paramyosin vs. TrEMBL
Match: A0A4Z2CSX2 (Paramyosin isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_007839 PE=4 SV=1)

HSP 1 Score: 927.546 bits (2396), Expect = 0.000e+0
Identity = 547/871 (62.80%), Postives = 720/871 (82.66%), Query Frame = 3
Query:  273 MNSNSSESHVKIVRQFYRGSSPTSLRLESRVKELEDLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGSVMPGSTYRAISVVRETSTLNSSRGARATSI 2885
            M ++ SESHVKI R  YRG SP++ RLESRV+ELED++DLERDAR+R+ER  A+L+YQ+DAL+ R++E      Q Q+ +K+R+M+I KLRKDLE AN  LE  E  +R+++  ++ E+S E+++LQK +GKAEKDKS+L+ME+++V+G+LDG  KAK SAE+KL+ L+ Q++RLK++ DDLQRQ+ +LN AKS+L+SEN+EL  + Q+YE QI ++ K KSSLE QVDDLK++LD+ESR R  LQ QL  LQ D+D+LQA+YDEESE A  LRNQ+SK NAD+A LK K+++E+M KTEE+EE+KRKLT++I EL D A RER +A  LEK K +LT+EIKDLQ+E++ L  EN +L+ R K AE LA+ELQ+R+D+L++E+N+L S NNQL ++NMRLK+ V++L ++N+ LE++N  + +Q+K+LK +LRDANRR+ +LEALR+QLEA+RDNL++A  DA++AL+D++QKYQ++ +AL  LK++MEQRLRE+D+ELESLR+ST RTIEELT+TITE+EVKYKSE++RLKK+YES+I +LEIQLD  NK NA L K+N +L++R+ +LE  L+DERR  EA   +L I+E KR+QL  E+++LR+ +E+ ER RK+AE E +E   RVSELT+ VNTL NDKRRLEGD+GV+Q D+DDA+NA+QAAEDRA +LNNEV RLADELRQEQ+NYK AE+LRK LEIEIREITVKLEEAEA+ATREG+R VQKLQ R+RELEA+F+ E RRCK+A AQARKFERQ+KELQ QAEDDRRMV+ELQDLLDKTQ+KM+AYKRQLEE+E+VS + MNKYRKAQQQIE+AE RADMAER +TVRR G   PG   RA+SV RE S + S+RG RATS+
Sbjct:    1 MMNHDSESHVKISRTIYRGVSPSTTRLESRVRELEDILDLERDARVRAERHAADLSYQVDALSERLDEAGGSTTQTQELLKRREMEINKLRKDLENANASLELAETSMRRRHQTALNELSLEVENLQKQKGKAEKDKSHLIMEVDNVLGQLDGALKAKQSAESKLEGLDSQLNRLKTLTDDLQRQLTELNNAKSRLTSENFELLHINQDYEAQILNYSKAKSSLESQVDDLKRSLDDESRNRFNLQAQLTSLQMDYDNLQAKYDEESEEASNLRNQVSKFNADIAALKSKFERELMSKTEEFEEMKRKLTMRITELEDVAERERLKAVSLEKLKTKLTLEIKDLQSEIESLSLENGELIRRAKSAESLASELQRRVDELTIEVNTLTSQNNQLESENMRLKSLVNDLTDKNNALERENRQMNDQVKELKSSLRDANRRLTDLEALRSQLEAERDNLASALHDAEEALRDMDQKYQASQAALNHLKSEMEQRLRERDEELESLRKSTTRTIEELTVTITEMEVKYKSELSRLKKRYESSIADLEIQLDATNKANANLMKENKNLAQRVKDLETFLDDERRLREAAENNLQITEHKRIQLANEVEELRSAMENLERLRKHAETELEETQSRVSELTIQVNTLSNDKRRLEGDIGVMQADMDDAINAKQAAEDRATRLNNEVLRLADELRQEQENYKHAEALRKQLEIEIREITVKLEEAEAFATREGRRMVQKLQARVRELEAEFDGESRRCKDALAQARKFERQYKELQTQAEDDRRMVLELQDLLDKTQMKMKAYKRQLEEMEEVSQITMNKYRKAQQQIEEAEHRADMAERTVTVRRVG---PGG--RAVSVARELS-VTSNRGMRATSM 865          
BLAST of Paramyosin vs. TrEMBL
Match: B1PS36 (Paramyosin OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 926.006 bits (2392), Expect = 0.000e+0
Identity = 546/871 (62.69%), Postives = 719/871 (82.55%), Query Frame = 3
Query:  273 MNSNSSESHVKIVRQFYRGSSPTSLRLESRVKELEDLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGSVMPGSTYRAISVVRETSTLNSSRGARATSI 2885
            M ++ +ESHVKI R  YRG SP++ RLESRV+ELED++DLERDAR+R+ER  A+L+YQ+DAL+ R++E      Q Q+ +K+R+M+I KLRKDLE AN  LE  E  +R+++  ++ E+S E+++LQK +GKAEKDKS+L+ME+++V+G+LDG  KAK SAE+KL+ L+ Q++RLK++ DDLQRQ+ +LN AKS+L+SEN+EL  + Q+YE QI ++ K KSSLE QVDDLK++LD+ESR R  LQ QL  LQ D+D+LQA+YDEESE A  LRNQ+SK NAD+A LK K+++E+M KTEE+EE+KRKLT++I EL D A RER +A  LEK K +LT+EIKDLQ+E++ L  EN +L+ R K AE LA+ELQ+R+D+L++E+N+L S NNQL ++NMRLK+ V++L ++N+ LE++N  + +Q+K+LK +LRDANRR+ +LEALR+QLEA+RDNL++A  DA++AL+D++QKYQ++ +AL  LK++MEQRLRE+D+ELESLR+ST RTIEELT+TITE+EVKYKSE++RLKK+YES+I +LEIQLD  NK NA L K+N +L++R+ +LE  L+DERR  EA   +L I+E KR+QL  E+++LR+ +E+ ER RK+AE E +E   RVSELT+ VNTL NDKRRLEGD+GV+Q D+DDA+NA+QAAEDRA +LNNEV RLADELRQEQ+NYK AE+LRK LEIEIREITVKLEEAEA+ATREG+R VQKLQ R+RELEA+F+ E RRCK+A AQARKFERQ+KELQ QAEDDRRMV+ELQDLLDKTQ KM+AYKRQLEE+E+VS + MNKYRKAQQQIE+AE RADMAER +TVRR G   PG   RA+SV RE S + S+RG RATS+
Sbjct:    1 MMNHDTESHVKISRTIYRGVSPSTTRLESRVRELEDILDLERDARVRAERHAADLSYQVDALSERLDEAGGSTTQTQELLKRREMEINKLRKDLENANASLELAETSMRRRHQTALNELSLEVENLQKQKGKAEKDKSHLIMEVDNVLGQLDGALKAKQSAESKLEGLDSQLNRLKTLTDDLQRQLTELNNAKSRLTSENFELLHINQDYEAQILNYSKAKSSLESQVDDLKRSLDDESRNRFNLQAQLTSLQMDYDNLQAKYDEESEEASNLRNQVSKFNADIAALKSKFERELMSKTEEFEEMKRKLTMRITELEDVAERERLKAVSLEKLKTKLTLEIKDLQSEIESLSLENGELIRRAKSAESLASELQRRVDELTIEVNTLTSQNNQLESENMRLKSLVNDLTDKNNALERENRQMNDQVKELKSSLRDANRRLTDLEALRSQLEAERDNLASALHDAEEALRDMDQKYQASQAALNHLKSEMEQRLRERDEELESLRKSTTRTIEELTVTITEMEVKYKSELSRLKKRYESSIADLEIQLDATNKANANLMKENKNLAQRVKDLETFLDDERRLREAAENNLQITEHKRIQLANEVEELRSAMENLERLRKHAETELEETQSRVSELTIQVNTLSNDKRRLEGDIGVMQADMDDAINAKQAAEDRATRLNNEVLRLADELRQEQENYKHAEALRKQLEIEIREITVKLEEAEAFATREGRRMVQKLQARVRELEAEFDGESRRCKDALAQARKFERQYKELQTQAEDDRRMVLELQDLLDKTQTKMKAYKRQLEEMEEVSQITMNKYRKAQQQIEEAEHRADMAERTVTVRRVG---PGG--RAVSVARELS-VTSNRGMRATSM 865          
BLAST of Paramyosin vs. TrEMBL
Match: B1PS35 (Paramyosin OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 922.924 bits (2384), Expect = 0.000e+0
Identity = 545/871 (62.57%), Postives = 719/871 (82.55%), Query Frame = 3
Query:  273 MNSNSSESHVKIVRQFYRGSSPTSLRLESRVKELEDLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGSVMPGSTYRAISVVRETSTLNSSRGARATSI 2885
            M ++ +ESHVKI R  YRG SP++ RLESRV+ELED++DLERDAR+R+ER  A+L+YQ+DAL+ R++E      Q Q+ +K+R+M+I KLRKDLE AN  LE  E  +R+++  ++ E+S E+++LQK +GKAEKDKS+L+ME+++V+G+LDG  KAK SAE+KL+ L+ Q++RLK++ DDLQRQ+ +LN AKS+L+SEN+EL  + Q+YE QI ++ K KSSLE QVDDLK++LD+ESR R  LQ QL  LQ D+D+LQA+YDEESE A  LRNQ+SK NAD+A LK K+++E+M KTEE+EE+KRKLT++I EL D A RER +A  LEK K +LT+EIKDLQ+E++ L  EN +L+ R K AE LA+ELQ+R+D+L++E+N+L S NNQL ++NMRLK+ V++L ++N+ LE++N  + +Q+K+LK +LRDANRR+ +LEALR+QLEA+RDNL++A  DA++AL+D++QKYQ++ +AL  LK++MEQRLRE+D+ELESLR+ST RTIEELT+TITE+EVKYKSE++RLKK+YES+I +LEIQLD  NK NA L K+N +L++R+ +LE  L+DERR  EA   +L I+E KR+QL  E+++LR+ +E+ ER RK+AE E +E   RVSELT+ VNTL NDKRRLEGD+GV+Q D+DDA+NA+QAAEDRA +LNNEV RLADELRQEQ+NYK AE+LRK LEIEIREITVKLEEAEA+ATREG+R VQKL  R+RELEA+F+ E RRCK+A AQARKFERQ+KELQ QAEDDRRMV+ELQDLLDKTQ+KM+AYKRQLEE+E+VS + MNKYRKAQQQIE+AE RADMAER +TVRR G   PG   RA+SV RE S + S+RG RATS+
Sbjct:    1 MMNHDTESHVKISRTIYRGVSPSTTRLESRVRELEDILDLERDARVRAERHAADLSYQVDALSERLDEAGGSTTQTQELLKRREMEINKLRKDLENANASLELAETSMRRRHQTALNELSLEVENLQKQKGKAEKDKSHLIMEVDNVLGQLDGALKAKQSAESKLEGLDSQLNRLKTLTDDLQRQLTELNNAKSRLTSENFELLHINQDYEAQILNYSKAKSSLESQVDDLKRSLDDESRNRFNLQAQLTSLQMDYDNLQAKYDEESEEASNLRNQVSKFNADIATLKSKFERELMSKTEEFEEMKRKLTMRITELEDVAERERLKAVSLEKLKTKLTLEIKDLQSEIESLSLENGELIRRAKSAESLASELQRRVDELTIEVNTLTSQNNQLESENMRLKSLVNDLTDKNNALERENRQMNDQVKELKSSLRDANRRLTDLEALRSQLEAERDNLASALHDAEEALRDMDQKYQASQAALNHLKSEMEQRLRERDEELESLRKSTTRTIEELTVTITEMEVKYKSELSRLKKRYESSIADLEIQLDATNKANANLMKENKNLAQRVKDLETFLDDERRLREAAENNLQITEHKRIQLANEVEELRSAMENLERLRKHAETELEETQSRVSELTIQVNTLSNDKRRLEGDIGVMQADMDDAINAKQAAEDRATRLNNEVLRLADELRQEQENYKHAEALRKQLEIEIREITVKLEEAEAFATREGRRMVQKLLARVRELEAEFDGESRRCKDALAQARKFERQYKELQTQAEDDRRMVLELQDLLDKTQMKMKAYKRQLEEMEEVSQITMNKYRKAQQQIEEAEHRADMAERTVTVRRVG---PGG--RAVSVARELS-VTSNRGMRATSM 865          
BLAST of Paramyosin vs. TrEMBL
Match: A0A2H1CQG2 (Myosin tail OS=Fasciola hepatica OX=6192 GN=D915_001853 PE=4 SV=1)

HSP 1 Score: 921.768 bits (2381), Expect = 0.000e+0
Identity = 548/871 (62.92%), Postives = 715/871 (82.09%), Query Frame = 3
Query:  273 MNSNSSESHVKIVRQFYRGSSPTSLRLESRVKELEDLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGSVMPGSTYRAISVVRETSTLNSSRGARATSI 2885
            MN + SESHVKI R  YRG SP++ RLE RV+ELED++DLERDAR+R+ER  A++++QIDAL+ R++E      Q  + +K+R+M+I KLRKDLE AN  LE  E  +R+++  ++ E++SE+++LQK +GKAEKDK++L+ME+++V+G+LDG  KAK SAE+KL+ L+ Q+ RLKS+ DDLQRQ+ DLN AKS+L+SEN+EL  V QEYE Q+ +  K KS+LE  VDDLK++LD+E++ R  LQ QL  LQ D+D+LQA+YDEESE A  LRNQ+SK NAD+A LK K+++E+M KTEEYEE+KRKLT++I+EL D A RER+RA+ LEK K +LTIEIKDLQ EVD L AENA+L +R K AE LA ELQ+R+D+L++E+N+L S N+ L  +NMRLK+QV++L ++ ++L+++N  L++Q+K+LK ALRDANRR+ +LEALR+QLEA+RDNL++A  DA++AL +++QKYQ++ +AL  LK++MEQRLREKDDELE+LR+ST RTIEELT+TITE+EVKYKSE++RLKK+YE+ I ELE+QLD ANK NA L K+N  L++R+ +LE  L++ERR  EA   +L  SERKR+QL  E+++LR  LE+S+RARK+AENE  E   RVSELT+ VNTL NDKRRLEGD+GV+Q D+D+AVNA+QAAEDRA +LN EV RLADELRQEQ+NYK AE+LRK LE+EIREITVKLEEAEA++ REG+R VQKLQ R+RELEA+F+ E RRCKEA A ARKFERQ++ELQ QAEDDRRMV+ELQDLLDKTQ+KM+AYKRQL+E E+VS + MNKYRKAQQQIE+AE RADMAER +TVRR G   PG   RA SVVRE S + +SRGARATS+
Sbjct:    1 MN-HESESHVKISRTIYRGVSPSTTRLEGRVRELEDMLDLERDARVRAERHAADMSFQIDALSERLDEAGGNSSQTHELLKRREMEINKLRKDLENANAALEMAETSMRRRHQNALNELASEVENLQKQKGKAEKDKNSLIMEVDNVLGQLDGALKAKQSAESKLEGLDSQLSRLKSLTDDLQRQLTDLNAAKSRLTSENFELLHVNQEYEAQVLNLSKAKSALESNVDDLKRSLDDEAKNRFNLQAQLTSLQMDYDNLQAKYDEESEEASSLRNQVSKFNADMAALKSKFERELMSKTEEYEELKRKLTLRISELEDMAERERARAANLEKIKTKLTIEIKDLQAEVDNLSAENAELAHRAKAAENLANELQRRVDELTIEVNNLHSQNSALEAENMRLKSQVNDLTDKIANLDRENRQLSDQVKELKSALRDANRRLTDLEALRSQLEAERDNLASALHDAEEALHEMDQKYQASQAALNHLKSEMEQRLREKDDELEALRKSTTRTIEELTVTITEMEVKYKSELSRLKKRYEANIAELEMQLDVANKANANLMKENKTLAQRVKDLETFLDEERRLREAAEGNLQASERKRIQLASEVEELRGALEASDRARKHAENEMTEAQSRVSELTMQVNTLTNDKRRLEGDIGVMQADMDEAVNAKQAAEDRATRLNTEVLRLADELRQEQENYKHAEALRKQLEVEIREITVKLEEAEAFSAREGRRMVQKLQARVRELEAEFDGESRRCKEALASARKFERQYRELQTQAEDDRRMVLELQDLLDKTQIKMKAYKRQLDEAEEVSQITMNKYRKAQQQIEEAEHRADMAERTVTVRRVG---PGG--RAGSVVREMSVV-TSRGARATSM 864          
BLAST of Paramyosin vs. TrEMBL
Match: A0A504Z290 (Paramyosin OS=Fasciola gigantica OX=46835 GN=FGIG_02459 PE=4 SV=1)

HSP 1 Score: 920.228 bits (2377), Expect = 0.000e+0
Identity = 548/871 (62.92%), Postives = 714/871 (81.97%), Query Frame = 3
Query:  273 MNSNSSESHVKIVRQFYRGSSPTSLRLESRVKELEDLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGSVMPGSTYRAISVVRETSTLNSSRGARATSI 2885
            MN + SESHVKI R  YRG SP++ RLE RV+ELED++DLERDAR+R+ER  A++++QIDAL+ R++E      Q  + +K+R+M+I KLRKDLE AN  LE  E  +R+++  ++ E++SE+++LQK +GKAEKDK++L+ME+++V+G+LDG  KAK SAE+KL+ L+ Q+ RLKS+ DDLQRQ+ DLN AKS+L+SEN+EL  V QEYE Q+ +  K KS+LE  VDDLK++LD+E++ R  LQ QL  LQ D+D+LQA+YDEESE A  LRNQ+SK NAD+A LK K+++E+M KTEEYEE+KRKLT++I EL D A RER+RA+ LEK K +LTIEIKDLQ EVD L AENA+L +R K AE LA ELQ+R+D+L++E+N+L S N+ L  +NMRLK+QV++L ++ ++L+++N  L++Q+K+LK ALRDANRR+ +LEALR+QLEA+RDNL++A  DA++AL +++QKYQ++ +AL  LK++MEQRLREKDDELE+LR+ST RTIEELT+TITE+EVKYKSE++RLKK+YE+ I ELE+QLD ANK NA L K+N  L++R+ +LE  L++ERR  EA   +L  SERKR+QL  E+++LR  LE+S+RARK+AENE  E   RVSELT+ VNTL NDKRRLEGD+GV+Q D+D+AVNA+QAAEDRA +LN EV RLADELRQEQ+NYK AE+LRK LE+EIREITVKLEEAEA++ REG+R VQKLQ R+RELEA+F+ E RRCKEA A ARKFERQ++ELQ QAEDDRRMV+ELQDLLDKTQ+KM+AYKRQL+E E+VS + MNKYRKAQQQIE+AE RADMAER +TVRR G   PG   RA SVVRE S + +SRGARATS+
Sbjct:    1 MN-HESESHVKISRTIYRGVSPSTTRLEGRVRELEDMLDLERDARVRAERHAADMSFQIDALSERLDEAGGNSSQTHELLKRREMEINKLRKDLENANAALEMAETSMRRRHQNALNELASEVENLQKQKGKAEKDKNSLIMEVDNVLGQLDGALKAKQSAESKLEGLDNQLSRLKSLTDDLQRQLTDLNAAKSRLTSENFELLHVNQEYEAQVLNLSKAKSALESNVDDLKRSLDDEAKNRFNLQAQLTSLQMDYDNLQAKYDEESEEASNLRNQVSKFNADMAALKSKFERELMSKTEEYEELKRKLTLRITELEDMAERERARAANLEKIKTKLTIEIKDLQAEVDNLSAENAELAHRAKAAENLANELQRRVDELTIEVNNLHSQNSALEAENMRLKSQVNDLTDKIANLDRENRQLSDQVKELKSALRDANRRLTDLEALRSQLEAERDNLASALHDAEEALHEMDQKYQASQAALNHLKSEMEQRLREKDDELEALRKSTTRTIEELTVTITEMEVKYKSELSRLKKRYEANIAELEMQLDVANKANANLMKENKTLAQRVKDLETFLDEERRLREAAEGNLQASERKRIQLASEVEELRGALEASDRARKHAENEMTEAQSRVSELTMQVNTLTNDKRRLEGDIGVMQADMDEAVNAKQAAEDRATRLNTEVLRLADELRQEQENYKHAEALRKQLEVEIREITVKLEEAEAFSAREGRRMVQKLQARVRELEAEFDGESRRCKEALASARKFERQYRELQTQAEDDRRMVLELQDLLDKTQIKMKAYKRQLDEAEEVSQITMNKYRKAQQQIEEAEHRADMAERTVTVRRVG---PGG--RAGSVVREMSVV-TSRGARATSM 864          
BLAST of Paramyosin vs. Ensembl Cavefish
Match: ENSAMXT00000039595.1 (myosin heavy chain, fast skeletal muscle-like [Source:NCBI gene;Acc:103043084])

HSP 1 Score: 362.459 bits (929), Expect = 7.607e-105
Identity = 275/795 (34.59%), Postives = 483/795 (60.75%), Query Frame = 3
Query:  411 RSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGS 2795
            + E+  A+L+ +++ ++ R+EE         +  KKR+ + QKLR+DLE + LQ E+    LRKK   S+ E+  +ID+LQ+ + K EK+KS   ME++ +   ++ V KAK + E     LE Q+  +KS ND+  RQ+NDL+  K++L +EN E    ++E E+ ++   + K +   Q+D+LK+ ++EE + +  L   LQ  + D D L+ +++EE EA  +L+  +SK N+++A  + KY+ + + +TEE EE K+KL  ++ E  ++     S+ + LEKTKQ+L  E++DL  +V+   A  A+L  + ++ + + AE +++ ++   EL   +     L+T+  ++K    E L++   L+++N +L  ++ DL + + +  + I ELE  +  +E ++  +  A  +A+  L+  E K       L Q+K++++++L EKD+E+E ++R++QR IE +  T+    V+ +++  R+KKK E  + E+EIQL +AN+  ++  K   ++  ++ + +  L+D  R  E   E +++ ER+   +  E+++LR  LE +ER RK AE E  +   RV+ L     +L+N K++LE DL  +QG++DD V   + AED+A K   +   +A+EL++EQD     E ++K LE+ ++++  +L+EAE  A + GK+ +QKL+ R+RELEA+ EAEQRR  +A    RK+ER+ KEL  Q E+D++ +  LQDL+DK QLK++AYKRQ EE E+ +   ++K RKAQ  +E+AE+RAD+AE  +   R+ S
Sbjct: 1130 KVEKQRADLSRELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEESTLQHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSEYKMEIDDLSSNMEAVAKAKANLEKMCRTLEDQLSEIKSKNDENVRQINDLSAQKARLQTENGEFGRQLEEKESLVSQLTRGKQAFTQQIDELKRQIEEEVKAKNALAHGLQSARHDCDLLREQFEEEQEAKAELQRSMSKANSEVAQWRSKYETDAIQRTEELEEAKKKLAQRLQEAEEQIEAVNSKCASLEKTKQRLQGEVEDLMIDVERANALAANLDKKQRNFDKVLAEWKQKFEEGQAELEGAQKEARGLSTELFKMKNSYEEALDQLETLKRENKNLQQEISDLTEQIGETGKSIHELEKAKKTVETEKAEIQTALEEAEGTLEHEESKILRVQLELNQVKSEVDRKLAEKDEEMEQIKRNSQRVIESMQSTLDSE-VRSRNDALRIKKKMEGDLNEMEIQLSHANRQASEAQKQLRNVQGQLKDAQLHLDDAVRGQEDMKEQVAMVERRNTLMLAEIEELRAALEQTERGRKVAEQELVDASERVALLHSQNTSLLNTKKKLEADLVQVQGEVDDTVQEARNAEDKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEVTVKDLQHRLDEAENLAMKGGKKQLQKLESRVRELEAEVEAEQRRGVDAVKGVRKYERRVKELTYQTEEDKKNLTRLQDLVDKLQLKVKAYKRQAEEAEEQANGHLSKLRKAQHDLEEAEERADIAESQVNKLRAKS 1923          
BLAST of Paramyosin vs. Ensembl Cavefish
Match: ENSAMXT00000036333.1 (myosin heavy chain, fast skeletal muscle-like [Source:NCBI gene;Acc:103043387])

HSP 1 Score: 362.073 bits (928), Expect = 1.166e-104
Identity = 278/816 (34.07%), Postives = 489/816 (59.93%), Query Frame = 3
Query:  411 RSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLT-----VRRSGSVMPGSTYRAISVVRET 2843
            + E+  A+L+ +++ ++ R+EE         +  KKR+ + QKLR+DLE + LQ E+    LRKK   S+ E+  +ID+LQ+ + K EK+KS   ME++ +   ++ V KAK + E     LE Q+  +K+ ND+  RQ+NDL+  K++L +EN E    ++E E+ ++   + K +   Q+D+LK+ ++EE + +  L   LQ  + D D L+ +++EE EA  +L+  +SK N+++A  + KY+ + + +TEE EE K+KL  ++ E  ++     S+ + LEKTKQ+L  E++DL  +V+   A  A+L  + ++ + + AE +++ ++   EL   +     L+T+  ++K    E L++   L+++N +L  ++ DL + + +  + I ELE  +  +E ++  +  A  +A+  L+  E K       L Q+K +++++L EKD+E+E ++R++QR IE +  T+    V+ +++  R+KKK E  + E+EIQL +AN+  ++  K   ++  ++ + +  L+D  R  E   E +++ ER+   +  E+++LR  LE +ER RK AE E  +   RV+ L     +L+N K++LE DL  +QG++DD V   + AED+A K   +   +A+EL++EQD     E ++K LE+ ++++  +L+EAE  A + GK+ +QKL+ R+RELEA+ EAEQRR  +A    RK+ER+ KEL  Q E+D++ +  LQDL+DK QLK++AYKRQ EE E+ +   ++K RKAQ  +E+AE+RAD+AE  +       R SG V      R  ++ ++T
Sbjct: 1122 KVEKQRADLSRELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEESTLQHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSEYKMEIDDLSSNMEAVAKAKANLEKMCRTLEDQLSEIKTKNDENVRQINDLSAQKARLQTENGEFGRQLEEKESLVSQLTRGKQAFTQQIDELKRQIEEEVKAKNALAHGLQSARHDCDLLREQFEEEQEAKAELQRSMSKANSEVAQWRSKYETDAIQRTEELEEAKKKLAQRLQEAEEQTEAVNSKCASLEKTKQRLQGEVEDLMIDVERANALAANLDKKQRNFDKVLAEWKQKFEEGQAELEGAQKEARGLSTELFKMKNSYEEALDQLETLKRENKNLQQEISDLTEQIGETGKSIHELEKAKKAVETEKAEIQTALEEAEGTLEHEESKILRVQLELNQVKGEVDRKLAEKDEEMEQIKRNSQRVIESMQSTLDSE-VRSRNDALRIKKKMEGDLNEMEIQLSHANRQASEAQKQLRNVQGQLKDAQLHLDDAVRGQEDMKEQVAMVERRNTLMLAEIEELRAALEQTERGRKVAEQELVDASERVALLHSQNTSLLNTKKKLEADLVQVQGEVDDTVQEARNAEDKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEVTVKDLQHRLDEAENLAMKGGKKQLQKLESRVRELEAEVEAEQRRGVDAVKGVRKYERRVKELTYQTEEDKKNLTRLQDLVDKLQLKVKAYKRQAEEAEEQANGHLSKLRKAQHDLEEAEERADIAESQVNKLRAKSRDSGKVSRKELLRYTNIFKQT 1936          
BLAST of Paramyosin vs. Ensembl Cavefish
Match: ENSAMXT00000042907.1 (myosin heavy chain, fast skeletal muscle-like [Source:NCBI gene;Acc:103033118])

HSP 1 Score: 358.607 bits (919), Expect = 1.692e-103
Identity = 272/795 (34.21%), Postives = 481/795 (60.50%), Query Frame = 3
Query:  411 RSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGS 2795
            + E+  A+L+ +++ ++ R+EE         +  KKR+ + QKLR+DLE + LQ E+    LRKK   S+ E+  +ID+LQ+ + K EK+KS   ME++ +   ++ V KAK + E     LE Q+  +K+ ND+  RQ+ND+   K++L +EN E    ++E E+ ++   + K +   Q+++LK+ ++EE + +  L   LQ  + D D L+ +++EE EA  +L+  +SK N+++A  + KY+ + + +TEE EE K+KL  ++ E  ++     S+ + LEKTKQ+L  E++DL  +V+   A  A+L  + ++ + + AE +++ ++   EL   +     L+T+  ++K    E L++   L+++N +L  ++ DL + + +  + I ELE  +  +E ++  +  A  +A+  L+  E K       L Q+K +++++L EKD+E+E ++R++QR IE +  T+    V+ +++  R+KKK E  + E+EIQL +AN+  ++  K   ++  ++ + +  L+D  R  E   E +++ ER+   +  E+++LR  LE +ER RK AE E  +   RV+ L     +L+N K++LE DL  +QG++DD V   + AED+A K   +   +A+EL++EQD     E ++K LE+ ++++  +L+EAE  A + GK+ +QKL+ R+RELEA+ EAEQRR  +A    RK+ER+ KEL  Q E+D++ +  LQDL+DK QLK++AYKRQ EE E+ +   ++K RKAQ  +E+AE+RAD+AE  +   R+ S
Sbjct: 1130 KVEKQRADLSRELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEESTLQHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSEYKMEIDDLSSNMEAVAKAKANLEKMCRTLEDQLSEIKTKNDENVRQINDIGAQKARLQTENGEFGRQLEEKESLVSQLTRGKQAFTQQIEELKRQIEEEVKAKNALAHGLQSARHDCDLLREQFEEEQEAKAELQRSMSKANSEVAQWRSKYETDAIQRTEELEEAKKKLAQRLQEAEEQIEAVNSKCASLEKTKQRLQGEVEDLMIDVERANALAANLDKKQRNFDKVLAEWKQKFEEGQAELEGAQKEARGLSTELFKMKNSYEEALDQLETLKRENKNLQQEISDLTEQIGETGKSIHELEKAKKTVETEKAEIQTALEEAEGTLEHEESKILRVQLELNQVKGEVDRKLAEKDEEMEQIKRNSQRVIESMQSTLDSE-VRSRNDALRIKKKMEGDLNEMEIQLSHANRQASEAQKQLRNVQGQLKDAQLHLDDAVRGQEDMKEQVAMVERRNTLMLAEIEELRAALEQTERGRKVAEQELVDASERVALLHSQNTSLLNTKKKLEADLVQVQGEVDDTVQEARNAEDKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEVTVKDLQHRLDEAENLAMKGGKKQLQKLESRVRELEAEVEAEQRRGVDAVKGVRKYERRVKELTYQTEEDKKNLTRLQDLVDKLQLKVKAYKRQAEEAEEQANGHLSKLRKAQHDLEEAEERADIAESQVNKLRAKS 1923          
BLAST of Paramyosin vs. Ensembl Cavefish
Match: ENSAMXT00000004509.2 (myosin-1-like [Source:NCBI gene;Acc:103027891])

HSP 1 Score: 357.836 bits (917), Expect = 2.490e-103
Identity = 271/825 (32.85%), Postives = 495/825 (60.00%), Query Frame = 3
Query:  342 SLRLESRVKELEDLIDLE-------RDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGS 2795
            S +L+ ++KEL+  I+         R AR + E+  A+L+ +++ ++ R+EE         +  KKR+ + QKLR+DLE + LQ ES+   LRKK   S+ E+  +ID+LQ+ + K EK+KS L ME++ +   ++ V K K   E +  NLE Q H  K+ +++ QR +ND     ++L +EN ELT  ++E E  I+   ++K     Q+++LK+ L+EE + +  L   +Q  + D D L+ +++EE EA  +L+  +SK N+++A  + KY+ + + +TEE EE K++L  ++ +  ++     ++ + LEKTKQ+L  E++DL  E++   A NA L  + ++ + +  E +++ ++   EL   +  +  L+T+  +LK    E L+   +++++N +L  ++ DL + L  + + I ELE    Q E D+  +  A  +A+ +L+  E K       L Q+K+++++++ EKD+E++ L+R+ QR   ++  +  + E + ++E  RLKKK +  + E+EIQL +AN+  A+ +K   ++  ++ + + +L+    A E   E L++ ER+   L  E++++R  LE SER+RK AE E  ++  R   L     +L++ K+++E D+  +Q +++D V   + A+++A K   +   +A+EL++EQD     E ++K LE  ++++  +L+EAE  A + GK+ +QKL+ R+RELE + EAEQ+R  E     RK+ER+ KEL  Q+E+D++ V  LQDL++K QLK++ YKRQ EE E+ +++ ++K+RK Q ++E+AE+RAD+AE  +   R+ S
Sbjct: 1103 STQLQKKIKELQARIEELEEEVEAERTARAKVEKQRADLSRELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEESTLQHESIAATLRKKQADSVAELGEQIDNLQRVKQKLEKEKSELKMEIDDLASNMESVLKMKAGFEKQCRNLEDQNHEYKTKSEEAQRALNDYTTHSARLQTENGELTRQLEEKEITISQLSRVKIVCTHQIEELKRQLEEEIKAKNALAHSMQSTRHDCDLLREQFEEEQEAKAELQRGMSKANSEVAQWRTKYETDAIQRTEELEEAKKRLAQRLQDSEEQTEAVNAKCASLEKTKQRLQSEVEDLMVEIERANAANATLDKKQRNFDKVLTEWKQKYEESQSELEGSQRESRSLSTELFKLKNSYEEALDHLENMKRENKNLQQEITDLSEQLGQSAKTIHELEKAVKQAEQDKIEVQTALEEAESSLEHEEAKILHIQLELNQVKSEVDRKVAEKDEEIDQLKRNHQR-TVDILQSALDSETRSRNEAMRLKKKMDGDLNEMEIQLGHANRQAAEASKQLRNVQIQLKDTQVQLDAALHAQEDLREQLAMIERRNTLLTAEIEEMRAGLEQSERSRKMAEQELVDMSERTQLLHAQTTSLLSTKKKMELDIINLQTEVEDTVQVARNADEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEATVKDLQQRLDEAEQIAMKGGKKELQKLETRVRELENELEAEQKRGVETMKGVRKYERKIKELTYQSEEDKKNVTRLQDLVNKLQLKVKTYKRQCEEAEEQTSINLSKFRKLQHELEEAEERADIAESQVNKLRAKS 1926          
BLAST of Paramyosin vs. Ensembl Cavefish
Match: ENSAMXT00000057167.1 (pep primary_assembly:Astyanax_mexicanus-2.0:22:18770743:18781004:1 gene:ENSAMXG00000042223.1 transcript:ENSAMXT00000057167.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 355.525 bits (911), Expect = 1.704e-102
Identity = 272/802 (33.92%), Postives = 484/802 (60.35%), Query Frame = 3
Query:  411 RSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGSVMPGSTY 2816
            + E+  A+L+ +++ ++ R+EE         +  KKR+ + QKLR+DLE + LQ E+    LRKK   S+ E+  +ID+LQ+ + K EK+KS   ME++ +   ++ V K+K + E     LE Q+   KS ND+  RQ+NDL+  K++L +EN E    ++E E  ++   + K +   Q+++LK+ ++EE + +  L   +Q  + D D L+ +++EE EA  +L+  +SK N+++A  + KY+ + + +TEE EE K+KL  ++ +  +      S+ + LEKTKQ+L  E++DL  +V+   A  A+L  + ++ + + AE +++ ++   EL   +     L+T+  ++K    E L++   L+++N +L  ++ DL + L +  + I ELE  +  +E ++  +  A  +A+  L+  E K       L Q+K++++++L EKD+E+E ++R++QR IE +  T+    V+ +++  R+KKK E  + E+EIQL +AN+  ++  K   ++  ++ + +  L++  R HE   E +++ ER+   +  E+++LR+ LE +ER RK AE E  +   RV+ L     +LIN K++LE DL  IQ ++DD +   + AE++A K   +   +A+EL++EQD     E ++K LEI ++++  +L+EAE  A + GK+ +QKL+ R+RELEA+ E+EQRR  +A    RK+ER+ KEL  Q E+D++ V  LQDL+DK QLK++AYKRQ EE E+ +   +++YRK Q ++E+A++RAD+AE  +   R+ S   G  Y
Sbjct: 1097 KVEKQRADLSRELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEESTLQHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSEYKMEIDDLSSNMEAVAKSKANLEKLCRTLEDQLSEFKSKNDEHVRQLNDLSAQKARLQTENGEFGRQLEEKEALVSQLTRGKQAYTQQIEELKRQIEEEVKAKNALAHGVQSARHDCDLLREQFEEEQEAKAELQRGMSKANSEVAQWRTKYETDAIQRTEELEESKKKLAQRLQDAEESIEAVNSKCASLEKTKQRLQGEVEDLMIDVERANALAANLDKKQRNFDKVLAEWKQKFEEGQAELEGAQKEARSLSTELFKMKNSYEEALDQLETLKRENKNLQQEISDLTEQLGETGKTIHELEKAKKTVETEKSEIQTALEEAEGTLEHEESKILRIQLELNQVKSEIDRKLAEKDEEMEQIKRNSQRVIESMQSTLDSE-VRSRNDALRVKKKMEGDLNEMEIQLSHANRQASEAQKQLRNVQGQLKDAQLHLDEAIRGHEDMKEQVAMVERRNNLMLAEIEELRSALEQTERGRKVAEQELVDASERVALLHSQNTSLINTKKKLEADLVQIQSEVDDTIQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEITVKDLQHRLDEAENLAMKGGKKQLQKLESRVRELEAEVESEQRRGADAVKGVRKYERRVKELTYQTEEDKKNVTRLQDLVDKLQLKVKAYKRQAEESEEQANTHLSRYRKVQHELEEAQERADIAESQVNKLRAKSREAGKVY 1897          
BLAST of Paramyosin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005905.1 (pep scaffold:Pmarinus_7.0:GL476612:176223:319014:-1 gene:ENSPMAG00000004928.1 transcript:ENSPMAT00000005905.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 340.117 bits (871), Expect = 4.085e-98
Identity = 275/796 (34.55%), Postives = 488/796 (61.31%), Query Frame = 3
Query:  411 RSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSL-ANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGS 2795
            + E+  ++L+ +++ ++ R+EE         +  KKR+ + QKLR+DLE A LQ E+    LRKK   S+ E+  +ID+LQ+ + K EK+KS   ME++ +   ++ + K+K + E    +LE Q+  LK+ +++  R +ND+   +++L +E+ ELT  ++E E  +    + K S   QV+DLK+ L+EE + +  L   +Q  + D D L+ ++DEE EA G+L+  +SK NA++A  + KY+ + + +TEE E+ K+KL  ++ E  ++     S+ + LEKTKQ+L  E++DL  +V+   +  A L  + K  + + +E +++ ++   EL + +  +  L T+  +LK    E L+     +++N +L A ++ DL + L ++++ + ELE  R  +E ++ ++ AA  +A+ +L+  E K       L Q+KA++++++ EKD+E++ ++R  QRT+E +  T+     K ++E  RLKKK E  + E+EIQL++AN+  A+  K   ++  +I +L+  L+D  RA+E   E  ++ ER+   L  E+D++R+ LE +E+ARK AE E      RV  L     +LIN KR+LEGDL  +Q ++++++   + A+++A K   +   +A+EL++EQD     E ++K +E  ++++  +L+EAE  A + GK+ +QKL+ R+RELE++ +AEQRR  E    +RK+ER+ KEL  Q E+DR+  + LQDL+DK QLK++AYKRQ EE E+ +   ++KYRK Q ++E+A++RAD+AE  +   R+ S
Sbjct: 1015 KVEKQRSDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKLRRDLEEATLQHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSEFKMEVDDLSSNMEQITKSKVNLEKLSRSLEDQLSELKTKDEENIRTINDITAQRARLQAESGELTRKLEEKEVLVVQLSRGKQSYTQQVEDLKRQLEEEVKAKNALAHAVQSARHDCDLLREQFDEEQEAKGELQRAMSKANAEVAQWRTKYETDAIQRTEELEDAKKKLAARLQEAEEQVEAANSKCASLEKTKQRLQGEVEDLMIDVERAHSAAAALDKKQKAFDKVLSEWKQKFEESQAELEAAQKESRSLGTELFKLKNAYEETLDHLETFKRENKNLQAEEISDLTEQLGESSKSLHELEKNRKAIEQEKSDIQAALEEAEASLEHEEGKILRVQLELNQVKAEVDRKIAEKDEEIDQIKRGFQRTVESMQATLDSE-TKSRNEALRLKKKMEGDLNEMEIQLNHANRQAAESQKHLRNVQGQIKDLQVHLDDALRANEDYKEQAAMLERRNNLLVAEVDEMRSALEQTEKARKLAEQELLGATERVQLLHSQNTSLINTKRKLEGDLSQLQSEVEESIQESRNADEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQHRLDEAEQIAMKGGKKQLQKLETRVRELESELDAEQRRTAETIKGSRKYERRIKELSYQTEEDRKNNLRLQDLVDKLQLKVKAYKRQSEEAEEQANTNLSKYRKLQHELEEADERADIAESQVNKLRARS 1809          
BLAST of Paramyosin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002731.1 (pep scaffold:Pmarinus_7.0:GL478284:11062:40470:1 gene:ENSPMAG00000002428.1 transcript:ENSPMAT00000002731.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 310.457 bits (794), Expect = 4.102e-88
Identity = 270/802 (33.67%), Postives = 463/802 (57.73%), Query Frame = 3
Query:  411 RSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSEN----------YEL-TIVVQEYETQIN---SFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSL---ANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAE 2765
            + E+  A++  +++ ++ R+EE         +  KKR+ + QKLR+DLE + LQ E+    LRKK+  S+ E+  ++D+LQ+ + K EK+KS L MEL+ V+  ++ V K K SA     +   + HR   ++   QR ++D    K+KL +EN          Y + TI+     T I    S + IK +              E + +  L   +Q  + D D L+ +Y+EE EA  +L+  +S+ NA++A  + KY+ + + +TEE EE K+KL  ++ E  +      ++ S LEKTKQ+L  E++D+  +V+   A  A L  + +  + + +E +++ ++   EL   +     L+T+  +LK    E L+    ++++N +L     ++ DL + + +  + + ELE LR QLE ++ +L AA  +A+ +L+  E K       L Q+KAD+E++L EKD+ELE  +R+ QR +E L   +     + ++E  R+KKK E  + E+EIQL +AN+  ++  K    +  +  E + +L+D  R  +   E  +++ER+   +  E+++LR+ LE +ERARK AE E  E   RV  L     +LIN K++LEGD+GV+Q +++++V   + AE++A K   +   +A+EL++EQD     E ++K +E  ++++  +L+EAE  A + GK+ +QKL+ R+RELE + EAEQRR  E    ARK+ER+ KEL  Q E+D++ +  LQDL+DK Q+K++AYKR  EE E+ +   +++YRK Q ++E+AE+RAD+AE
Sbjct: 1123 KVEKQRADVARELEEISERLEEAGGATAAQVEFNKKREAEFQKLRRDLEESTLQHEATASALRKKHADSVAELGEQLDNLQRVKQKLEKEKSELKMELDDVLSNMESVVKTKVSAWRDASD-AARAHR--HLHLSCQRLISDFTAQKAKLQTENGAPSSTHTPQYAIETIITMHTGTFIEQRLSQRHIKHN--------------EVKAKSALAHAVQAARHDCDLLREQYEEEQEAKAELQRALSRANAEVAQWRTKYETDAIQRTEELEEAKKKLVQRLQEAEESVEAANAKCSSLEKTKQRLQNELEDMMVDVERANAAAAALDKKQRTFDKVLSEWKQKFEESQAELEGAQKEARSLSTELFKLKNAYEESLDHLETMKRENKNLQACTEEISDLTEQMSEGAKTVHELEKLRKQLEQEKVDLQAALEEAEASLEHEESKILRAQLELNQMKADIERKLSEKDEELEQAKRNNQRAVETLQTALEAE-TRSRNEALRIKKKMEGDLNEMEIQLSHANRSASEAQKQLKMVQSQFKEAQLQLDDALRLGDEYKEQAAMAERRSTLMLAEVEELRSALEQTERARKLAEQELIEASERVQLLHSQNTSLINQKKKLEGDMGVLQNEVEESVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQRRNAETVKGARKYERRAKELSYQTEEDKKNLARLQDLVDKLQMKVKAYKRPAEEAEEQANGNLSRYRKLQHELEEAEERADIAE 1906          
BLAST of Paramyosin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003821.1 (pep scaffold:Pmarinus_7.0:GL477325:10535:35195:1 gene:ENSPMAG00000003267.1 transcript:ENSPMAT00000003821.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.667 bits (496), Expect = 5.491e-51
Identity = 177/522 (33.91%), Postives = 304/522 (58.24%), Query Frame = 3
Query:  375 EDLIDLERDARMRSERLN--AELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNA 1934
            E L+DLE D +   E+L     L++ +  ++ R+EE       H +  KKR+ +  KLR+DLE A LQ E+    LRKK   S+ E+  +ID+LQ+ + K EK+KS   ME++ +   L+ V KAK + E     +E Q+  +K+  ++  R +ND+N  +++L +EN EL+  ++E E  +    + K S   QV+DLK+ L+EE + +  L   +Q  + D D L+ ++DEE EA G+L+  +SK NA++A  + KY+ + + KTEE EE K+KL +++ E  ++     S+ + LEKTKQ+L  E++DL  +V+   +  A L  + K    + +E +++ ++   EL + +  +  L+T+  +LK    E L+    L+++N +L  ++ DL + L ++ + + E+E  R QLE ++  + AA  +A+ +L+  E K       L Q+KAD+++++ EKD+EL+ L+RS QR   E      + E K ++E  RLKKK E  + E+EIQL++AN+  A
Sbjct: 1064 ESLMDLENDKQQLDEKLKKCVLLSHLVPQISERLEEAGGATSAHIEMNKKREAEF-KLRRDLEEATLQHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSEFKMEVDDLSSNLEQVTKAKVNLEKLCRTIEDQLAEVKTKEEEQIRSINDINTQRARLLAENGELSRKLEEKEVLVVQLSRGKLSYTQQVEDLKRQLEEEIKAKNALAHAVQSARHDCDLLREQFDEEQEAKGELQRAMSKANAEVAQWRTKYETDAIQKTEELEEAKKKLAVRLQEAEEQVEASNSKCASLEKTKQRLLGEVEDLMIDVERAHSAAAALDKKQKAFGKVLSEWKQKYEESQSELEASQKESRSLSTEVFKLKNAYEETLDHLETLKRENKNLQEEISDLTEQLGESGKALHEVEKSRKQLEQEKLEIQAALEEAEASLEHEEGKILRIQLELNQVKADIDRKIAEKDEELDQLKRSNQR-TVESMQASLDAETKSRNEALRLKKKMEGDLNEMEIQLNHANRQAA 1583          

HSP 2 Score: 157.147 bits (396), Expect = 5.531e-39
Identity = 88/210 (41.90%), Postives = 143/210 (68.10%), Query Frame = 3
Query: 2184 NTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGS--VMPG 2807
             +LIN KR+LEGD+  +Q + ++A+   + A+++A K   +   +A+EL++EQD     E ++K +E  ++++  +L+EAE  A + GK+ +QKL+ R+RELE++ ++EQRR  E    ARK+ER+ KEL  QAE+DR+  + LQDL+DK QLK++ YKRQ EE E+ +   ++KYRK Q ++E+A++RAD+AE  +   R+ S  V P 
Sbjct: 1660 TSLINTKRKLEGDIVQLQNECEEAIQESRNADEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQNRLDEAEQIAMKGGKKQIQKLETRVRELESELDSEQRRIAETIKGARKYERRVKELTYQAEEDRKNNLRLQDLVDKLQLKVKTYKRQSEEAEEQANTNLSKYRKLQHELEEADERADIAESQVNKLRARSRDVHPA 1869          
BLAST of Paramyosin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005818.1 (pep scaffold:Pmarinus_7.0:GL484421:7309:13492:-1 gene:ENSPMAG00000005268.1 transcript:ENSPMAT00000005818.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 168.703 bits (426), Expect = 7.690e-46
Identity = 130/355 (36.62%), Postives = 216/355 (60.85%), Query Frame = 3
Query: 1713 LIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDL----LDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAE 2765
            L Q+KAD+E++L EKD+ELE  +R+ QR +E L   +     + ++E  R+KKK E  + E+EIQL +AN+  ++  K    +  ++ E + +L+D  R  +   E  +++ER+   +  E+++LR+ LE +ERARK AE E  +   RV  L     +LIN K++LEGD+G +Q ++++AV   + AE++A K   +   +A+EL++EQD     E ++K +E  ++++  +L+EAE  A + GK+ +QKL+ R+RELE + EAEQRR  E    ARK+ER+ KEL  Q +  RR V+          + T   +    R+ EE  + +   +++YRK Q ++E+AE+RAD+AE
Sbjct:   18 LSQMKADIERKLSEKDEELEQAKRNNQRAVETLQTALEAE-TRSRNEALRIKKKMEGDLNEMEIQLSHANRSASEAQKQLKMVQSQLKEAQLQLDDALRLGDEYKEQAAMAERRSTLMLAEVEELRSALEQTERARKLAEQELIDASERVQLLHSQNTSLINQKKKLEGDMGTLQNEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQRRNAETVKGARKYERRAKELSYQIDQVRRHVISTTPTSSIAPNTTAPSLLPPPRRQEEQANGN---LSRYRKLQHELEEAEERADIAE 368          
BLAST of Paramyosin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005582.1 (pep scaffold:Pmarinus_7.0:GL481917:38212:72095:-1 gene:ENSPMAG00000004862.1 transcript:ENSPMAT00000005582.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 148.673 bits (374), Expect = 2.069e-36
Identity = 82/187 (43.85%), Postives = 132/187 (70.59%), Query Frame = 3
Query: 2205 RRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAE 2765
            + LEGD+G +Q ++++AV   + AE++A K   +   +A+EL++EQD     E ++K +E  ++++  +L+EAE  A + GK+ +QKL+ R+RELE + EAEQRR  E    ARK+ER+ KEL  Q E+D++ +  LQDL+DK Q+K++AYKRQ EE E+ +   +++YRK Q ++E+AE+RAD+AE
Sbjct: 1698 KXLEGDMGSLQSEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQRRNAETVKGARKYERRAKELSYQTEEDKKNMARLQDLVDKLQMKVKAYKRQSEEAEEQANGNLSRYRKLQHELEEAEERADIAE 1884          

HSP 2 Score: 130.183 bits (326), Expect = 1.035e-30
Identity = 154/515 (29.90%), Postives = 281/515 (54.56%), Query Frame = 3
Query:  411 RSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSEN-------YELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSL---ANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANK 1925
            + E+  A++  +++ ++ R+EE         +  KKR+ + QKLR+DLE + LQ E+    LRKK+  S+ E+  ++D+LQ+ + K EK+KS L MEL+ ++  ++ V K K  ++ +L  L+  V   +    + Q  V+  N    KL +EN        +   ++Q+   Q    + IK++   Q   L   +   ++ +  L   +Q  + D D L+ +Y+EE EA  +L+  +S+ NA++A  + KY+ + + +TEE EE K+KL  ++ +  +      ++ S LEKTKQ+L  E++D+  +V+   A  A L  + +  + + AE +++ ++   EL   +     L+T+  +LK    E L+    ++++N +L     ++ DL + + +  + + ELE LR QLE ++ +L AA  +A+ +L+  E K       L Q+KAD++++L EKD+ELE  +R+  R   E   T  E E + ++E  R+KKK E  + E+EIQL +AN+
Sbjct: 1122 KVEKQRADVARELEEISERLEEAGGATAAQIEFNKKREAEFQKLRRDLEESTLQHEATASALRKKHADSVAELGEQLDNLQRVKQKLEKEKSELKMELDDIVSNMESVVKTKEISQKRLRVLDFCVIESRMSLIESQESVDSWNRVALKLQTENGAPSGTHTDTGALIQQRVQQ----RHIKNNE--QFAHLPHPVQASAKAKSALAHAVQAARHDCDLLREQYEEEQEAKAELQRALSRANAEVAQWRTKYETDAIQRTEELEEAKKKLVQRLQDAEESVEAANAKCSSLEKTKQRLQNELEDMMVDVERANAAAAALDKKQRTFDKVLAEWKQKYEESQAELEGAQKEARSLSTELFKLKNAYEESLDHLETMKRENKNLQACTEEISDLTEQMSEGAKTVHELEKLRKQLEQEKVDLQAALEEAEASLEHEESKILRAQLELNQMKADIDRKLSEKDEELEQAKRNNLR-AVETLQTALEAETRSRNEALRIKKKMEGDLNEMEIQLSHANR 1629          
BLAST of Paramyosin vs. Ensembl Nematostella
Match: EDO44893 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUF8])

HSP 1 Score: 52.373 bits (124), Expect = 8.739e-7
Identity = 42/103 (40.78%), Postives = 58/103 (56.31%), Query Frame = 3
Query:  399 DARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELE 707
            +AR +SER   EL +++D LN R++E         +  KKR+ DI KLRKDLE   L  E     +R K N  + EM  E+D ++K +  AEK +S L  ELE
Sbjct:  409 NARSKSERARQELEHELDDLNERLDEQGGATQAQMELNKKRESDIIKLRKDLEEQALAHEQAVNSMRSKQNQQMQEMQEELDQVKKTKANAEKTRSRLNSELE 511          
BLAST of Paramyosin vs. Ensembl Medaka
Match: ENSORLT00000029659.1 (myosin heavy chain, fast skeletal muscle-like [Source:NCBI gene;Acc:111947749])

HSP 1 Score: 357.836 bits (917), Expect = 2.904e-103
Identity = 269/788 (34.14%), Postives = 480/788 (60.91%), Query Frame = 3
Query:  411 RSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHL 2774
            + E+  A+L+ +++ ++ R+EE         +  KKR+ + QKLR+DLE + LQ E+    LRKK   S+ E+  +ID+LQ+ + K EK+KS   ME++ +   ++GV K+K + E     LE Q+  LK+ ND+  RQ+NDLN  +++L +EN E +  ++E E  ++   + K +   Q+++LK+ ++EE + +  L   +Q  + D D L+ +++EE EA  +L+  +SK N+++A  + KY+ + + +TEE EE K+KL  ++ E  +      S+ + LEKTKQ+L  E++DL  +V+   +  A+L  + ++ + + AE +++ ++   EL   +     L+T+  ++K    E L++   ++++N +L  ++ DL + + +  + I ELE  +  +E ++  +  A  +A+  L+  E K       L Q+K +++++L EKD+ELE ++R++QR IE +  T+    V+ +++  R+KKK E  + E+EIQL +AN+  A+  K   ++  ++ + +  L+D  RA E   E +++ ER+   +  E+++LR  LE +ER RK AE E  +   RV  L     +L+N K++LE DL  +QG++DDA+   + AE++A K   +   +A+EL++EQD     E ++K LE+ ++++  +L+EAE  A + GK+ +QKL+ R+RELE++ E+EQRR  +A    RK+ER+ KEL  Q E+D++ V  LQDL+DK QLK++AYKRQ EE E+++   M+K RK Q + E+A++RAD+AE  +
Sbjct: 1131 KVEKQRADLSRELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEESTLQHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSEYKMEIDDLSSNMEGVAKSKGNLEKMCRTLEDQLSELKAKNDENIRQLNDLNAQRARLQTENGEFSRQLEEKEALVSQLTRGKQAFTQQIEELKRLVEEEVKAKNALAHGVQSARHDCDLLREQFEEEQEAKAELQRGMSKANSEVAQWRTKYETDAIQRTEELEESKKKLAQRLQEAEESIEAVNSKCASLEKTKQRLQGEVEDLMIDVERANSLAANLDKKQRNFDKVLAEWKQKYEESQAELEGAQKEARSLSTELFKMKNSYEEALDQLETMKRENKNLQQEISDLTEQIGETGKSIHELEKAKKTVETEKSEIQTALEEAEGTLEHEESKILRVQLELNQVKGEIDRKLAEKDEELEQIKRNSQRVIESMQSTLEAE-VRSRNDALRVKKKMEGDLNEMEIQLSHANRQAAEAQKQLRNVQGQLKDAQLHLDDALRAQEDMKEQVAMVERRNGLMLAEIEELRAALEQTERGRKVAEQELVDASERVGLLHSQNTSLLNTKKKLESDLVQVQGEVDDAIQGARNAEEKAKKAITDAAMMAEELKKEQDTSSHLERMKKNLEVTVKDLQHRLDEAENLAMKGGKKQLQKLESRVRELESEVESEQRRGVDAIKGVRKYERRVKELTYQTEEDKKNVARLQDLVDKLQLKVKAYKRQAEEAEEMANTHMSKLRKVQNEFEEAQERADIAESQV 1917          
BLAST of Paramyosin vs. Ensembl Medaka
Match: ENSORLT00000038488.1 (myosin heavy chain, fast skeletal muscle-like [Source:NCBI gene;Acc:111947749])

HSP 1 Score: 357.451 bits (916), Expect = 4.232e-103
Identity = 269/788 (34.14%), Postives = 480/788 (60.91%), Query Frame = 3
Query:  411 RSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHL 2774
            + E+  A+L+ +++ ++ R+EE         +  KKR+ + QKLR+DLE + LQ E+    LRKK   S+ E+  +ID+LQ+ + K EK+KS   ME++ +   ++GV K+K + E     LE Q+  LK+ ND+  RQ+NDLN  +++L +EN E +  ++E E  ++   + K +   Q+++LK+ ++EE + +  L   +Q  + D D L+ +++EE EA  +L+  +SK N+++A  + KY+ + + +TEE EE K+KL  ++ E  +      S+ + LEKTKQ+L  E++DL  +V+   +  A+L  + ++ + + AE +++ ++   EL   +     L+T+  ++K    E L++   ++++N +L  ++ DL + + +  + I ELE  +  +E ++  +  A  +A+  L+  E K       L Q+K +++++L EKD+ELE ++R++QR IE +  T+    V+ +++  R+KKK E  + E+EIQL +AN+  A+  K   ++  ++ + +  L+D  RA E   E +++ ER+   +  E+++LR  LE +ER RK AE E  +   RV  L     +L+N K++LE DL  +QG++DDA+   + AE++A K   +   +A+EL++EQD     E ++K LE+ ++++  +L+EAE  A + GK+ +QKL+ R+RELE++ E+EQRR  +A    RK+ER+ KEL  Q E+D++ V  LQDL+DK QLK++AYKRQ EE E+++   M+K RK Q + E+A++RAD+AE  +
Sbjct: 1132 KVEKQRADLSRELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEESTLQHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSEYKMEIDDLSSNMEGVAKSKGNLEKMCRTLEDQLSELKAKNDENIRQLNDLNAQRARLQTENGEFSRQLEEKEALVSQLTRGKQAFTQQIEELKRLVEEEVKAKNALAHGVQSARHDCDLLREQFEEEQEAKAELQRGMSKANSEVAQWRTKYETDAIQRTEELEESKKKLAQRLQEAEESIEAVNSKCASLEKTKQRLQGEVEDLMIDVERANSLAANLDKKQRNFDKVLAEWKQKYEESQAELEGAQKEARSLSTELFKMKNSYEEALDQLETMKRENKNLQQEISDLTEQIGETGKSIHELEKAKKTVETEKSEIQTALEEAEGTLEHEESKILRVQLELNQVKGEIDRKLAEKDEELEQIKRNSQRVIESMQSTLEAE-VRSRNDALRVKKKMEGDLNEMEIQLSHANRQAAEAQKQLRNVQGQLKDAQLHLDDALRAQEDMKEQVAMVERRNGLMLAEIEELRAALEQTERGRKVAEQELVDASERVGLLHSQNTSLLNTKKKLESDLVQVQGEVDDAIQGARNAEEKAKKAITDAAMMAEELKKEQDTSSHLERMKKNLEVTVKDLQHRLDEAENLAMKGGKKQLQKLESRVRELESEVESEQRRGVDAIKGVRKYERRVKELTYQTEEDKKNVARLQDLVDKLQLKVKAYKRQAEEAEEMANTHMSKLRKVQNEFEEAQERADIAESQV 1918          
BLAST of Paramyosin vs. Ensembl Medaka
Match: ENSORLT00000002483.2 (myosin heavy chain, fast skeletal muscle-like [Source:NCBI gene;Acc:101163661])

HSP 1 Score: 356.681 bits (914), Expect = 7.141e-103
Identity = 269/788 (34.14%), Postives = 480/788 (60.91%), Query Frame = 3
Query:  411 RSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHL 2774
            + E+  A+L+ +++ ++ R+EE         +  KKR+ + QKLR+DLE + LQ E+    LRKK   S+ E+  +ID+LQ+ + K EK+KS   ME++ +   ++GV K+K + E     LE Q+  LK+ ND+  RQ+NDLN  +++L +EN E +  ++E E  ++   + K +   Q+++LK+ ++EE + +  L   +Q  + D D L+ +++EE EA  +L+  +SK N+++A  + KY+ + + +TEE EE K+KL  ++ E  +      S+ + LEKTKQ+L  E++DL  +V+   +  A+L  + ++ + + AE +++ ++   EL   +     L+T+  ++K    E L++   ++++N +L  ++ DL + + +  + I ELE  +  +E ++  +  A  +A+  L+  E K       L Q+K +++++L EKD+ELE ++R++QR IE +  T+    V+ +++  R+KKK E  + E+EIQL +AN+  A+  K   ++  ++ + +  L+D  RA E   E +++ ER+   +  E+++LR  LE +ER RK AE E  +   RV  L     +L+N K++LE DL  +QG++DDA+   + AE++A K   +   +A+EL++EQD     E ++K LE+ ++++  +L+EAE  A + GK+ +QKL+ R+RELE++ E+EQRR  +A    RK+ER+ KEL  Q E+D++ V  LQDL+DK QLK++AYKRQ EE E+++   M+K RK Q + E+A++RAD+AE  +
Sbjct: 1132 KVEKQRADLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKLRRDLEESTLQHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSEYKMEIDDLSSNMEGVAKSKGNLEKMCRTLEDQLSELKAKNDENVRQLNDLNAQRARLQTENGEFSRQLEEKEALVSQLTRGKQAFTQQIEELKRHVEEEVKAKNALAHGVQSARHDCDLLREQFEEEQEAKAELQRGMSKANSEVAQWRTKYETDAIQRTEELEESKKKLAQRLQEAEESIEAVNSKCASLEKTKQRLQGEVEDLMIDVERANSLAANLDKKQRNFDKVLAEWKQKYEESQAELEGAQKEARSLSTELFKMKNSYEEALDQLETMKRENKNLQQEISDLTEQIGETGKSIHELEKAKKSVETEKSEIQTALEEAEGTLEHEESKILRVQLELNQVKGEIDRKLAEKDEELEQIKRNSQRVIESMQSTLEAE-VRSRNDALRVKKKMEGDLNEMEIQLSHANRQAAEAQKQLRNVQGQLKDAQLHLDDALRAQEDMKEQVAMVERRNGLMLAEIEELRAALEQTERGRKVAEQELVDASERVGLLHSQNTSLLNTKKKLESDLVQVQGEVDDAIQEARNAEEKAKKAITDAAMMAEELKKEQDTSSHLERMKKNLEVTVKDLQHRLDEAENLAMKGGKKQLQKLESRVRELESEVESEQRRGVDAIKGVRKYERRVKELTYQTEEDKKNVARLQDLVDKLQLKVKAYKRQAEEAEEMANTHMSKLRKVQNEFEEAQERADIAESQV 1918          
BLAST of Paramyosin vs. Ensembl Medaka
Match: ENSORLT00000027078.1 (myosin heavy chain, fast skeletal muscle-like [Source:NCBI gene;Acc:101163631])

HSP 1 Score: 356.681 bits (914), Expect = 8.138e-103
Identity = 268/788 (34.01%), Postives = 479/788 (60.79%), Query Frame = 3
Query:  411 RSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHL 2774
            + E+  A+L+ +++ ++ R+EE         +  KKR+ + QKLR+DLE + LQ E+    LRKK   S+ E+  +ID+LQ+ + K EK+KS   ME++ +   ++GV K+K + E     LE Q+  LK+ ND+  RQ+NDLN  +++L +EN E +  ++E E  ++   + K +   Q+++LK+ ++EE + +  L   +Q  + D D L+ +++EE EA  +L+  +SK N+++A  + KY+ + + +TEE EE K+KL  ++ E  +      S+ + LEKTKQ+L  E++DL  +V+   +  A+L  + ++ + + AE +++ ++   EL   +     L+T+  ++K    E L++   ++++N +L  ++ DL + + +  + I ELE  +  +E ++  +  A  +A+  L+  E K       L Q+K +++++L EKD+ELE ++R++QR IE +  T+    V+ +++  R+KKK E  + E+EIQL +AN+  A+  K   ++  ++ + +  L+D  R  E   E +++ ER+   +  E+++LR  LE +ER RK AE E  +   RV  L     +L+N K++LE DL  +QG++DDA+   + AE++A K   +   +A+EL++EQD     E ++K LE+ ++++  +L+EAE  A + GK+ +QKL+ R+RELE++ E+EQRR  +A    RK+ER+ KEL  Q E+D++ V  LQDL+DK QLK++AYKRQ EE E+++   M+K RK Q + E+A++RAD+AE  +
Sbjct: 1132 KVEKQRADLSRELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEESTLQHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSEYKMEIDDLSSNMEGVAKSKGNLEKMCRTLEDQLSELKAKNDENVRQLNDLNAQRARLQTENGEFSRQLEEKEALVSQLTRGKQAFTQQIEELKRLVEEEVKAKNALAHGVQSARHDCDLLREQFEEEQEAKAELQRGMSKANSEVAQWRTKYETDAIQRTEELEESKKKLAQRLQEAEESIEAVNSKCASLEKTKQRLQGEVEDLMIDVERANSLAANLDKKQRNFDKVLAEWKQKYEESQAELEGAQKEARSLSTELFKMKNSYEEALDQLETMKRENKNLQQEISDLTEQIGETGKSIHELEKAKKSVETEKSEIQTALEEAEGTLEHEEAKILRVQLELNQVKGEIDRKLAEKDEELEQIKRNSQRVIESMQSTLDAE-VRSRNDALRVKKKMEGDLNEMEIQLSHANRQAAEAQKQLRNVQGQLKDAQLHLDDALRGQEDMKEQVAMVERRNGLMLAEIEELRAALEQTERGRKVAEQELVDASERVGLLHSQNTSLLNTKKKLESDLVQVQGEVDDAIQEARNAEEKAKKAITDAAMMAEELKKEQDTSSHLERMKKNLEVTVKDLQHRLDEAENLAMKGGKKQLQKLESRVRELESEVESEQRRGADAIKGVRKYERRVKELTYQTEEDKKNVARLQDLVDKLQLKVKAYKRQAEEAEEMANTHMSKLRKVQNEFEEAQERADIAESQV 1918          
BLAST of Paramyosin vs. Ensembl Medaka
Match: ENSORLT00000007759.2 (myosin heavy chain, fast skeletal muscle [Source:NCBI gene;Acc:101158198])

HSP 1 Score: 354.369 bits (908), Expect = 3.801e-102
Identity = 270/795 (33.96%), Postives = 478/795 (60.13%), Query Frame = 3
Query:  411 RSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGS 2795
            + E+  A+L+ +++ ++ R+EE         +  KKR+ + QKLR+DLE + LQ E+    LRKK   S+ E+  +ID+LQ+ + K EK+KS   ME++ +   ++GV K+K + E     LE Q+  LK+ ND+  RQ+NDLN  +++L +EN E    + E E  ++   + K +   Q+++LK+ ++EE + +  L   +Q  + D D L+ +++EE EA  +L+  +SK N+++A  + KY+ + + +TEE EE K+KL  ++ E  +      S+ + LEKTKQ+L  E++DL  +V+   +  A+L  + ++ + + AE +++ ++   EL   +     L+T+  ++K    E L++   ++++N +L  ++ DL + L +  + I ELE  +  +E ++  +  A  +A+  L+  E K       L Q+K +++++L EKD+ELE ++R++QR IE +  T+    V+ +++  R+KKK E  + E+EIQL +AN+  A+  K   ++  ++ + +  L+D  R  E   E +++ ER+   +  E+++LR  LE +ER RK AE E  +   RV  L     +L+N K++LE D   +QG++DDAV   + AE++A K   +   +A+EL++EQD     E ++K LE+ ++++  +L+EAE  A + GK+ +QKL+ R+RELE++ E+EQRR  +A    RK+ER+ KEL  Q E+D++ V  LQDL+DK QLK++AYKRQ EE E+ +   M++ RK Q ++E+A++RAD+AE  +   R  S
Sbjct: 1050 KVEKQRADLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKLRRDLEESTLQHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSEYKMEIDDLSSNMEGVAKSKGNLEKMCRTLEDQLSELKAKNDENVRQLNDLNAQRARLQTENGEFARQLDEKEALVSQLTRSKQAFTQQIEELKRHVEEEVKAKNALAHAVQSARHDCDLLREQFEEEQEAKAELQRGMSKANSEVAQWRTKYETDAIQRTEELEESKKKLAQRLQEAEESIEAVNSKCASLEKTKQRLQGEVEDLMTDVERANSLAANLDKKQRNFDKVLAEWKQKYEESQAELEGAQKEARSLSTELFKMKNSYEEALDQLETMKRENKNLQQEISDLTEQLGEIGKSIHELEKAKKSVETEKCEIQTALEEAEGTLEHEESKILRVQLELNQVKGEIDRKLAEKDEELEQIKRNSQRVIESMQSTLDAE-VRSRNDALRVKKKMEGDLNEMEIQLSHANRQAAEAQKQLRNVQGQLKDAQLHLDDALRGQEDMKEQVAMVERRNGLMLAEIEELRAALEQTERGRKVAEQELVDASERVGLLHSQNTSLLNTKKKLESDFVQVQGEVDDAVQEARNAEEKAKKAITDAAMMAEELKKEQDTSSHLERMKKNLEVTVKDLQHRLDEAENLAMKGGKKQLQKLESRVRELESEVESEQRRGADAIKGVRKYERRVKELTYQTEEDKKNVARLQDLVDKLQLKVKAYKRQTEEAEEQANTHMSRLRKVQNELEEAQERADIAESQVNKLRVKS 1843          
BLAST of Paramyosin vs. Planmine SMEST
Match: SMESG000016909.1 (SMESG000016909.1)

HSP 1 Score: 1511.51 bits (3912), Expect = 0.000e+0
Identity = 872/872 (100.00%), Postives = 872/872 (100.00%), Query Frame = 3
Query:  273 MNSNSSESHVKIVRQFYRGSSPTSLRLESRVKELEDLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGSVMPGSTYRAISVVRETSTLNSSRGARATSIR 2888
            MNSNSSESHVKIVRQFYRGSSPTSLRLESRVKELEDLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADEAARERSRASGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDLSLELNSLRSSNNQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDANRRIAELEALRAQLEADRDNLSAAYADAKDALKDLEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRTIEELTITITEIEVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDLSRRIAELERELEDERRAHEATNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGSVMPGSTYRAISVVRETSTLNSSRGARATSIR
Sbjct:    1 MNSNSSESHVKIVRQFYRGSSPTSLRLESRVKELEDLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADEAARERSRASGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDLSLELNSLRSSNNQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDANRRIAELEALRAQLEADRDNLSAAYADAKDALKDLEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRTIEELTITITEIEVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDLSRRIAELERELEDERRAHEATNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGSVMPGSTYRAISVVRETSTLNSSRGARATSIR 872          
BLAST of Paramyosin vs. Planmine SMEST
Match: SMESG000058328.1 (SMESG000058328.1)

HSP 1 Score: 887.871 bits (2293), Expect = 0.000e+0
Identity = 529/872 (60.67%), Postives = 704/872 (80.73%), Query Frame = 3
Query:  273 MNSNS-SESHVKIVRQFYRGSSPTSLRLESRVKELEDLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGSVMPGSTYRAISVVRETSTLNSSRGARATSI 2885
            MN +S +ES + I RQF R  SPT+LRLESR++ELED++DLERDA+MR+ERL  E +YQ++AL+ R++E       + + +K+++M++ KLRK+LE AN+ LES E  +++K+  +I E +SEI++LQK +GK EKDK+ L +E+E++ G+L+G  K K SAEAKL+  E Q+ RLKS++DDLQRQ+ D+ GAK++L +EN++L  +VQEYETQI +  K +SSL+ Q+DDLKK LDEE+R R+  Q QL  LQ ++D L  R++EESE  G L+ Q+SKL  +L  LKGKY++E+M+KTEE EEIKRKLTI+I EL D + RER RAS LEK KQ+L+IEIK+LQ+++D LGAEN DL  RLK AE LA ELQ R+D+LS+E+++L+S+NNQL+ DNMRLKAQV++LL++N +L+++N SLA+QL++ K+ALRDAN+R+ +LEAL++QLEADRDNL++A AD +DALK++E KY   H AL++LK++MEQRLREK+DELESLR+ST RTIEELT+TITE+EVK++SE+++LKK+YESTI ELE+QLD+ NK NAKL K+N D  +RI ELE  LE+ER+  E    +L ++ERKR+Q+Q EL++    LES+ RA+K AENEA E   R+ E+ L VN+L  DKRRLE D+GV+Q D++DAVN RQAAEDRAN+LN EV RLADELRQEQ+NY++AE+LRK LEIE+REITVKLEEAEA+ATREG+R VQKLQ RLRELEA+ EAE RR K++ AQARKFERQ+KE QQQA+DDRRMV+ELQDLL+KTQLKM+ YKRQ+EE+E+V+++ MNKYRKAQQ IE+AE RADM ER +T+R +    PG   R+ISV RE S  N+ RG R+TSI
Sbjct:    1 MNRSSINESTISISRQFTRSGSPTTLRLESRLRELEDILDLERDAKMRAERLANEYSYQVEALSERLDEIGGSSSHNTEQLKRKEMEVSKLRKELETANMNLESHEHNMKRKHQTTIMEFTSEIENLQKQKGKVEKDKNQLTIEMENIYGQLEGALKGKQSAEAKLEGFESQLSRLKSLSDDLQRQLQDVTGAKNRLQTENFDLVKLVQEYETQITTLSKARSSLQNQLDDLKKNLDEETRSRLHTQDQLHNLQQEYDVLHVRFEEESELNGNLKGQVSKLQNELQALKGKYERELMLKTEEIEEIKRKLTIRITELEDISERERMRASNLEKIKQKLSIEIKELQHDIDNLGAENQDLARRLKSAENLANELQHRVDELSIEVSNLQSANNQLSDDNMRLKAQVNDLLDKNLNLDRENKSLADQLREAKNALRDANKRVVDLEALKSQLEADRDNLASALADTEDALKEMELKYNQVHDALVKLKSEMEQRLREKEDELESLRKSTSRTIEELTVTITEMEVKHRSELSKLKKRYESTILELEMQLDSVNKANAKLMKENKDFFQRIKELELSLEEERKGRENAEANLQLTERKRIQIQSELEETITILESTTRAKKAAENEAGEANNRLGEMNLQVNSLTQDKRRLEADIGVMQTDMEDAVNGRQAAEDRANRLNAEVARLADELRQEQENYRQAEALRKQLEIEVREITVKLEEAEAFATREGRRMVQKLQARLRELEAEMEAESRRSKDSAAQARKFERQWKEAQQQADDDRRMVLELQDLLEKTQLKMKTYKRQVEELEEVASITMNKYRKAQQSIEEAEHRADMVERSMTMRHTSG--PG--IRSISVTREVS--NTFRGNRSTSI 866          
BLAST of Paramyosin vs. Planmine SMEST
Match: SMESG000009422.1 (SMESG000009422.1)

HSP 1 Score: 495.738 bits (1275), Expect = 2.606e-160
Identity = 357/825 (43.27%), Postives = 570/825 (69.09%), Query Frame = 3
Query:  300 VKIVRQFYRGSSPTSLRLESRVKELEDLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHL 2774
            ++ +R  YR SSPT  R ESR+KELE+L+DLER+ R+R E+ N++   QID LN ++EE S+   Q+ + I++R+ D+Q+LRK+ E   LQ+E  E   RK+ + S+ E+S+EIDSLQK + K EK+K  LM ELES++ ++D + K K +AEAKL+N E Q  R K + DD ++Q+ D++G K+K+S +N  L + + E   Q NS +K KS+LE  +++ KK L+EE++ R  LQ QL   Q+D++ L+ ++++ES+   +L+NQ+SKLN++L  LK KYDKE+  K++E+EE+KR+   KINEL DE ++E+ +++  EK+KQQL+IEI++L  ++D +  EN  L++ +K +E    EL  R+ DL LEL  ++   N+   +N +L+  + E  +R S L KD  +L N LK+ K+  R   + +++L+ +R Q+EADR NL AA  + K+ L D E K Q  H++L+QLK DMEQRL+EKD++L +++R+TQ+TIEELT +I   E K K+EI +L+KKYE+ + +++ +L  + K NA+L +D  + S ++ ELE+ LE+ER+ +    E L  SE++R Q+QG+L+D    LE+S++ RK  + E +E+  ++++   H+N L N+KR+LE ++ V+  D+DDAV ++  +E+R +KL +E+NRL+DEL+QE +N+ K+E+ RK+L  E+REI  +LE  E+ A++E  +  Q  Q R++++E + E E+ R KEAQ   RK ER  +E+QQQA++DRR+V +LQ LLD    K+++YKRQL+E+E  +   +NKY++AQ+ I++AE RA +AER +
Sbjct:   10 IEFIRHVYRASSPTVARQESRIKELEELLDLEREVRVRLEKTNSDFCGQIDQLNEQIEELSLSSSQYNETIRRREADLQRLRKEYEKITLQMEMAEHDNRKRNHNSMLELSTEIDSLQKQKQKFEKEKMVLMQELESMLTQIDLISKGKINAEAKLENAESQNLRFKLMLDDQEKQLRDMSGIKTKVSEDNMNLKVHINEVNHQNNSLRKSKSNLESLLEETKKQLEEETKTREFLQSQLHQTQSDNEQLKLQFEDESDNYHRLQNQVSKLNSELMFLKTKYDKEVSQKSDEFEELKRRNASKINELQDELSKEQLKSASAEKSKQQLSIEIRELYTDIDRISTENEQLIHEIKSSENFNKELTNRLHDLDLELAQIKVGLNKSNAENSKLRLSLEESDQRISSLNKDIGALTNDLKEEKENNRFLQKEVSDLQMIRNQMEADRGNLLAALEETKERLIDSEHKNQLAHNSLLQLKTDMEQRLQEKDEDLLTIKRNTQKTIEELTSSIANAEAKLKTEIAKLRKKYETDLKDIQNELFESQKENAQLIEDLKNNSAKLIELEQNLEEERQQYNVIQEKLFSSEKRRNQMQGDLEDSNRLLEASDKTRKKIQFEIEEISMKLADSFSHINCLNNEKRKLESEIVVLHNDVDDAVVSKLESEERISKLTSEINRLSDELKQEHENHNKSETTRKSLMSELREIKSRLESRESTASQEIIKNTQIFQDRIKDIEIELENERLRNKEAQNSIRKQERSMREIQQQADEDRRVVNDLQQLLDGANAKIKSYKRQLDELEAANVDNINKYKRAQKLIDEAEHRASIAERRI 834          
BLAST of Paramyosin vs. Planmine SMEST
Match: SMESG000013389.1 (SMESG000013389.1)

HSP 1 Score: 350.903 bits (899), Expect = 4.985e-101
Identity = 279/832 (33.53%), Postives = 501/832 (60.22%), Query Frame = 3
Query:  351 LESRVKELEDLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHL-----------TVRRSGSVMPGST 2813
            L++R++ELE+ ++ ER AR ++E+   +L  +++ L+ R+EE         D  KKR+ ++ KL++DLE +N+Q + V    RKK    + E S ++D LQK + K EK+K+ +  +L  + G+L+ + KAK +++ ++  +E Q   L+   ++  R +ND N    K    N EL   ++E E+QIN   K+K  ++ Q+++ ++  ++ESR +  L   ++ L AD D+L+   +EE+E    ++ Q+ K   ++  LK K++    +++EE +E KRK   +I+EL +EA   +S+A  LEK K +L  EI+D+  +VD      + L  + K  + + +E Q++  +   EL + +  +  ++ +  R+KAQ+ E  E+   ++++N +LA+++ DL + + +  R + E++  R +LE +++ L  A  +A+ AL+  E K Q +   + Q++ ++++RL EK++E E+ R + QR +E +  ++     + ++E  ++KKK E  I ELE+ +D AN+  ++  K+     +++ EL   +EDE+   +   E  +++ERK   +  ELD++R  LE+SER RKN ENE  E+  R++EL++  +  +  KR+LE DL  +Q DL++A    + A ++A K   +  RL DE+RQEQ++ ++ + ++K LE + +E+  KL+E+E  A + GK+A+ KL+ R+RELEA+ + EQ+R  E+Q  +RK ER+ KEL  Q ++D++    LQDL++K Q K++ YKRQ+EE E+++ V + KYRK QQ+IED+E+RAD AE+ L           +  R GS+ PG T
Sbjct: 1095 LQARIQELEEDLEAERQARAKAEKSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQKVKAKVEKEKNEMKEDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEDESRAKAKLSSDIRNLNADLDNLREALEEENENKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLEMEKEELQHALEEAEQALEQEEAKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRAMESMEASLEAES-RGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELDEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNALKGGKKALSKLEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGMT 1925          
BLAST of Paramyosin vs. Planmine SMEST
Match: SMESG000013389.1 (SMESG000013389.1)

HSP 1 Score: 350.903 bits (899), Expect = 5.269e-101
Identity = 279/832 (33.53%), Postives = 501/832 (60.22%), Query Frame = 3
Query:  351 LESRVKELEDLIDLERDARMRSERLNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQLESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGELDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSENYELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQGLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTEEYEEIKRKLTIKINELADXXXXXXXXXXGLEKTKQQLTIEIKDLQNEVDLLGAENADLLNRLKHAEGLAAELQKRIDDXXXXXXXXXXXXXQLATDNMRLKAQVSELLERNSHLEKDNNSLANQLKDLKDALRDXXXXXXXXXXXXXXXXXDRDNLSXXXXXXXXXXXXXEQKYQSTHSALIQLKADMEQRLREKDDELESLRRSTQRXXXXXXXXXXXXXVKYKSEINRLKKKYESTITELEIQLDNANKYNAKLAKDNNDXXXXXXXXXXXXXXXXXXXXXTNESLSISERKRVQLQGELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGDLGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLRKTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRCKEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLEEIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHL-----------TVRRSGSVMPGST 2813
            L++R++ELE+ ++ ER AR ++E+   +L  +++ L+ R+EE         D  KKR+ ++ KL++DLE +N+Q + V    RKK    + E S ++D LQK + K EK+K+ +  +L  + G+L+ + KAK +++ ++  +E Q   L+   ++  R +ND N    K    N EL   ++E E+QIN   K+K  ++ Q+++ ++  ++ESR +  L   ++ L AD D+L+   +EE+E    ++ Q+ K   ++  LK K++    +++EE +E KRK   +I+EL +EA   +S+A  LEK K +L  EI+D+  +VD      + L  + K  + + +E Q++  +   EL + +  +  ++ +  R+KAQ+ E  E+   ++++N +LA+++ DL + + +  R + E++  R +LE +++ L  A  +A+ AL+  E K Q +   + Q++ ++++RL EK++E E+ R + QR +E +  ++     + ++E  ++KKK E  I ELE+ +D AN+  ++  K+     +++ EL   +EDE+   +   E  +++ERK   +  ELD++R  LE+SER RKN ENE  E+  R++EL++  +  +  KR+LE DL  +Q DL++A    + A ++A K   +  RL DE+RQEQ++ ++ + ++K LE + +E+  KL+E+E  A + GK+A+ KL+ R+RELEA+ + EQ+R  E+Q  +RK ER+ KEL  Q ++D++    LQDL++K Q K++ YKRQ+EE E+++ V + KYRK QQ+IED+E+RAD AE+ L           +  R GS+ PG T
Sbjct: 1086 LQARIQELEEDLEAERQARAKAEKSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQKVKAKVEKEKNEMKEDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEDESRAKAKLSSDIRNLNADLDNLREALEEENENKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLEMEKEELQHALEEAEQALEQEEAKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRAMESMEASLEAES-RGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELDEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNALKGGKKALSKLEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGMT 1916          
The following BLAST results are available for this feature:
BLAST of Paramyosin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYH76.580e-10135.71myosin heavy chain 7 [Source:HGNC Symbol;Acc:HGNC:... [more]
MYH62.414e-10035.13myosin heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:... [more]
MYH11.943e-9933.46myosin heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
MYH41.777e-9833.25myosin heavy chain 4 [Source:HGNC Symbol;Acc:HGNC:... [more]
MYH24.509e-9833.46myosin heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Paramyosin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-549.843e-9534.68Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566][more]
unc-549.843e-9534.68Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566][more]
unc-549.843e-9534.68Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566][more]
myo-59.336e-9031.44MYOsin heavy chain structural genes [Source:UniPr... [more]
unc-157.489e-8932.97Paramyosin [Source:UniProtKB/Swiss-Prot;Acc:P1056... [more]
back to top
BLAST of Paramyosin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mhc9.723e-10838.26gene:FBgn0264695 transcript:FBtr0346712[more]
Mhc1.019e-10738.26gene:FBgn0264695 transcript:FBtr0307494[more]
Mhc1.841e-10738.26gene:FBgn0264695 transcript:FBtr0080897[more]
Mhc2.031e-10637.80gene:FBgn0264695 transcript:FBtr0301829[more]
Mhc2.332e-10638.39gene:FBgn0264695 transcript:FBtr0080906[more]
back to top
BLAST of Paramyosin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myhz1.12.229e-10433.84myosin, heavy polypeptide 1.1, skeletal muscle [So... [more]
myhb8.910e-10433.71myosin, heavy chain b [Source:ZFIN;Acc:ZDB-GENE-08... [more]
myhb8.910e-10433.71myosin, heavy chain b [Source:ZFIN;Acc:ZDB-GENE-08... [more]
myh7l2.178e-10335.45myosin heavy chain 7-like [Source:ZFIN;Acc:ZDB-GEN... [more]
myh7l3.518e-10335.45myosin heavy chain 7-like [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Paramyosin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcmf14.685e-10533.89potassium channel modulatory factor 1 [Source:Xenb... [more]
kcmf17.285e-10534.02potassium channel modulatory factor 1 [Source:Xenb... [more]
kcmf18.240e-10533.89potassium channel modulatory factor 1 [Source:Xenb... [more]
kcmf18.327e-10534.02potassium channel modulatory factor 1 [Source:Xenb... [more]
kcmf14.716e-10433.25potassium channel modulatory factor 1 [Source:Xenb... [more]
back to top
BLAST of Paramyosin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Myh71.778e-10035.58myosin, heavy polypeptide 7, cardiac muscle, beta ... [more]
Myh71.778e-10035.58myosin, heavy polypeptide 7, cardiac muscle, beta ... [more]
Myh131.226e-9932.61myosin, heavy polypeptide 13, skeletal muscle [Sou... [more]
Myh131.226e-9932.61myosin, heavy polypeptide 13, skeletal muscle [Sou... [more]
Myh131.226e-9932.61myosin, heavy polypeptide 13, skeletal muscle [Sou... [more]
back to top
BLAST of Paramyosin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q05870|MYSP_SCHJA0.000e+062.69Paramyosin OS=Schistosoma japonicum OX=6182 PE=2 S... [more]
sp|P06198|MYSP_SCHMA0.000e+061.77Paramyosin OS=Schistosoma mansoni OX=6183 PE=2 SV=... [more]
sp|P35418|MYSP_TAESO0.000e+062.40Paramyosin OS=Taenia solium OX=6204 GN=PMY PE=1 SV... [more]
sp|Q8T305|MYSP_TAESA0.000e+062.28Paramyosin OS=Taenia saginata OX=6206 GN=PMY PE=2 ... [more]
sp|P35417|MYSP_ECHGR0.000e+062.75Paramyosin OS=Echinococcus granulosus OX=6210 PE=2... [more]
back to top
BLAST of Paramyosin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2CSX20.000e+062.80Paramyosin isoform 1 OS=Schistosoma japonicum OX=6... [more]
B1PS360.000e+062.69Paramyosin OS=Schistosoma japonicum OX=6182 PE=2 S... [more]
B1PS350.000e+062.57Paramyosin OS=Schistosoma japonicum OX=6182 PE=2 S... [more]
A0A2H1CQG20.000e+062.92Myosin tail OS=Fasciola hepatica OX=6192 GN=D915_0... [more]
A0A504Z2900.000e+062.92Paramyosin OS=Fasciola gigantica OX=46835 GN=FGIG_... [more]
back to top
BLAST of Paramyosin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000039595.17.607e-10534.59myosin heavy chain, fast skeletal muscle-like [Sou... [more]
ENSAMXT00000036333.11.166e-10434.07myosin heavy chain, fast skeletal muscle-like [Sou... [more]
ENSAMXT00000042907.11.692e-10334.21myosin heavy chain, fast skeletal muscle-like [Sou... [more]
ENSAMXT00000004509.22.490e-10332.85myosin-1-like [Source:NCBI gene;Acc:103027891][more]
ENSAMXT00000057167.11.704e-10233.92pep primary_assembly:Astyanax_mexicanus-2.0:22:187... [more]
back to top
BLAST of Paramyosin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005905.14.085e-9834.55pep scaffold:Pmarinus_7.0:GL476612:176223:319014:-... [more]
ENSPMAT00000002731.14.102e-8833.67pep scaffold:Pmarinus_7.0:GL478284:11062:40470:1 g... [more]
ENSPMAT00000003821.15.491e-5133.91pep scaffold:Pmarinus_7.0:GL477325:10535:35195:1 g... [more]
ENSPMAT00000005818.17.690e-4636.62pep scaffold:Pmarinus_7.0:GL484421:7309:13492:-1 g... [more]
ENSPMAT00000005582.12.069e-3643.85pep scaffold:Pmarinus_7.0:GL481917:38212:72095:-1 ... [more]
back to top
BLAST of Paramyosin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Paramyosin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO448938.739e-740.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Paramyosin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000029659.12.904e-10334.14myosin heavy chain, fast skeletal muscle-like [Sou... [more]
ENSORLT00000038488.14.232e-10334.14myosin heavy chain, fast skeletal muscle-like [Sou... [more]
ENSORLT00000002483.27.141e-10334.14myosin heavy chain, fast skeletal muscle-like [Sou... [more]
ENSORLT00000027078.18.138e-10334.01myosin heavy chain, fast skeletal muscle-like [Sou... [more]
ENSORLT00000007759.23.801e-10233.96myosin heavy chain, fast skeletal muscle [Source:N... [more]
back to top
BLAST of Paramyosin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016909.10.000e+0100.00SMESG000016909.1[more]
SMESG000058328.10.000e+060.67SMESG000058328.1[more]
SMESG000009422.12.606e-16043.27SMESG000009422.1[more]
SMESG000013389.14.985e-10133.53SMESG000013389.1[more]
SMESG000013389.15.269e-10133.53SMESG000013389.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001807 ID=SMED30001807|Name=Paramyosin|organism=Schmidtea mediterranea sexual|type=transcript|length=3112bp
TCCGATCTGTGCACATTACCGGGGCACACATTTGAAAAGTGAACATTCAG
TAAAGCATCGTAGATGTATGCTTAATATCCAGATGGGGGGTTACATGTTT
GGATATAATACAAGCTATCGTAGAAACTTTATAAATATTTCCCTGACACT
TTTTCGACAAAATATCTATAACTATTTCGACGTTTTCTTGGATTACGTTT
CTCGATTATTTGTCTTATAAATATTTTAGTGAAAAATTTTCTTTTTTCCA
ACTTTAAGCCAAAAGCCAAACCATGAATAGTAATTCTAGTGAGAGTCATG
TAAAAATTGTGAGACAATTCTATCGAGGATCATCTCCAACATCTTTACGA
TTGGAATCGAGAGTCAAAGAGCTTGAAGACTTAATAGACCTTGAAAGAGA
TGCCAGAATGAGATCCGAACGTTTGAATGCTGAGTTGACCTATCAAATAG
ATGCACTGAATGCCAGAATGGAAGAAAATTCAATTTTTGGAATGCAACAT
CAAGATGCAATCAAAAAACGAGACATGGATATTCAGAAATTGCGGAAAGA
CCTGGAAGTTGCTAATTTGCAATTAGAATCAGTCGAACAAGGTTTAAGAA
AGAAATACAATTTATCAATAACAGAAATGTCATCTGAAATTGATAGCCTT
CAAAAGTTTCGTGGAAAAGCTGAAAAGGATAAAAGCAATTTAATGATGGA
ATTGGAAAGCGTAATTGGAGAATTAGATGGTGTAAGAAAAGCAAAAAACT
CCGCTGAAGCTAAATTAGACAACTTAGAGGGTCAAGTTCATCGATTAAAA
AGTGTGAATGATGATTTACAAAGACAAGTCAATGACTTAAATGGAGCCAA
GTCCAAGTTATCTTCAGAAAATTACGAATTGACAATTGTTGTTCAAGAAT
ACGAAACTCAAATTAATTCTTTTAAGAAAATCAAATCTTCATTAGAAATT
CAAGTTGATGATTTAAAAAAAGCCTTAGATGAAGAATCAAGAATACGAAT
CACTCTACAGGGTCAATTACAAGGACTTCAAGCTGACCATGACAGTTTAC
AAGCTAGATATGATGAAGAAAGTGAAGCAGCTGGGAAATTAAGAAACCAA
ATATCAAAATTAAACGCCGATCTAGCAGGCCTTAAAGGAAAATACGACAA
AGAAATAATGATGAAAACTGAAGAATATGAAGAAATAAAGCGTAAATTAA
CAATTAAAATAAACGAGTTAGCCGACGAAGCTGCCAGAGAACGATCAAGA
GCATCAGGATTAGAAAAGACCAAACAACAACTCACAATTGAGATAAAAGA
TTTACAAAATGAAGTTGATTTGCTTGGTGCTGAAAATGCGGATCTTTTGA
ACCGCTTGAAACACGCTGAAGGTTTGGCTGCTGAACTTCAAAAGCGAATA
GATGATTTATCACTGGAATTGAACAGCTTACGGTCCTCAAATAACCAATT
GGCTACTGACAATATGAGACTCAAAGCCCAAGTTAGCGAACTACTAGAAC
GAAATAGTCATTTAGAAAAAGATAATAACAGTCTTGCGAACCAATTGAAG
GATCTGAAAGATGCGCTAAGAGATGCCAACCGACGCATTGCCGAATTGGA
AGCATTGCGAGCACAATTGGAAGCTGATAGAGATAATTTATCAGCTGCTT
ATGCCGATGCGAAAGACGCATTGAAAGATCTGGAACAAAAGTACCAGAGT
ACACACAGTGCTTTGATACAACTGAAAGCCGACATGGAACAACGATTGCG
AGAGAAAGACGATGAATTGGAGTCATTGAGACGATCGACACAGAGGACAA
TCGAGGAATTGACTATAACAATCACAGAAATCGAAGTGAAATACAAATCA
GAAATCAATCGATTGAAAAAGAAATACGAATCGACAATCACAGAATTGGA
AATCCAATTGGACAATGCAAACAAATACAACGCCAAATTAGCAAAGGACA
ATAATGATTTGTCGAGACGAATTGCTGAATTGGAACGGGAACTCGAGGAC
GAGAGAAGAGCTCATGAAGCAACCAATGAGAGTTTATCGATCAGCGAACG
GAAACGAGTGCAATTGCAAGGGGAGCTCGATGATTTGAGGAACCAACTGG
AATCATCAGAGAGAGCGAGAAAGAATGCAGAAAATGAAGCCCAGGAGCTC
GGTGGACGCGTGAGCGAGTTGACACTGCACGTGAACACGCTGATCAATGA
CAAGCGGCGGCTGGAGGGAGATCTGGGGGTGATCCAGGGCGATCTCGATG
ATGCAGTGAATGCTCGACAGGCTGCCGAGGACAGGGCCAACAAATTGAAC
AATGAAGTGAACCGATTGGCCGACGAGCTGAGACAGGAACAGGACAACTA
TAAGAAGGCGGAATCGCTTAGGAAGACGTTGGAAATCGAAATCCGAGAAA
TAACGGTGAAACTAGAGGAAGCCGAGGCCTACGCTACGAGAGAGGGGAAA
CGCGCGGTCCAGAAATTGCAGGTGAGGCTGAGGGAGCTCGAGGCCGATTT
CGAGGCGGAACAAAGGAGATGCAAGGAAGCACAAGCTCAAGCAAGGAAAT
TCGAGAGACAATTCAAGGAATTACAACAACAAGCTGAAGATGACCGCAGG
ATGGTTGTGGAGCTGCAAGACCTGTTAGACAAGACTCAATTGAAGATGCG
AGCTTATAAACGGCAATTAGAGGAAATTGAAGATGTGAGCACTGTGGCAA
TGAACAAATATCGCAAAGCCCAGCAACAGATTGAGGATGCGGAGCAACGG
GCTGACATGGCTGAACGACATTTGACTGTCAGGCGATCCGGCAGCGTGAT
GCCAGGATCAACTTATCGAGCTATTTCGGTGGTGAGAGAAACCTCAACTC
TAAATAGTTCTCGAGGAGCTCGAGCAACCAGCATCCGCTAATCATTAATT
TGTCAAATGAAAAAGAATTTTTTTAAAATAGAAAACTTTTTCAATAACAG
CTTTTGGTCCGATGCGCTGACCTTACCTTATGACCTTTAAATTATTAATT
TATTTGAATTGTTTCGAATGATTTTCCTTTCGGAGTTTATTGATTCTGTG
GCTAATTTAGTTATATTCAATATATTTGAAAATAAATATTTGTCCTTCAA
AAAAAAAGATCG
back to top

protein sequence of SMED30001807-orf-1

>SMED30001807-orf-1 ID=SMED30001807-orf-1|Name=SMED30001807-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=873bp
MNSNSSESHVKIVRQFYRGSSPTSLRLESRVKELEDLIDLERDARMRSER
LNAELTYQIDALNARMEENSIFGMQHQDAIKKRDMDIQKLRKDLEVANLQ
LESVEQGLRKKYNLSITEMSSEIDSLQKFRGKAEKDKSNLMMELESVIGE
LDGVRKAKNSAEAKLDNLEGQVHRLKSVNDDLQRQVNDLNGAKSKLSSEN
YELTIVVQEYETQINSFKKIKSSLEIQVDDLKKALDEESRIRITLQGQLQ
GLQADHDSLQARYDEESEAAGKLRNQISKLNADLAGLKGKYDKEIMMKTE
EYEEIKRKLTIKINELADEAARERSRASGLEKTKQQLTIEIKDLQNEVDL
LGAENADLLNRLKHAEGLAAELQKRIDDLSLELNSLRSSNNQLATDNMRL
KAQVSELLERNSHLEKDNNSLANQLKDLKDALRDANRRIAELEALRAQLE
ADRDNLSAAYADAKDALKDLEQKYQSTHSALIQLKADMEQRLREKDDELE
SLRRSTQRTIEELTITITEIEVKYKSEINRLKKKYESTITELEIQLDNAN
KYNAKLAKDNNDLSRRIAELERELEDERRAHEATNESLSISERKRVQLQG
ELDDLRNQLESSERARKNAENEAQELGGRVSELTLHVNTLINDKRRLEGD
LGVIQGDLDDAVNARQAAEDRANKLNNEVNRLADELRQEQDNYKKAESLR
KTLEIEIREITVKLEEAEAYATREGKRAVQKLQVRLRELEADFEAEQRRC
KEAQAQARKFERQFKELQQQAEDDRRMVVELQDLLDKTQLKMRAYKRQLE
EIEDVSTVAMNKYRKAQQQIEDAEQRADMAERHLTVRRSGSVMPGSTYRA
ISVVRETSTLNSSRGARATSIR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
Vocabulary: INTERPRO
TermDefinition
IPR042180IF_rod_dom_coil1B
IPR002928Myosin_tail
Vocabulary: molecular function
TermDefinition
GO:0003774motor activity
Vocabulary: cellular component
TermDefinition
GO:0016459myosin complex
GO:0032982myosin filament
GO:0005737cytoplasm
GO:0030016myofibril
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 151..199
NoneNo IPR availableCOILSCoilCoilcoord: 299..512
NoneNo IPR availableCOILSCoilCoilcoord: 249..290
NoneNo IPR availableCOILSCoilCoilcoord: 87..107
NoneNo IPR availableCOILSCoilCoilcoord: 525..636
NoneNo IPR availableCOILSCoilCoilcoord: 207..241
NoneNo IPR availableCOILSCoilCoilcoord: 34..54
NoneNo IPR availableCOILSCoilCoilcoord: 658..720
NoneNo IPR availableCOILSCoilCoilcoord: 722..833
NoneNo IPR availableGENE3DG3DSA:1.20.5.340coord: 644..742
e-value: 3.2E-5
score: 25.9
NoneNo IPR availablePANTHERPTHR34491:SF5coord: 27..836
NoneNo IPR availablePANTHERPTHR34491FAMILY NOT NAMEDcoord: 27..836
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 659..773
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 151..267
NoneNo IPR availableSUPERFAMILYSSF57997Tropomyosincoord: 592..695
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 353..464
IPR002928Myosin tailPFAMPF01576Myosin_tail_1coord: 27..838
e-value: 8.2E-73
score: 245.8
IPR042180Intermediate filament, rod domain, coil 1BGENE3DG3DSA:1.20.5.1160coord: 175..272
e-value: 1.5E-6
score: 30.3