NADH dehydrogenase subunit 5

Overview
NameNADH dehydrogenase subunit 5 (YP_008592430.2)
Smed IDSMED30001799
Length (bp)1596
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NADH dehydrogenase subunit 5 (SMED30001799) t-SNE clustered cells

Violin plots show distribution of expression levels for NADH dehydrogenase subunit 5 (SMED30001799) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NADH dehydrogenase subunit 5 (SMED30001799) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NADH dehydrogenase subunit 5 (SMED30001799) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001799

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30001799 dd_Smed_v4_258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001799 dd_Smed_v4_258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001799 dd_Smed_v4_258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001799 dd_Smed_v4_258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30001799 dd_Smed_v4_957_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001799 dd_Smed_v4_957_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30001799SMESG000061907.1 Contig47838newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30001799SMESG000061907.1 Contig47838uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30001799 dd_Smed_v6_957_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30001799 dd_Smed_v6_957_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NADH dehydrogenase subunit 5 vs. Ensembl Human
Match: MT-ND5 (mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 5 [Source:HGNC Symbol;Acc:HGNC:7461])

HSP 1 Score: 133.265 bits (334), Expect = 1.455e-32
Identity = 91/317 (28.71%), Postives = 162/317 (51.10%), Query Frame = 1
Query:  151 VIFVAILFVIVGSVVSFMVYYFSLEINLIRFVYLFKFFVFSMVLLIVSPSFFSFLVG*DGLGFISFFLVS*-YGCGSRLTSSLKTFLVKRLGDSLYLVSFVWYFSRFSFSVNSFDCFVVFILG---------------LALCTKRAIYPFSY*LPEAMAAPTPVSALVHSSTLVVAGLYILFRLFDCXXXXXXXXXXXXXXXXXXX--GSFRALFTLDFKKLVAYSTLSQLGFLGCILSYGCFDLFFYYLIVHALFKASMFIVLGTFMVVGSHNQDVRLLNSLGYSTPLVSFFMLLDVSSLFGVPFLSSFYMKELVI 1047
            ++F+ +   +  S++ F ++Y + + N+ +F      F+ +M++L+ + + F   +G +G+G +SF L+S  Y      T++++  L  R+GD  ++++  W    F    NS+D   + +L                     +  ++P+   LP AM  PTPVSAL+HSST+VVAG+++L R         +     L L  +     +  AL   D KK+VA+ST SQLG +   +      L F ++  HA FKA +F+  G+ +   ++ QD+R +  L  + PL S  + +   +L G+PFL+ FY K+ +I
Sbjct:   87 MMFIPVALFVTWSIMEFSLWYMNSDPNINQFFKYLLIFLITMLILVTANNLFQLFIGWEGVGIMSFLLISWWYARADANTAAIQAILYNRIGDIGFILALAW----FILHSNSWDPQQMALLNANPSLTPLLGLLLAAAGKSAQLGLHPW---LPSAMEGPTPVSALLHSSTMVVAGIFLLIRFHPLAENSPLIQTLTLCLGAITTLFAAVCALTQNDIKKIVAFSTSSQLGLMMVTIGINQPHLAFLHICTHAFFKAMLFMCSGSIIHNLNNEQDIRKMGGLLKTMPLTSTSLTIGSLALAGMPFLTGFYSKDHII 396          
BLAST of NADH dehydrogenase subunit 5 vs. Ensembl Celegans
Match: nduo-5 (NADH-ubiquinone oxidoreductase chain 5 [Source:UniProtKB/Swiss-Prot;Acc:P24896])

HSP 1 Score: 114.005 bits (284), Expect = 9.822e-27
Identity = 111/303 (36.63%), Postives = 159/303 (52.48%), Query Frame = 1
Query:  148 RVIFVAILFVIVGSVVSFMVYYFSLEINLIRFVYLFKFFVFSMVLLIVSPSFFSFLVG*DGLGFISFFLVS*YGCGSRLTSSLKTFLVKRLGDSLYLVSF-VWYFSRFSFSVNSFDCFVVFILGLALC-TKRAIYPFSY*LPEAMAAPTPVSALVHSSTLVVAGLYILFRLFDCXXXXXXXXXXXXX-XXXXXXGSFRALFTLDFKKLVAYSTLSQLGFLGCILSYGCFDLFFYYLIVHALFKASMFIVLGTFMVVGSHNQDVRLLNSLGYSTPLVSFFMLLDVSSLFGVPFLSSFYMKELVI 1047
             ++F  ILF++  SV+ F  YY + E+N   + ++   FV SM  L  S S F+ L+  D LG  SFFLV  Y      + ++ T L  RLGD    V F +  FS + F   S     + +L L    TK A +PFS  LP+AM+APTPVS+LVHSSTLV AGL +L    + +       F  +  L T+F  S  +L   D KK+VA STLSQ+GF    L  G   + F +L+ HALFK+ +F+ +G  +      QD R  ++ G     +   ML+ +  L G+ F S    K+ ++
Sbjct:   47 SILFSFILFLVTFSVLVFSTYYLNSELNFNYYYFVLLIFVGSMFSLNFSNSIFTMLLSWDLLGISSFFLVLFYNNWDSCSGAMNTALTNRLGDYFMFVFFGLSVFSGYYFLSFSMFSSYMSLLLLLTAFTKSAQFPFSSWLPKAMSAPTPVSSLVHSSTLVTAGLILLMNFNNLVMQKDFISFVLIIGLFTMFFSSLASLVEEDLKKVVALSTLSQMGFSMVTLGLGLSFISFIHLVSHALFKSCLFMQVGYIIHCSFGQQDGRNYSNNGNLPNFIQLQMLVTLFCLCGLIFSSGAVSKDFIL 349          
BLAST of NADH dehydrogenase subunit 5 vs. Ensembl Fly
Match: mt:ND5 (gene:FBgn0013684 transcript:FBtr0433501)

HSP 1 Score: 167.933 bits (424), Expect = 3.503e-45
Identity = 118/310 (38.06%), Postives = 178/310 (57.42%), Query Frame = 1
Query:  151 VIFVAILFVIVGSVVSFMVYYFSLEINLIRFVYLFKFFVFSMVLLIVSPSFFSFLVG*DGLGFISFFLVS*YGCGSRLTSSLKTFLVKRLGDSLYLVSFVWYFSRFSFS--------VNSFDCFVV-FILGLALCTKRAIYPFSY*LPEAMAAPTPVSALVHSSTLVVAGLYILFRLFDCXXXXXXXXXXXXXX--XXXXXGSFRALFTLDFKKLVAYSTLSQLGFLGCILSYGCFDLFFYYLIVHALFKASMFIVLGTFMVVGSHNQDVRLLNSLGYSTPLVSFFMLLDVSSLFGVPFLSSFYMKELVI 1047
            ++F++ + +I   V+ +   Y   + ++ RF+ L   FV SM+LLI+SP+  S L+G DGLG +S+ LV  +       + + T L  R+GD   L+S  W  +  S++         N F+  ++  ++ LA  TK A  PFS  LP AMAAPTPVSALVHSSTLV AG+Y+L R F+ +          L L  +T+F+    A F  D KK++A STLSQLG +  ILS G   L  ++L+ HALFKA +F+  G  +   +++QD+RL+  L    PL S    +   +L G+PFL+ FY K++++
Sbjct:   55 LLFMSFVLMISSLVIFYSKEYMMNDNHINRFIMLVLMFVLSMMLLIISPNLISILLGWDGLGLVSYCLVIYFQNIKSYNAGMLTALSNRIGDVALLLSIAWMLNYGSWNYIFYLEIMQNEFEMLMIGSLVMLAAMTKSAQIPFSSWLPAAMAAPTPVSALVHSSTLVTAGVYLLIR-FNIILSTSWLGQLMLLLSGLTMFMAGLGANFEFDLKKIIALSTLSQLGLMMSILSMGFLKLAMFHLLTHALFKALLFMCAGAIIHNMNNSQDIRLMGGLSIHMPLTSACFNVSNLALCGMPFLAGFYSKDMIL 363          
BLAST of NADH dehydrogenase subunit 5 vs. Ensembl Zebrafish
Match: mt-nd5 (NADH dehydrogenase subunit 5 [Source:NCBI gene;Acc:140535])

HSP 1 Score: 133.265 bits (334), Expect = 1.009e-32
Identity = 94/315 (29.84%), Postives = 160/315 (50.79%), Query Frame = 1
Query:  151 VIFVAILFVIVGSVVSFMVYYFSLEINLIRFVYLFKFFVFSMVLLIVSPSFFSFLVG*DGLGFISFFLVS*Y-GCGSRLTSSLKTFLVKRLGDSLYLVSFVWYFSRFSFSVNSFDCFVVFILG-------------LALCTKRAIYPFSY*LPEAMAAPTPVSALVHSSTLVVAGLYILFRLFDCXXXXXXXXXXXXXXXXXXX--GSFRALFTLDFKKLVAYSTLSQLGFLGCILSYGCFDLFFYYLIVHALFKASMFIVLGTFMVVGSHNQDVRLLNSLGYSTPLVSFFMLLDVSSLFGVPFLSSFYMKELVI 1047
            V F +I   I  S++ F  +Y +       F      F+ SM++L+ + + F   +G +G+G +SF L+  + G     T+SL+  +  R+GD  ++++  W     +  +NS+D   +FIL              +A   K A +     LP AM  PTPVSAL+HSST+VVAG+++L RL   +    +     L L  L     +  AL   D KK+VA+ST SQLG +   +      L F+++  HA FKA +F+  G  +   ++ QD+R +    ++ P+ + ++ +   +L G PFL+ F+ K+ ++
Sbjct:   87 VTFTSIALFITWSILEFASWYMASYPQKELFYKYLLLFLMSMIILVTANNLFQLFIGWEGVGIMSFLLIGWWFGRTEANTASLQAVIYNRMGDIGFILTLAW----MAMYLNSWDIQQIFILSKDFDMTIPQIGLIIAATGKSAQFTLHPWLPSAMEGPTPVSALLHSSTMVVAGIFLLIRLHPIMETNKLAPTICLCLGALTTLFAATCALTQNDIKKIVAFSTSSQLGLMMVAIGLNQPHLAFFHICTHAFFKAMLFLCSGAIIHSLNNEQDIRKMGGTYHTLPMTTNYLTIGKMALMGTPFLAGFFSKDAIL 397          
BLAST of NADH dehydrogenase subunit 5 vs. Ensembl Xenopus
Match: dennd2c (DENN/MADD domain containing 2C [Source:Xenbase;Acc:XB-GENE-5955506])

HSP 1 Score: 139.428 bits (350), Expect = 1.197e-34
Identity = 103/319 (32.29%), Postives = 165/319 (51.72%), Query Frame = 1
Query:  154 IFVAILFVIVGSVVSFMVYYFSLEINLIRF-VYLFKFFVFSMVLLIVSPSFFSFLVG*DGLGFISFFLVS*-YGCGSRLTSSLKTFLVKRLGDSLYLVSFVWYFSRFSFSVNSFDCFVVFILG------------LALCTKRAIYPFSY*LPEAMAAPTPVSALVHSSTLVVAGLYILFRLFDCXXXXXXXXXXXXXXXXXXXGSFRALFTL-------DFKKLVAYSTLSQLGFLGCILSYGCFDLFFYYLIVHALFKASMFIVLGTFMVVGSHNQDVRLLNSLGYSTPLVSFFMLLDVSSLFGVPFLSSFYMKELVI 1047
            IF+ I   +  S++ F  +Y + +  + RF  YL  F V +MV+L+ + +FF   +G +G+G +SF L+   Y      T++L+  +  R+GD   ++S  W     + ++NS++   VF+L             LA   K A +     LP AM  PTPVSAL+HSST+VVAG+++L R+        I   +    I L LG+   LFT        D KK+VA+ST SQLG +   +      L F+++  HA FKA +F+  G+ +   +  QD+R +  L  S P  +  + +   +L G PFL+ F+ K+ +I
Sbjct:   90 IFLPIALFVTWSILEFATWYMASDPLITRFFKYLLTFLV-AMVILVTANNFFQLFIGWEGVGIMSFLLIGWWYARADANTAALQAVIYNRVGDIGLILSMAW----VAMNLNSWEMQQVFMLNPENLTLPLLGLILAATGKSAQFGLHPWLPAAMEGPTPVSALLHSSTMVVAGIFLLIRIHP-----MIQNNNTALTICLCLGAITTLFTAACALTQNDIKKIVAFSTSSQLGLMMVTIGLNLPQLAFFHICTHAFFKAMLFLCSGSIIHSLNDEQDIRKMGGLQNSLPTTTTCLTIGSLALTGTPFLAGFFSKDAII 398          
BLAST of NADH dehydrogenase subunit 5 vs. Ensembl Mouse
Match: mt-Nd5 (mitochondrially encoded NADH dehydrogenase 5 [Source:MGI Symbol;Acc:MGI:102496])

HSP 1 Score: 144.05 bits (362), Expect = 1.849e-36
Identity = 97/315 (30.79%), Postives = 165/315 (52.38%), Query Frame = 1
Query:  151 VIFVAILFVIVGSVVSFMVYYFSLEINLIRFVYLFKFFVFSMVLLIVSPSFFSFLVG*DGLGFISFFLVS*-YGCGSRLTSSLKTFLVKRLGDSLYLVSFVWY--------FSRFSFSVNSFDCFVVFILGLALCTKRAIYPFSY*LPEAMAAPTPVSALVHSSTLVVAGLYILFRLFDCXXXXXXXXXXXXXXXXXXXGSFRALFTL-------DFKKLVAYSTLSQLGFLGCILSYGCFDLFFYYLIVHALFKASMFIVLGTFMVVGSHNQDVRLLNSLGYSTPLVSFFMLLDVSSLFGVPFLSSFYMKELVI 1047
            ++F ++   +  S++ F  +Y   + N+ RF+     F+ +M++L  + + F   +G +G+G +SF L+   YG     T++L+  L  R+GD  ++++ VW+          +  FS N+ +   +  L +A   K A +     LP AM  PTPVSAL+HSST+VVAG+++L R             +F+    L LG+   LFT        D KK++A+ST SQLG +   L      L F ++  HA FKA +F+  G+ +   +  QD+R + ++    P  S  +++   +L G+PFL+ FY K+L+I
Sbjct:   87 ILFTSVALFVTWSIMQFSSWYMHSDPNINRFIKYLTLFLITMLILTSANNMFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAILYNRIGDIGFILAMVWFSLNMNSWELQQIMFSNNNDNLIPLMGLLIAATGKSAQFGLHPWLPSAMEGPTPVSALLHSSTMVVAGIFLLVRFHP-----LTTNNNFILTTMLCLGALTTLFTAICALTQNDIKKIIAFSTSSQLGLMMVTLGMNQPHLAFLHICTHAFFKAMLFMCSGSIIHSLADEQDIRKMGNITKIMPFTSSCLVIGSLALTGMPFLTGFYSKDLII 396          
BLAST of NADH dehydrogenase subunit 5 vs. UniProt/SwissProt
Match: sp|P34855|NU5M_APILI (NADH-ubiquinone oxidoreductase chain 5 OS=Apis mellifera ligustica OX=7469 GN=ND5 PE=3 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 1.099e-50
Identity = 115/277 (41.52%), Postives = 167/277 (60.29%), Query Frame = 1
Query:  223 EINLIRFVYLFKFFVFSMVLLIVSPSFFSFLVG*DGLGFISFFLVS*YGCGSRLTSSLKTFLVKRLGDS--LYLVSFVWYFSRFSFSVNSFDCFVVFILGLALCTKRAIYPFSY*LPEAMAAPTPVSALVHSSTLVVAGLYILFRLFDCXXXXXXXXXXXXXXXXXXXGSFRALFTLDFKKLVAYSTLSQLGFLGCILSYGCFDLFFYYLIVHALFKASMFIVLGTFMVVGSHNQDVRLLNSLGYSTPLVSFFMLLDVSSLFGVPFLSSFYMKELVI 1047
            E+ + RF+YL   F+ SM +LI+SP+  S ++G DGLG IS+ LV  Y      TS + T L+ RLGD   L ++  + Y+  ++ S    + F++  + L   TK A  PFS  LP AM APTPVS+LVHSSTLV AG+Y+L R  + L   +      +  +T+      A F LD KK+VAYSTLSQLGF+  +LS G  +L F +L +HA+FK+ MF+ +G++M     NQD+R+   + Y  P+ S  ++  + SL G PFL  +Y K+L+I
Sbjct:   82 ELKMDRFLYLMILFLISMYMLILSPNMLSIILGWDGLGLISYCLVIYYMKMKSFTSGMVTILLNRLGDIGLLLIMGLMTYYGSWNLSFYKMNEFMMIYILLMAFTKSAQIPFSTWLPMAMMAPTPVSSLVHSSTLVTAGIYLLIRYVNLLDFNYKNYIMLIASLTMLFAGLVANFELDLKKVVAYSTLSQLGFMMSMLSIGSTELVFLHLFIHAMFKSLMFMCVGSYMHYMYSNQDIRMYYGMYYIYPMKSMILIFSILSLCGFPFLVGYYSKDLII 358          
BLAST of NADH dehydrogenase subunit 5 vs. UniProt/SwissProt
Match: sp|P51899|NU5M_ANOAR (NADH-ubiquinone oxidoreductase chain 5 (Fragment) OS=Anopheles arabiensis OX=7173 GN=ND5 PE=3 SV=2)

HSP 1 Score: 176.792 bits (447), Expect = 5.615e-49
Identity = 121/310 (39.03%), Postives = 186/310 (60.00%), Query Frame = 1
Query:  151 VIFVAILFVIVGSVVSFMVYYFSLEINLIRFVYLFKFFVFSMVLLIVSPSFFSFLVG*DGLGFISFFLVS*YGCGSRLTSSLKTFLVKRLGDSLYLVSFVWYFSRFSFS--------VNSFDCFVVF-ILGLALCTKRAIYPFSY*LPEAMAAPTPVSALVHSSTLVVAGLYILFRLFDCXXXXXXXXXXXXXX-XXXXXGSFRALFTLDFKKLVAYSTLSQLGFLGCILSYGCFDLFFYYLIVHALFKASMFIVLGTFMVVGSHNQDVRLLNSLGYSTPLV-SFFMLLDVSSLFGVPFLSSFYMKELVI 1047
            ++F++ + +I   V+ +   Y   + N+ RF+ L   FV SM++LI+SP+  S L+G DGLG +S+ LV  +       + + T L  R+GD   L++  W  +  S++         N+ +  ++  ++ LA  TK A  PFS  LP AMAAPTPVSALVHSSTLV AG+Y+L R  D L   ++  F  L   +T+F+    A F  D KK++A STLSQLG +  ILS G + L F++L+ HALFKA +F+  G+ +    ++QD+R++ SL  S PL  S F + ++ +L G+PFL+ FY K+L++
Sbjct:   61 LMFMSFVLLISSLVIFYSNQYMEEDYNINRFILLVLMFVMSMMMLIISPNLISILLGWDGLGLVSYCLVIYFQNVKSYNAGMLTALSNRIGDVALLLAIAWMLNYGSWNYIFYLDMMKNNIEMMIIGGLVMLAAMTKSAQIPFSSWLPAAMAAPTPVSALVHSSTLVTAGVYLLIRFNDVLMNWWMAQFLLLVSGLTMFMAGLGANFEFDLKKIIALSTLSQLGLMMSILSMGFYKLAFFHLLTHALFKALLFMCAGSIIHNMKNSQDIRMMGSLSMSMPLTCSCFNVANL-ALCGMPFLAGFYSKDLIL 369          
BLAST of NADH dehydrogenase subunit 5 vs. UniProt/SwissProt
Match: sp|P34854|NU5M_ANOGA (NADH-ubiquinone oxidoreductase chain 5 OS=Anopheles gambiae OX=7165 GN=mt:ND5 PE=3 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 4.740e-47
Identity = 119/310 (38.39%), Postives = 182/310 (58.71%), Query Frame = 1
Query:  151 VIFVAILFVIVGSVVSFMVYYFSLEINLIRFVYLFKFFVFSMVLLIVSPSFFSFLVG*DGLGFISFFLVS*YGCGSRLTSSLKTFLVKRLGDSLYLVSFVWYFSRFSFS--------VNSFDCFVVF-ILGLALCTKRAIYPFSY*LPEAMAAPTPVSALVHSSTLVVAGLYILFRLFDCXXXXXXXXXXXXXXXXXX-XGSFRALFTLDFKKLVAYSTLSQLGFLGCILSYGCFDLFFYYLIVHALFKASMFIVLGTFMVVGSHNQDVRLLNSLGYSTPLV-SFFMLLDVSSLFGVPFLSSFYMKELVI 1047
            ++F++ + +I   V+ +   Y   + N+ RF+ L   FV SM++LI+SP+  S L+G DGLG +S+ LV  +       + + T L  R+GD   L++  W  +  S++         N+ +  ++  ++ LA  TK A  PFS  LP AMAAPTPVSALVHSSTLV AG+Y+L R  D L   ++  F  L       +    A F  D KK++A STLSQLG +  ILS G + L F++L+ HALFKA +F+  G+ +    ++QD+R++ SL  S PL  S F + ++ +L G+PFL+ FY K+L++
Sbjct:   61 LMFMSFVLLISSLVIFYSNQYMEEDYNINRFILLVLMFVMSMMMLIISPNLISILLGWDGLGLVSYCLVIYFQNVKSYNAGMLTALSNRIGDVALLLAIAWMLNYGSWNYIFYLDMMKNNIEMMIIGGLVMLAAMTKSAQIPFSSWLPAAMAAPTPVSALVHSSTLVTAGVYLLIRFNDVLMNWWMAQFLLLVSGLTMFMAGLGANFEFDLKKIIALSTLSQLGLMMSILSMGFYKLAFFHLLTHALFKALLFMCAGSIIHNMKNSQDIRMMGSLSMSMPLTCSCFNVANL-ALCGMPFLAGFYSKDLIL 369          
BLAST of NADH dehydrogenase subunit 5 vs. UniProt/SwissProt
Match: sp|P33510|NU5M_ANOQU (NADH-ubiquinone oxidoreductase chain 5 OS=Anopheles quadrimaculatus OX=7166 GN=ND5 PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 2.357e-46
Identity = 125/313 (39.94%), Postives = 183/313 (58.47%), Query Frame = 1
Query:  151 VIFVAILFVIVGSVVSFMVYYFSLEINLIRFVYLFKFFVFSMVLLIVSPSFFSFLVG*DGLGFISFFLVS*YGCGSRLTSSLKTFLVKRLGDSLYLVSFVWYFSRFSF---------SVNSFDCFVVFILGLALCTKRAIYPFSY*LPEAMAAPTPVSALVHSSTLVVAGLYILFR----LFDCXXXXXXXXXXXXXXXXXXXGSFRALFTLDFKKLVAYSTLSQLGFLGCILSYGCFDLFFYYLIVHALFKASMFIVLGTFMVVGSHNQDVRLLNSLGYSTPLV-SFFMLLDVSSLFGVPFLSSFYMKELVI 1047
            ++F++ + +I   V+ +   Y   + N+ RF+ L   FV SM++LI+SP+  S L+G DGLG +S+ LV  +       + + T L  R+GD   L++  W  +  S+         S N+    +  ++ LA  TK A  PFS  LP AMAAPTPVSALVHSSTLV AGLY+L R    L D     F+ L S L +    LG   A F  D KK++A STLSQLG +  ILS G + L F++L+ HALFKA +F+  G+ +    ++QD+R++ SL  S PL  S F + ++ +L G+PFL+ FY K+L++
Sbjct:   57 LMFMSFVLLISSLVIFYSNQYMEEDYNINRFILLVLMFVMSMMMLIISPNLISILLGWDGLGLVSYCLVIYFQNVKSYNAGMLTALSNRIGDVALLLAIAWMLNYGSWNYIFYLEMMSKNTEMMIIGGLVMLAAMTKSAQIPFSSWLPAAMAAPTPVSALVHSSTLVTAGLYLLIRFNILLTDWWMGQFMLLISGLTMFMAGLG---ANFEFDLKKIIALSTLSQLGLMMSILSMGFYKLAFFHLLTHALFKALLFMCAGSIIHNMKNSQDIRMMGSLSMSMPLTCSCFNVANL-ALCGMPFLAGFYSKDLIL 365          
BLAST of NADH dehydrogenase subunit 5 vs. UniProt/SwissProt
Match: sp|B0FWD3|NU5M_AEDAE (NADH-ubiquinone oxidoreductase chain 5 OS=Aedes aegypti OX=7159 GN=mt:ND5 PE=3 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 5.199e-45
Identity = 120/312 (38.46%), Postives = 181/312 (58.01%), Query Frame = 1
Query:  151 VIFVAILFVIVGSVVSFMVYYFSLEINLIRFVYLFKFFVFSMVLLIVSPSFFSFLVG*DGLGFISFFLVS*YGCGSRLTSSLKTFLVKRLGDSLYLVSFVWYFSRFSFS--------VNSFDCFVVF-ILGLALCTKRAIYPFSY*LPEAMAAPTPVSALVHSSTLVVAGLYILFR---LFDCXXXXXXXXXXXXXXXXXXXGSFRALFTLDFKKLVAYSTLSQLGFLGCILSYGCFDLFFYYLIVHALFKASMFIVLGTFMVVGSHNQDVRLLNSLGYSTPLV-SFFMLLDVSSLFGVPFLSSFYMKELVI 1047
            ++F++ + +I   V+ +   Y   + N+ RF+ L   FV SM++LI+SP+  S L+G DGLG +S+ LV  +       + + T L  R+GD   L++  W  +  S++         N+F+  V+  ++ LA  TK A  PFS  LP AMAAPTPVSALVHSSTLV AG+Y+L R   L D  +         +  +T+F+    A F  D KK++A STLSQLG +  ILS G + L F++L+ HALFKA +F+  G  +    + QD+R +  L  S PL  S F + ++ +L G+PFL+ FY K+L++
Sbjct:   61 LMFMSFVLLISSLVIFYSDQYMGEDYNVNRFILLVLMFVMSMMMLIISPNLISILLGWDGLGLVSYCLVIYFQNVKSYNAGMLTALSNRIGDVALLLAIAWMLNYGSWNYIFYLDMMKNNFEMMVIGGLVMLAAMTKSAQIPFSSWLPAAMAAPTPVSALVHSSTLVTAGVYLLIRFNILLD--NSKLGQFLLLVSGLTMFMAGLGANFEFDLKKIIALSTLSQLGLMMSILSIGYYKLAFFHLLTHALFKALLFMCAGVIIHNTKNAQDIRFMGGLSMSMPLTCSCFNIANL-ALCGMPFLAGFYSKDLIL 369          
BLAST of NADH dehydrogenase subunit 5 vs. TrEMBL
Match: T1PTG4 (NADH dehydrogenase subunit 5 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=ND5 PE=4 SV=2)

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 467/482 (96.89%), Postives = 467/482 (96.89%), Query Frame = 1
Query:  148 RVIFVAILFVIVGSVVSFMVYYFSLEINLIRFVYLFKFFVFSMVLLIVSPSFFSFLVG*DGLGFISFFLVS*YGCGSRLTSSLKTFLVKRLGDSLYLVSFVWYFSRFSFSVNSFDCFVVFILGLALCTKRAIYPFSY*LPEAMAAPTPVSALVHSSTLVVAGLYILFRLFDCXXXXXXXXXXXXXXXXXXXGSFRALFTLDFKKLVAYSTLSQLGFLGCILSYGCFDLFFYYLIVHALFKASMFIVLGTFMVVGSHNQDVRLLNSLGYSTPLVSFFMLLDVSSLFGVPFLSSFYMKELVIFNSLTXXXXXXXXXXXXXXXXXXXXXXXXXXNIVFSGSCKYLVSVIRSLC*SVYPFVFLFVYMLLMGVYFFYLDCSDFNLGSSAWLLAMYXXXXXXLMGIVNYFICSYKYLNLFYLSVSYLNLKFGSFFYLLDSGIFVFSFISSLGVLVYSHFL*FYYSLVVNNLGYFVYVSLLVLFFISML 1593
             VIFVAILFVIVGSVVSFMVYYFSLEINLIRFVYLF FFVFSMVLLIVSPSFFSFLVG DGLGFISFFLVS YGCGS LTSSLKTFLV RLGDSLYLVSFVWYFS FSFSVNSFDCFVVFILGLALCTK AIYPFSY LPEAMAAPTPVSALVHSSTLVVAGLYILFRLFDCLSLGFIFLFSFL LITLFLGSF ALFTLDFKKLVAYSTLSQLGFLGCILSYGCFDLFFYYLIVHALFKASMFIVLGTFMVVGSHNQDVRLLNSLGYSTPLVSFFMLLDVSSLFGVPFLSSFYMKELVIFNSLTLSY LVYSFLLLFSLLLTFLYSFRFLNIVFSGSCKYLVSVIRSLC SVYPFVFLFVYMLLMGVYFFYLDCSDFNLGSSAWLLAMYFFFFFFLMGIVNYFICSY YLNLFYLSVSYLNLKFGSFFYLLDSGIFVFSFISSLGVLVYSHFL FYYSLVVNNLGYFVYVSLLVLFFISML
Sbjct:   51 SVIFVAILFVIVGSVVSFMVYYFSLEINLIRFVYLFNFFVFSMVLLIVSPSFFSFLVGWDGLGFISFFLVSWYGCGSSLTSSLKTFLVNRLGDSLYLVSFVWYFSSFSFSVNSFDCFVVFILGLALCTKSAIYPFSYWLPEAMAAPTPVSALVHSSTLVVAGLYILFRLFDCLSLGFIFLFSFLSLITLFLGSFSALFTLDFKKLVAYSTLSQLGFLGCILSYGCFDLFFYYLIVHALFKASMFIVLGTFMVVGSHNQDVRLLNSLGYSTPLVSFFMLLDVSSLFGVPFLSSFYMKELVIFNSLTLSYSLVYSFLLLFSLLLTFLYSFRFLNIVFSGSCKYLVSVIRSLCWSVYPFVFLFVYMLLMGVYFFYLDCSDFNLGSSAWLLAMYFFFFFFLMGIVNYFICSYNYLNLFYLSVSYLNLKFGSFFYLLDSGIFVFSFISSLGVLVYSHFLWFYYSLVVNNLGYFVYVSLLVLFFISML 532          
BLAST of NADH dehydrogenase subunit 5 vs. TrEMBL
Match: A0A0B4VIW8 (NADH dehydrogenase subunit 5 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=ND5 PE=4 SV=1)

HSP 1 Score: 697.582 bits (1799), Expect = 0.000e+0
Identity = 456/482 (94.61%), Postives = 463/482 (96.06%), Query Frame = 1
Query:  148 RVIFVAILFVIVGSVVSFMVYYFSLEINLIRFVYLFKFFVFSMVLLIVSPSFFSFLVG*DGLGFISFFLVS*YGCGSRLTSSLKTFLVKRLGDSLYLVSFVWYFSRFSFSVNSFDCFVVFILGLALCTKRAIYPFSY*LPEAMAAPTPVSALVHSSTLVVAGLYILFRLFDCXXXXXXXXXXXXXXXXXXXGSFRALFTLDFKKLVAYSTLSQLGFLGCILSYGCFDLFFYYLIVHALFKASMFIVLGTFMVVGSHNQDVRLLNSLGYSTPLVSFFMLLDVSSLFGVPFLSSFYMKELVIFNSLTXXXXXXXXXXXXXXXXXXXXXXXXXXNIVFSGSCKYLVSVIRSLC*SVYPFVFLFVYMLLMGVYFFYLDCSDFNLGSSAWLLAMYXXXXXXLMGIVNYFICSYKYLNLFYLSVSYLNLKFGSFFYLLDSGIFVFSFISSLGVLVYSHFL*FYYSLVVNNLGYFVYVSLLVLFFISML 1593
             V+FVA+LFVIVGSVVSFMVYYFSLEINL+RFVYL+ FFVFSMVLLIVSPSFFSFLVG DGLGFISFFLVS YGCGS LTSSLKTFLV RLGDSLYLVSFVWYFS FSFSVNSFDCFVVFILGLALCTK AIYPFSY LPEAMAAPTPVSALVHSSTLVVAGLYILFRLFDCLS GFIFLFSFL LITLFLGSF ALFTLDFKKLVAYSTLSQLGFLGCILSYGCFDLFFYYLIVHALFKASMFIVLGTFMVVGSHNQDVRLLNSLGYSTPLVSFFMLLDVSSLFGVPFLSSFYMKELVIFNSLTLSY LVYSFLLLFSLLLTFLYSFRFLNIVFSGSCKYLVSVIRSL  SVYPFVFLFVYMLLMGVYFFYLDCSDFNLGSSAWLLAMY FFFFFL+GIVNYFICSY +LNLFYL VSYLNLKFGSFFYLLDSGIFVFSFISSLGVLVYSHFL FYYSLVVNNLGYFVYVS+LVLFFISML
Sbjct:   51 SVMFVAMLFVIVGSVVSFMVYYFSLEINLVRFVYLYNFFVFSMVLLIVSPSFFSFLVGWDGLGFISFFLVSWYGCGSSLTSSLKTFLVNRLGDSLYLVSFVWYFSSFSFSVNSFDCFVVFILGLALCTKSAIYPFSYWLPEAMAAPTPVSALVHSSTLVVAGLYILFRLFDCLSFGFIFLFSFLSLITLFLGSFSALFTLDFKKLVAYSTLSQLGFLGCILSYGCFDLFFYYLIVHALFKASMFIVLGTFMVVGSHNQDVRLLNSLGYSTPLVSFFMLLDVSSLFGVPFLSSFYMKELVIFNSLTLSYSLVYSFLLLFSLLLTFLYSFRFLNIVFSGSCKYLVSVIRSLYWSVYPFVFLFVYMLLMGVYFFYLDCSDFNLGSSAWLLAMY-FFFFFLIGIVNYFICSYNFLNLFYLLVSYLNLKFGSFFYLLDSGIFVFSFISSLGVLVYSHFLSFYYSLVVNNLGYFVYVSVLVLFFISML 531          
BLAST of NADH dehydrogenase subunit 5 vs. TrEMBL
Match: A0A0C4ZKM0 (ND5 protein OS=Girardia sp. ER-2015 OX=1608986 GN=ND5 PE=4 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 5.224e-79
Identity = 207/387 (53.49%), Postives = 261/387 (67.44%), Query Frame = 1
Query:  157 FVAILFVIVGSVVSFMVYYFSLEINLIRFVYLFKFFVFSMVLLIVSPSFFSFLVG*DGLGFISFFLVS*YGCGSRLTSSLKTFLVKRLGDSLYLVSFVWYFSRFSFSVNSFDCFVVFILGLALCTKRAIYPFSY*LPEAMAAPTPVSALVHSSTLVVAGLYILFRLFDCXXXXXXXXXXXXXXXXXXXGSFRALFTLDFKKLVAYSTLSQLGFLGCILSYGCFDLFFYYLIVHALFKASMFIVLGTFMVVGSHNQDVRLLNSLGYSTPLVSFFMLLDVSSLFGVPFLSSFYMKELVIFNSLTXXXXXXXXXXXXXXXXXXXXXXXXXXNIVFSGSCKYLVSVIRSLC*SVYPFVFLFVYMLLMGVYFFYLDCSDFNLGSSAWLLAMY 1317
            F ++LF IV S+ SF+ YYFS+EINL RFV L   F+ SMV L++SP   S L+G DGLGFISF LV  +G     ++SLKTFLV R GDSL L      F  F    + +  F++FI  LAL TK A+YPFSY LPEAMAAPTPVSALVHSSTLVVAGLYILFR F  LS   +F  S + L+TLF GS++A  T D KKLVAYSTLSQLGFL   L  G  DLF++YL+VHA+FKAS+F+ +G++MVVGSHNQDVR L+SL +  P++S    L + SL G PFLS F+ KEL+I ++L +++ L + FL + SLLLT  YSFR L  +F  +   L++   +L  SV   V     MLL+GV F +  C   N+GSS  L  +Y
Sbjct:   51 FFSVLFSIVFSIYSFITYYFSIEINLSRFVSLLNLFIVSMVFLVMSPGLVSLLLGWDGLGFISFLLVCWFGSSQSFSASLKTFLVNRFGDSLLLCGLTLLF--FCGGFDYYYSFILFIF-LALLTKSALYPFSYWLPEAMAAPTPVSALVHSSTLVVAGLYILFRYFFLLSYLVLFFLSCIGLLTLFYGSYQASVTYDSKKLVAYSTLSQLGFLAFFLGLGFLDLFYHYLLVHAVFKASLFVSVGSYMVVGSHNQDVRYLSSLWFLNPIISVIFFLSIFSLSGFPFLSCFFFKELLIGSALNINFGLFFLFLFISSLLLTVYYSFRLL-FIFIFNKFVLINSYLNLNYSVVSSVLFSFLMLLVGVCFSFGYCFWLNVGSSFSLFTLY 433          
BLAST of NADH dehydrogenase subunit 5 vs. TrEMBL
Match: G9M8V3 (NADH dehydrogenase subunit 5 (Fragment) OS=Dugesia japonica OX=6161 GN=nd5 PE=4 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 2.802e-73
Identity = 174/299 (58.19%), Postives = 215/299 (71.91%), Query Frame = 1
Query:  154 IFVAILFVIVGSVVSFMVYYFSLEINLIRFVYLFKFFVFSMVLLIVSPSFFSFLVG*DGLGFISFFLVS*YGCGSRLTSSLKTFLVKRLGDSLYLVSFVWYFSRFSFS-VNSFDCFVVFILGLALCTKRAIYPFSY*LPEAMAAPTPVSALVHSSTLVVAGLYILFRLFDCXXXXXXXXXXXXXXXXXXXGSFRALFTLDFKKLVAYSTLSQLGFLGCILSYGCFDLFFYYLIVHALFKASMFIVLGTFMVVGSHNQDVRLLNSLGYSTPLVSFFMLLDVSSLFGVPFLSSFYMKELVI 1047
            +F+ +LF IV  + SF+ YYF  E+NL RFV L   F+FSMVLL+VSP   S L+G DGLGF+SF LV  +G GS  ++SLKTFL  R GDSL+LV  V  F    F  V+SF     F+L +AL TK A++PFSY LPEAMAAPTPVSALVHSSTLVVAGLYI+FR  D +S  F FL S + LITL+LGS  ++FT D KKLVAYSTLSQLG L  +L  G FDLF+ YL+VHA+FKAS+F+ +G+FMVVG H+QD+R L+SL +  P  S  +   V SL G PFLS F+ KEL++
Sbjct:   52 LFLMVLFSIVFCIYSFISYYFVYELNLSRFVNLLNLFIFSMVLLVVSPGLVSLLLGWDGLGFVSFLLVCWFGSGSSFSASLKTFLFNRFGDSLFLVGLVLLFFYGGFGFVSSFT----FLLFIALFTKSALFPFSYWLPEAMAAPTPVSALVHSSTLVVAGLYIIFRYIDVVSFLFTFLLSCVGLITLYLGSLSSIFTFDSKKLVAYSTLSQLGLLAFVLGLGLFDLFYSYLLVHAVFKASLFVSVGSFMVVGGHSQDLRYLSSLWFINPFFSLILFFSVFSLSGFPFLSCFFFKELIL 346          
BLAST of NADH dehydrogenase subunit 5 vs. TrEMBL
Match: A0A0E3ZCF5 (NADH dehydrogenase subunit 5 (Fragment) OS=Obama sp. MAP-2014 OX=1520506 GN=nad5 PE=4 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 8.454e-69
Identity = 150/307 (48.86%), Postives = 207/307 (67.43%), Query Frame = 1
Query:  148 RVIFVAILFVIVGSVVSFMVYYFSLEINLIRFVYLFKFFVFSMVLLIVSPSFFSFLVG*DGLGFISFFLVS*YGCGSRLTSSLKTFLVKRLGDSLYLVS-----FVWYFSRFSFSVNSFDCFVVFILGLALCTKRAIYPFSY*LPEAMAAPTPVSALVHSSTLVVAGLYILFRLFDCXXXXXXXXXXXXXXXXXXXGSFRALFTLDFKKLVAYSTLSQLGFLGCILSYGCFDLFFYYLIVHALFKASMFIVLGTFMVVGSHNQDVRLLNSLGYSTPLVSFFMLLDVSSLFGVPFLSSFYMKELVIFN 1053
             +I++++LF IV S++ F +YY + ++N IR++ +   FVFSMV L+++P+F+ FLVG DGLGF SF LV+ YGC    ++S+KTFL+ RLGD L+L S     F  YF+ F++   SF   ++F+L  A  TK + YPFS  LP+AMAAPTP+SALVHSSTLV AGLY +FR     +   + L   L L T+FLGSF   F+ + KK+VAYST+SQLG +   LS G  +L F+YLI+HALFKA +FI LG+ M    HNQD+R LN+L +  PL+   +   +  L G PF S FY+KEL++ N
Sbjct:   53 SIIYLSVLFSIVSSILFFSIYYMNSDLNYIRYIIILNLFVFSMVALVITPNFY-FLVGWDGLGFSSFLLVAWYGCYVSRSASIKTFLINRLGDGLFLSSLSLIFFQGYFNYFTYDYVSFLVIIIFLL--ASFTKSSHYPFSSWLPDAMAAPTPISALVHSSTLVTAGLYFIFRFSYLFNSDLMLLIHNLGLWTIFLGSFAGCFSNNSKKIVAYSTMSQLGLISFSLSLGFIELSFFYLIIHALFKALIFISLGSLMFNNWHNQDIRHLNNLWFQNPLILINIFYSLLVLSGFPFFSCFYIKELILNN 356          
BLAST of NADH dehydrogenase subunit 5 vs. Ensembl Sea Lamprey
Match: ND5 (NADH dehydrogenase subunit 5 [Source:NCBI gene;Acc:807813])

HSP 1 Score: 138.272 bits (347), Expect = 3.155e-35
Identity = 95/315 (30.16%), Postives = 164/315 (52.06%), Query Frame = 1
Query:  151 VIFVAILFVIVGSVVSFMVYYFSLEINLIRFVYLFKFFVFSMVLLIVSPSFFSFLVG*DGLGFISFFLVS*YGCGSRLT-SSLKTFLVKRLGDSLYLVSFVWYFSRFSFSVNSFDC-----------FVVFILG--LALCTKRAIYPFSY*LPEAMAAPTPVSALVHSSTLVVAGLYILFRLFDCXXX--XXXXXXXXXXXXXXXXGSFRALFTLDFKKLVAYSTLSQLGFLGCILSYGCFDLFFYYLIVHALFKASMFIVLGTFMVVGSHNQDVRLLNSLGYSTPLVSFFMLLDVSSLFGVPFLSSFYMKELVI 1047
            VIF  I  +I  S++ F  +Y + E ++ +F      F+ +M+  I + +     +G +G+G +SF L+S +   ++   S+L+     R+GD   ++S VW  S    + NS+D            +++  LG  +A   K A +     LP AM  PTPVSAL+HSST+VVAG+++L RL          + +   L  +T    +  A    D KK++A+ST SQLG +   +      + F ++  HA FKA +F+  G+ +   ++ QD+R  + L  + PL +  M +  ++L G+PFL+ F+ K+L++
Sbjct:   86 VIFTPIALMITWSIMEFSQWYMAKERHMDKFFKYLLLFLITMITFISANNLLQLFIGWEGVGIMSFLLISWWSGRTKANISALQAVAYNRIGDIGLMMSMVWMCS----NTNSWDLQQITMLLSDQQYLIPTLGFLIAATGKSAQFGLHPWLPAAMEGPTPVSALLHSSTMVVAGVFLLIRLHPLFQNYPLMLEMTLCLGAMTTICAALCATTQNDIKKIIAFSTSSQLGLMMVAVGLNHPHIAFLHMCTHAFFKAMLFLCSGSIIHNMNNEQDIRKFSCLNNNLPLTTTCMTIGSAALMGLPFLAGFFTKDLIL 396          
BLAST of NADH dehydrogenase subunit 5 vs. Ensembl Nematostella
Match: EDO35673 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKT3])

HSP 1 Score: 83.5741 bits (205), Expect = 2.542e-18
Identity = 56/160 (35.00%), Postives = 90/160 (56.25%), Query Frame = 1
Query:  583 PTPVSALVHSSTLVVAGLYILFR---LFDCXXXXXXXXXXXXXXXXXXXGSFRALFTLDFKKLVAYSTLSQLGFL--GCILSYGCFDLFFYYLIVHALFKASMFIVLGTFMVVGSHNQDVRLLNSLGYSTPLVSFFMLLDVSSLFGVPFLSSFYMKELVI 1047
            PTPVSAL+H++T+V AG+++L R   L +   +  + +     L      +   L   D KK++AYST SQLG++   C +S+    LF  +L+ HA FKA +F+  G+ +   +  QD+R +  L  S P     +L+   SL G P+L+ FY K+L++
Sbjct:    1 PTPVSALIHAATMVTAGVFLLIRSSPLLEQAPVALMVVTIVGSLTVFMAATV-GLVQNDLKKVIAYSTCSQLGYMVVACGISHYSISLF--HLMNHAFFKALLFLSAGSVIHALADEQDMRKMGGLIKSIPFTYTMILIGSLSLMGFPYLTGFYSKDLIL 157          
BLAST of NADH dehydrogenase subunit 5 vs. Ensembl Medaka
Match: ND5 (NADH dehydrogenase subunit 5 [Source:NCBI gene;Acc:805438])

HSP 1 Score: 134.42 bits (337), Expect = 2.968e-33
Identity = 94/320 (29.38%), Postives = 162/320 (50.62%), Query Frame = 1
Query:  151 VIFVAILFVIVGSVVSFMVYYFSLEINLIRFVYLFKFFVFSMVLLIVSPSFFSFLVG*DGLGFISFFLVS*Y-GCGSRLTSSLKTFLVKRLGDSLYLVSFVWYFSRFSFSVNSFDCFVVF-----------ILGLALCT--KRAIYPFSY*LPEAMAAPTPVSALVHSSTLVVAGLYILFRLFDCXXXXXXXXXXXXXXXXXXXGSFRALFTL-------DFKKLVAYSTLSQLGFLGCILSYGCFDLFFYYLIVHALFKASMFIVLGTFMVVGSHNQDVRLLNSLGYSTPLVSFFMLLDVSSLFGVPFLSSFYMKELVI 1047
            ++F  +   +  S++ F  +Y   + N+ RF      F+ +M++L+ + + F   +G +G+G +SF L+  + G     T++L+  +  R+GD   +++  W     + ++NS+D   +F           +LGL L    K A +     LP AM  PTPVSAL+HSST+VVAG+++L RL        +     +    L LG+   +FT        D KK++A+ST SQLG +   +      L F ++  HA FKA +F+  G+ +   +  QD+R +  L +  P  S  + +   +L G PFL+ F+ K+ +I
Sbjct:   92 IVFTPVALYVTWSILEFASWYMHDDPNMNRFFKYLLIFLIAMIVLVTANNMFQLFIGWEGVGIMSFLLIGWWFGRADANTAALQAVVYNRVGDIGLILAMAW----MAVNLNSWDMQQLFSMTTNQDMTLPLLGLVLAATGKSAQFGLHPWLPSAMEGPTPVSALLHSSTMVVAGIFLLIRL-----NPLMDNNPLVLSTCLCLGALTTVFTATCALTQNDIKKIIAFSTSSQLGLMMVTIGLNQPQLAFLHICTHAFFKAMLFLCSGSIIHSLNDEQDIRKMGGLHHLLPFTSSCLTIGSLALTGTPFLAGFFSKDAII 402          
The following BLAST results are available for this feature:
BLAST of NADH dehydrogenase subunit 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MT-ND51.455e-3228.71mitochondrially encoded NADH:ubiquinone oxidoreduc... [more]
back to top
BLAST of NADH dehydrogenase subunit 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nduo-59.822e-2736.63NADH-ubiquinone oxidoreductase chain 5 [Source:Un... [more]
back to top
BLAST of NADH dehydrogenase subunit 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mt:ND53.503e-4538.06gene:FBgn0013684 transcript:FBtr0433501[more]
back to top
BLAST of NADH dehydrogenase subunit 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mt-nd51.009e-3229.84NADH dehydrogenase subunit 5 [Source:NCBI gene;Acc... [more]
back to top
BLAST of NADH dehydrogenase subunit 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dennd2c1.197e-3432.29DENN/MADD domain containing 2C [Source:Xenbase;Acc... [more]
back to top
BLAST of NADH dehydrogenase subunit 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mt-Nd51.849e-3630.79mitochondrially encoded NADH dehydrogenase 5 [Sour... [more]
back to top
BLAST of NADH dehydrogenase subunit 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P34855|NU5M_APILI1.099e-5041.52NADH-ubiquinone oxidoreductase chain 5 OS=Apis mel... [more]
sp|P51899|NU5M_ANOAR5.615e-4939.03NADH-ubiquinone oxidoreductase chain 5 (Fragment) ... [more]
sp|P34854|NU5M_ANOGA4.740e-4738.39NADH-ubiquinone oxidoreductase chain 5 OS=Anophele... [more]
sp|P33510|NU5M_ANOQU2.357e-4639.94NADH-ubiquinone oxidoreductase chain 5 OS=Anophele... [more]
sp|B0FWD3|NU5M_AEDAE5.199e-4538.46NADH-ubiquinone oxidoreductase chain 5 OS=Aedes ae... [more]
back to top
BLAST of NADH dehydrogenase subunit 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1PTG40.000e+096.89NADH dehydrogenase subunit 5 (Fragment) OS=Schmidt... [more]
A0A0B4VIW80.000e+094.61NADH dehydrogenase subunit 5 (Fragment) OS=Schmidt... [more]
A0A0C4ZKM05.224e-7953.49ND5 protein OS=Girardia sp. ER-2015 OX=1608986 GN=... [more]
G9M8V32.802e-7358.19NADH dehydrogenase subunit 5 (Fragment) OS=Dugesia... [more]
A0A0E3ZCF58.454e-6948.86NADH dehydrogenase subunit 5 (Fragment) OS=Obama s... [more]
back to top
BLAST of NADH dehydrogenase subunit 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH dehydrogenase subunit 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ND53.155e-3530.16NADH dehydrogenase subunit 5 [Source:NCBI gene;Acc... [more]
back to top
BLAST of NADH dehydrogenase subunit 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH dehydrogenase subunit 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO356732.542e-1835.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NADH dehydrogenase subunit 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ND52.968e-3329.38NADH dehydrogenase subunit 5 [Source:NCBI gene;Acc... [more]
back to top
BLAST of NADH dehydrogenase subunit 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30001799
GenBankYP_008592430.2
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001799 ID=SMED30001799|Name=NADH dehydrogenase subunit 5|organism=Schmidtea mediterranea sexual|type=transcript|length=1596bp
ttagtttattatgttggtttgtttcatttttgttctttttgtttgctttt
gttttcttttgatagtgtgtctttagtgttagtttatgatttatttgtta
ttaatttgttggattatttttctttttatttgttcttagattgatttaga
gtgatatttgtagctatactgtttgttattgttggtagtgttgtatcttt
tatggtttattatttttcattggagataaatttgatacgttttgtttatt
tgtttaaattttttgtattttctatggttttgttgatagtttctcctagt
tttttttctttcttagttggttgagatggtcttggttttattagtttttt
tttagtgagttgatatggttgtggttcaagattgacttctagtttaaaga
cttttttagttaaacgtttaggtgattctttgtatttggttagttttgtg
tggtatttttctagattttctttttctgttaattcttttgattgttttgt
tgtttttattttaggtttggctttatgtacgaagagagctatttatccat
ttagttattgattgccagaagctatggctgctcctactcctgtttcagct
ttagttcattcttctactttggttgtagcaggtttgtatatattgtttcg
tttgtttgattgtttatctcttggttttatttttttgtttagttttttaa
gattaattacgttgtttttgggtagttttagagctttgtttactttagat
tttaagaagctagttgcttattctactttaagtcaacttgggttcttagg
ttgtattttaagttatggttgttttgatttgtttttttattatttgattg
tacatgctttgtttaaggcttctatgtttatagtgttaggtacttttatg
gttgttggtagtcacaatcaagatgttcgtttgttgaattctttagggta
ttctactcctttagtctctttttttatgttgctagatgtttcttctttat
ttggggttccttttttgtcttctttttatatgaaggagttagttatattt
aatagtttgactcttagttataggttagtttatagttttttgttattgtt
ttctttgttgttaacttttctttattctttccggtttttgaatattgtct
ttagtggttcttgtaagtatttggtttcagttattcgtagtttgtgttga
tctgtttatccttttgtatttttgtttgtttatatgttgttgatgggtgt
ttattttttttacttagattgttctgattttaatttgggttcatcggcat
ggcttttagccatgtatttttttttttttttttttttaatgggtattgtt
aattattttatttgttcttataaatatttgaatttgttttatttatcagt
atcctatttaaatttaaagtttggctcttttttttatttgttggattctg
gtatttttgtttttagttttatttctagtttgggtgttttagtttattcc
cattttttatgattttattatagcttagttgttaataatttgggatactt
tgtttatgtttcgttattagttttgttttttattagtatgttataa
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001750ND/Mrp_mem
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0008137NADH dehydrogenase (ubiquinone) activity
GO:0016491oxidoreductase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process