Retinal pigment epithelium-derived rhodopsin homolog

Overview
NameRetinal pigment epithelium-derived rhodopsin homolog
Smed IDSMED30001792
Length (bp)1839
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Retinal pigment epithelium-derived rhodopsin homolog (SMED30001792) t-SNE clustered cells

Violin plots show distribution of expression levels for Retinal pigment epithelium-derived rhodopsin homolog (SMED30001792) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Retinal pigment epithelium-derived rhodopsin homolog (SMED30001792) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Retinal pigment epithelium-derived rhodopsin homolog (SMED30001792) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001792

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30001792h1SMcG0002502 SmedASXL_015985SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30001792h1SMcG0002502 dd_Smed_v4_13675_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001792h1SMcG0002502 dd_Smed_v4_13675_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001792h1SMcG0002502 dd_Smed_v4_13675_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30001792h1SMcG0002502 dd_Smed_v4_13675_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30001792h1SMcG0002501 dd_Smed_v4_7301_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30001792h1SMcG0002501 dd_Smed_v4_7301_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001792h1SMcG0002502 dd_Smed_v4_13675_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Human
Match: RGR (retinal G protein coupled receptor [Source:HGNC Symbol;Acc:HGNC:9990])

HSP 1 Score: 80.1073 bits (196), Expect = 6.737e-16
Identity = 61/209 (29.19%), Postives = 97/209 (46.41%), Query Frame = 3
Query:  570 QNNQINEDCRKIHRHFIYSSLGVVLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERY--YSTRKIQLPWN--VNQILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLFTLSLETRKTEKINSFEKIMNNVSRKLFLMDLFSWCGYLVLCLIGLVSNQDS 1184
            +  ++   C  +      +  G+ L A++AA S  + RW +G   CQ + F+GFV  +++I     IA  RY  Y TR  QL WN  V+ +L+V W+   FW+ LPL G+G Y  E   T CT+       N   ++  +    F +P+ I I  +    SL  +K  K    +      +R L    L  W  Y +L L  ++++  S
Sbjct:   43 KTPELRTPCHLLVLSLALADSGISLNALVAATSSLLRRWPYGSDGCQAHGFQGFVTALASICSSAAIAWGRYHHYCTRS-QLAWNSAVSLVLFV-WLSSAFWAALPLLGWGHYDYEPLGTCCTLDYSKGDRNFTSFLFTMSFFNFAMPLFITITSY----SLMEQKLGKSGHLQVNTTLPARTL----LLGWGPYAILYLYAVIADVTS 241          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Human
Match: RRH (retinal pigment epithelium-derived rhodopsin homolog [Source:HGNC Symbol;Acc:HGNC:10450])

HSP 1 Score: 80.1073 bits (196), Expect = 1.375e-15
Identity = 63/224 (28.12%), Postives = 108/224 (48.21%), Query Frame = 3
Query:  642 LGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYSTRKIQLPWNVNQILYV-----CWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLF---TLSLE----TRKTEKIN---SFEKIMNNVSRKLFLMDLFSWCGYLVLCL---IGLVSNQDSPWAILFSSVSPLLTKFGIALLPMLY 1259
            +G  ++A S   G W FG   CQ YA     FG+++I ++ V+A++RY +     +   +    Y+      WI GLFW+L+P+ G+ SYA +    +CTI       +   Y   +I + F++P++  +MF+ +   TLS++    +  TE +N   S +  +  +S  +  M L +W  Y ++CL    G       P AI    ++PL  K      P +Y
Sbjct:   77 IGYPMSAASDLYGSWKFGYAGCQVYAGLNIFFGMASIGLLTVVAVDRYLTICLPDVGRRMTTNTYIGLILGAWINGLFWALMPIIGWASYAPDPTGATCTINWRKNDRSFVSYTMTVIAINFIVPLT--VMFYCYYHVTLSIKHHTTSDCTESLNRDWSDQIDVTKMSVIMICMFLVAWSPYSIVCLWASFGDPKKIPPPMAI----IAPLFAKSSTFYNPCIY 294          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Human
Match: RGR (retinal G protein coupled receptor [Source:HGNC Symbol;Acc:HGNC:9990])

HSP 1 Score: 76.6406 bits (187), Expect = 2.667e-15
Identity = 49/153 (32.03%), Postives = 76/153 (49.67%), Query Frame = 3
Query:  570 QNNQINEDCRKIHRHFIYSSLGVVLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERY--YSTRKIQLPWN--VNQILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGI 1016
            +  ++   C  +      +  G+ L A++AA S  + RW +G   CQ + F+GFV  +++I     IA  RY  Y TR  QL WN  V+ +L+V W+   FW+ LPL G+G Y  E   T CT+       N   ++  +    F +P+ I I
Sbjct:   43 KTPELRTPCHLLVLSLALADSGISLNALVAATSSLLRRWPYGSDGCQAHGFQGFVTALASICSSAAIAWGRYHHYCTRS-QLAWNSAVSLVLFV-WLSSAFWAALPLLGWGHYDYEPLGTCCTLDYSKGDRNFTSFLFTMSFFNFAMPLFITI 193          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Human
Match: RGR (retinal G protein coupled receptor [Source:HGNC Symbol;Acc:HGNC:9990])

HSP 1 Score: 76.2554 bits (186), Expect = 4.298e-15
Identity = 49/153 (32.03%), Postives = 76/153 (49.67%), Query Frame = 3
Query:  570 QNNQINEDCRKIHRHFIYSSLGVVLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERY--YSTRKIQLPWN--VNQILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGI 1016
            +  ++   C  +      +  G+ L A++AA S  + RW +G   CQ + F+GFV  +++I     IA  RY  Y TR  QL WN  V+ +L+V W+   FW+ LPL G+G Y  E   T CT+       N   ++  +    F +P+ I I
Sbjct:   43 KTPELRTPCHLLVLSLALADSGISLNALVAATSSLLRRWPYGSDGCQAHGFQGFVTALASICSSAAIAWGRYHHYCTRS-QLAWNSAVSLVLFV-WLSSAFWAALPLLGWGHYDYEPLGTCCTLDYSKGDRNFTSFLFTMSFFNFAMPLFITI 193          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Human
Match: RGR (retinal G protein coupled receptor [Source:HGNC Symbol;Acc:HGNC:9990])

HSP 1 Score: 76.6406 bits (187), Expect = 5.266e-15
Identity = 49/153 (32.03%), Postives = 76/153 (49.67%), Query Frame = 3
Query:  570 QNNQINEDCRKIHRHFIYSSLGVVLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERY--YSTRKIQLPWN--VNQILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGI 1016
            +  ++   C  +      +  G+ L A++AA S  + RW +G   CQ + F+GFV  +++I     IA  RY  Y TR  QL WN  V+ +L+V W+   FW+ LPL G+G Y  E   T CT+       N   ++  +    F +P+ I I
Sbjct:   43 KTPELRTPCHLLVLSLALADSGISLNALVAATSSLLRRWPYGSDGCQAHGFQGFVTALASICSSAAIAWGRYHHYCTRS-QLAWNSAVSLVLFV-WLSSAFWAALPLLGWGHYDYEPLGTCCTLDYSKGDRNFTSFLFTMSFFNFAMPLFITI 193          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Fly
Match: ninaE (gene:FBgn0002940 transcript:FBtr0083857)

HSP 1 Score: 60.077 bits (144), Expect = 2.737e-9
Identity = 40/155 (25.81%), Postives = 74/155 (47.74%), Query Frame = 3
Query:  684 WLFGDFLCQFYAFEGFVFGISNINIIVVIAMERY------YSTRKIQLPWNVNQILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLFTLSLETRKTEKINSFEKIMNNVSRKLFLMDLFS 1130
            W+ G  +C  YA  G  FG S+I  + +I+++RY       + R + +P  + +I Y+ W +   W L P FG+  Y  E + TSC I   +   N + Y+    I  + +P+ +    + F ++        +++ EK M   ++K+ +  L S
Sbjct:  116 WVLGPMMCDIYAGLGSAFGCSSIWSMCMISLDRYQVIVKGMAGRPMTIPLALGKIAYI-WFMSSIWCLAPAFGWSRYVPEGNLTSCGIDYLERDWNPRSYLIFYSIFVYYIPLFLICYSYWFIIA-------AVSAHEKAMREQAKKMNVKSLRS 262          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Fly
Match: Rh6 (gene:FBgn0019940 transcript:FBtr0347603)

HSP 1 Score: 57.7658 bits (138), Expect = 1.398e-8
Identity = 49/199 (24.62%), Postives = 85/199 (42.71%), Query Frame = 3
Query:  672 FVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYSTRK--IQLPWNVNQI---LYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFD---------LSHNHQLYMGGLIIVGFLLPVSIGIMFH----LFTLSLETRKTEKINSFEKIMNNVSRKLFLMDLFSWCGYLVLCLIGLVSNQD-SPWAILFSSV 1211
            F G W+ G FLC+ Y   G +FG  +I  + +IA +RY    K   + P         L V W +   W+L+PLFG+  Y  E + T+C    F          + ++  +Y+  L+ + F +      M      +   SL   + +K  + E  +  V+     +  F+W  Y ++   G+  +   SP + +  SV
Sbjct:  109 FYGTWIMGPFLCELYGMFGSLFGCVSIWSMTLIAYDRYCVIVKGMARKPLTATAAVLRLMVVWTICGAWALMPLFGWNRYVPEGNMTACGTDYFAKDWWNRSYIIVYSLWVYLTPLLTIIFAVAAHEKAMREQAKKMNVASLRNSEADKSKAIEIKLAKVALTTISLWFFAWTPYTIINYAGIFESMHLSPLSTICGSV 307          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Fly
Match: Rh2 (gene:FBgn0003248 transcript:FBtr0083697)

HSP 1 Score: 55.8398 bits (133), Expect = 5.703e-8
Identity = 44/186 (23.66%), Postives = 83/186 (44.62%), Query Frame = 3
Query:  684 WLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYSTRK------IQLPWNVNQILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLP----------VSIGIMFHLFTLSLETRK--TEKINSFEKIMNNVSRKLFLMDL-------FSWCGYLVLCLIGL 1166
            W+ G   C  YA  G +FG  +I  + +IA +RY    K      + +  ++ +IL++ W++ +FW+++PL G+ +Y  E + T+C+I       N + Y+    +  +  P          +   +  H   +  + +K   + + S E    +   KL  + L        +W  YLV+C  GL
Sbjct:  123 WVLGPLWCDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGINGTPMTIKTSIMKILFI-WMMAVFWTVMPLIGWSAYVPEGNLTACSIDYMTRMWNPRSYLITYSLFVYYTPLFLICYSYWFIIAAVAAHEKAMREQAKKMNVKSLRSSEDCDKSAEGKLAKVALTTISLWFMAWTPYLVICYFGL 307          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Zebrafish
Match: rrh (retinal pigment epithelium-derived rhodopsin homolog [Source:ZFIN;Acc:ZDB-GENE-040912-94])

HSP 1 Score: 79.7221 bits (195), Expect = 1.467e-15
Identity = 60/235 (25.53%), Postives = 111/235 (47.23%), Query Frame = 3
Query:  612 HFIYSSLGVV-LGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYSTRKIQLPWNVNQILY-----VCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHL-FTLSLETRKTEKINSFEKI---------MNNVSRKLFLMDLFSWCGYLVLCL---IGLVSNQDSPWAILFSSVSPLLTKFGIALLPMLY 1259
            +  ++ +GV  +G  ++A S   G W FG   CQ YA     FG+++I ++ V+A++RY +  +  +   +    Y       W+  +FWS +P+ G+  YA +    +CTI   +   +   Y   +I V F++P+S  +MF+  + +S   ++ +  N  + I         +  +S  + +M L +W  Y ++CL    G      +P AI    ++PLL K      P +Y
Sbjct:  111 NLAFTDIGVAGIGYPMSAASDLHGSWKFGYMGCQIYAALNIFFGMASIGLLTVVAIDRYLTICRPDIGQKLTTRSYTLLIVAAWLNAVFWSSMPIVGWAGYAPDPTGATCTINWRNNDTSFVSYTMTVITVNFIIPLS--VMFYCYYNVSATVKRFKASNCLDSINMDWSDQMDVTKMSVIMIVMFLAAWSPYSIVCLWASFGDPQKIPAPMAI----IAPLLAKSSTFYNPCIY 339          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Zebrafish
Match: rgra (retinal G protein coupled receptor a [Source:ZFIN;Acc:ZDB-GENE-040924-6])

HSP 1 Score: 78.5666 bits (192), Expect = 1.635e-15
Identity = 69/219 (31.51%), Postives = 103/219 (47.03%), Query Frame = 3
Query:  624 SSLGVVLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERY--YSTR-KIQLPWNVNQILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSI---GIMFHLFTLSLETRKTEKINSFEKIMNNVSRKLFLMDLFSWCGYLVLCLIGLVSNQD--SPW----AILFSSVSPLLTKFGIAL 1244
            + +G+   A +AA S F+  W +G   CQ + F+GF+  +++I+ I  IA +RY  Y TR K+Q    +  +L+  W+   FW+ +PLFG+G Y  E  +T CT+   D S   + Y      V +L+P+SI   GI   +  LS      +K     +   N    L  M LF W  Y +L     V N    SP     A + +  SP    F  AL
Sbjct:   61 ADMGISTNATVAAFSSFLRYWPYGSDGCQTHGFQGFMTALASIHFIAAIAWDRYHQYCTRTKLQWSSAITLVLFT-WLFTAFWAAMPLFGWGEYDYEPLRTCCTL---DYSKGDRNY------VSYLIPMSIFNMGIQVFV-VLSSYQSIDKKFKKTGQAKFNCGTPLKTM-LFCWGPYGILAFYAAVENATLVSPKLRMIAPILAKTSPTFNVFVYAL 267          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Zebrafish
Match: opn4a (opsin 4a (melanopsin) [Source:NCBI gene;Acc:571624])

HSP 1 Score: 73.9442 bits (180), Expect = 2.450e-13
Identity = 62/218 (28.44%), Postives = 104/218 (47.71%), Query Frame = 3
Query:  681 RWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYS-TRKIQLPWNVNQ-----ILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLFTL-SLET-----------RKTEKINSFEKIMN-----NVSRKLFLMDLFSWCGYLVLCLIGLVSNQD--SPWAILFSSVSPLLTKFGIALLPMLY 1259
            RW+FG+  C+ YAF G +FGI ++  ++VIA++RY+  TR +     ++Q     IL V W+  L WSL P FG+ +Y  E   TSCT      + + + Y   L I  F +P+ + I  + F   S+ T            K + +  F+++ N      ++  + LM + SW  Y  + L       D  +P+    +SV  ++ K      P++Y
Sbjct:  141 RWIFGEKGCELYAFCGALFGICSMITLMVIAVDRYFVITRPLASIGVLSQKRALLILLVAWVYSLGWSLPPFFGWSAYVPEGLLTSCTWDYMTFTPSVRAYTMLLFIFVFFIPLIVIIYCYFFIFRSIRTTNEAVGKINGDNKRDSMKRFQRLKNEWKMAKIALIVILMYVISWSPYSTVALTAFAGYSDFLTPY---MNSVPAVIAKASAIHNPIIY 355          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Zebrafish
Match: opn4a (opsin 4a (melanopsin) [Source:NCBI gene;Acc:571624])

HSP 1 Score: 73.9442 bits (180), Expect = 2.532e-13
Identity = 62/218 (28.44%), Postives = 104/218 (47.71%), Query Frame = 3
Query:  681 RWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYS-TRKIQLPWNVNQ-----ILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLFTL-SLET-----------RKTEKINSFEKIMN-----NVSRKLFLMDLFSWCGYLVLCLIGLVSNQD--SPWAILFSSVSPLLTKFGIALLPMLY 1259
            RW+FG+  C+ YAF G +FGI ++  ++VIA++RY+  TR +     ++Q     IL V W+  L WSL P FG+ +Y  E   TSCT      + + + Y   L I  F +P+ + I  + F   S+ T            K + +  F+++ N      ++  + LM + SW  Y  + L       D  +P+    +SV  ++ K      P++Y
Sbjct:  140 RWIFGEKGCELYAFCGALFGICSMITLMVIAVDRYFVITRPLASIGVLSQKRALLILLVAWVYSLGWSLPPFFGWSAYVPEGLLTSCTWDYMTFTPSVRAYTMLLFIFVFFIPLIVIIYCYFFIFRSIRTTNEAVGKINGDNKRDSMKRFQRLKNEWKMAKIALIVILMYVISWSPYSTVALTAFAGYSDFLTPY---MNSVPAVIAKASAIHNPIIY 354          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Zebrafish
Match: opn4xb (opsin 4xb [Source:NCBI gene;Acc:563080])

HSP 1 Score: 72.7886 bits (177), Expect = 2.811e-13
Identity = 67/238 (28.15%), Postives = 117/238 (49.16%), Query Frame = 3
Query:  585 NEDCRKIHRHFIYS-SLGVVLGAILAAPSRFVG----RWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYS-TRKIQ-LPWNVNQ---ILYVC-WIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLF--------TLSLETRKTEKINSFEKIMNNVSR--------KLFLMDLFSWCGYLVLCLIGLVSNQD--SPWAILFSSV 1211
            N+  R +  +FI + ++   L AI  +P  F+      W+FG+  C+ YAF G +FGI+++  ++ I+++RY   T+ +Q + WN  +   +  +C W+  L WSL PL G+ SY  E   TSCT      S  ++ Y   L    F +P+SI +  +LF        +  LE   ++K +SF K  +  S          + ++ + SW  Y  + L+    +QD  +P++    +V
Sbjct:   46 NKKLRSLPNYFIMNLAVSDFLMAITQSPIFFINCLYKEWMFGELGCKIYAFCGALFGITSMINLLAISIDRYLVITKPLQTIQWNSKRRTGLAILCIWLYSLAWSLAPLIGWSSYIPEGLMTSCTWDYVSPSPANKSYTMMLCCFVFFIPLSIILYCYLFMFLSVRQASRDLEMLSSQK-SSFVKQQSMRSEWKLAKIAAVVIVVYVLSWAPYACVTLVAWAGHQDVLTPYSKTLPAV 282          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Xenopus
Match: hes5.1 (hes family bHLH transcription factor 5 [Source:Xenbase;Acc:XB-GENE-481135])

HSP 1 Score: 80.4925 bits (197), Expect = 5.115e-16
Identity = 57/187 (30.48%), Postives = 93/187 (49.73%), Query Frame = 3
Query:  624 SSLGVVLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERY--YSTRKIQLPWNVN-QILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLFTLSLETRKTEKINSFEKIMNNVSRKLFLMDLFSWCGYLVLCLIGLVSN 1175
            +  G+ L A +AA S F+  W +G   CQ + F+GFV  +S+I     IA +RY  Y TR  +L W+    +++  W    FWS +PLFG+G Y  E  +T CT+       N+  Y+  +    FL+P+ I +M    ++  + +K+ +I  F   M   S       +F W  Y +LC   ++ +
Sbjct:   61 ADTGLCLNAFVAAFSSFLRYWPYGSEGCQIHGFQGFVAALSSIGSCAAIAWDRYHQYCTRS-KLHWSTAVSVVFFIWGFSAFWSAMPLFGWGEYDYEPLRTCCTLDYSKGDRNYISYLFTMAFFEFLVPLFI-LMTAYQSIYQKMKKSGQIR-FNTSMPVKSL------VFCWGPYCLLCFYAVIQD 238          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Xenopus
Match: ENSXETT00000008004.1 (opsin 5, gene 2 [Source:NCBI gene;Acc:100493595])

HSP 1 Score: 72.7886 bits (177), Expect = 2.895e-13
Identity = 67/224 (29.91%), Postives = 101/224 (45.09%), Query Frame = 3
Query:  654 LAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYSTRKIQLPWNVNQILYVC------WIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLL-----PVSI-----GIMFHLFTLSLETRKTEKINSFEKIMNNVSRKLFLMD---LFSWCGYLVLCLIGLV-SNQDSPWAILFSSVSPLLTKFGIALLPMLYWS 1265
            LA  S +   WL GD  C +YA  GF FG+S++  + V+A+ RY  T   +      +   VC      W+  L W++LPL G+G Y  E   TSCTI   D  H+   +    II  F+L      V+I     GI + L     E +  +KI +  K+   ++    L+    L SW  Y  +    L  S++  P  +  S +  L  K   A  PM+Y++
Sbjct:   70 LAIASAWNHAWLGGDASCLYYALMGFFFGVSSMMTLTVMAIIRYRVTSSFKYSGCTIEKKAVCILIMCIWLYALLWAVLPLLGWGRYGPEPFGTSCTIAWGDFHHSSNGF--SFIISMFILCTISPAVTIVVCYSGIAWKLHKAYQEIKNQDKIPNSTKVEKKLTLLAILVSFGFLISWTPYAAVSFWSLFHSSKYIPPVV--SLLPCLFAKSSTAFNPMIYYA 289          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Xenopus
Match: camk2d (calcium/calmodulin dependent protein kinase (CaM kinase) II delta [Source:Xenbase;Acc:XB-GENE-868293])

HSP 1 Score: 70.4774 bits (171), Expect = 1.960e-12
Identity = 51/198 (25.76%), Postives = 97/198 (48.99%), Query Frame = 3
Query:  612 HFIYSSLGVV-LGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYSTRKIQLPWNVN-----QILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLFTLSLETRKT-------EKIN---SFEKIMNNVSRKLFLMDLFSWCGYLVLCL 1157
            +  ++ +GV  +G  ++A S   G W FG   CQ YA     FG+++I ++ V+A++RY +  +  +   ++      ++   WI  +FWS++P+ G+ SYA +    +CTI       +   Y   ++ V F++P  + +MF+ +     T K          IN   S +  +  +S  + +M L +W  Y ++CL
Sbjct:   83 NLAFTDIGVSGIGYPMSAASDLHGSWKFGYVGCQIYAGLNIFFGMASIGLLTVVAIDRYLTICRPDIGRRISGRHYTAMILAAWINAVFWSVMPVVGWSSYAPDPTGATCTINWRKNDVSFVSYTMSVVAVNFVVP--LMVMFYCYYNVSRTMKGYGSRSSLGGINADWSDQTDVTKMSMVMIVMFLVAWSPYSIVCL 278          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Xenopus
Match: ENSXETT00000039733.1 (melanopsin-B-like [Source:NCBI gene;Acc:100485437])

HSP 1 Score: 63.1586 bits (152), Expect = 7.473e-10
Identity = 60/253 (23.72%), Postives = 112/253 (44.27%), Query Frame = 3
Query:  585 NEDCRKIHRHFIYS-SLGVVLGAILAAPSRFVG----RWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYS-TRKIQ-LPWNVN----QILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLP---VSIGIMFHLFTLSLETRKTEKINSF------------EKIMNNVSRKLFLMDLFSWCGYLVLCLIGLVSNQDS--PWAILFSSVSPLLTKFGIALLPMLY 1259
            N+  R    +FI + ++   L +   AP  F+      W+ G+  C  YAF G +FGI+++  ++ I++ RY   T+ +Q + W+      Q++ + W+    WSL PL G+ SY  E  + SCT      + +++ Y   L    F +P   +S    F    +    R  +K+ S+            E  M  ++  + ++ + SW  Y  + LI    +  S  P++    +V  ++ K      P++Y
Sbjct:   57 NKKLRTAPNYFIMNLAISDFLMSATQAPVCFLSSLHREWILGEIGCNVYAFCGALFGITSMMTLLAISVNRYIVITKPLQSIQWSSKKRTLQVIVLVWMYSFMWSLAPLLGWSSYVPEGLRISCTWDYVTSTTSNKSYTMMLCCCVFFIPLIIISHCYFFMFLAIRSTGRNVQKLGSYGRQSFLTPTMKNEWKMAKIAFVIIIVYVLSWSPYACVTLIAWAGHGKSLTPYS---KTVPAVIAKASAIYNPIIY 306          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Xenopus
Match: OPN5 (opsin 5 [Source:NCBI gene;Acc:100497642])

HSP 1 Score: 62.003 bits (149), Expect = 1.017e-9
Identity = 56/229 (24.45%), Postives = 101/229 (44.10%), Query Frame = 3
Query:  627 SLGV-VLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYSTRKIQL-PWNVNQ----ILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIK--IFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLFTLSLETRKTEKINSFE-KIMNNVSRKLFLMD---------LFSWCGYLVLCLIGLVSNQDSPWAILFSSVSPLLTKFGIALLPMLY 1259
             LG+ V G   A  S F  RW+FG   C++Y + GF FG  ++  + V++++RY     ++   W   +     L V W     W+ LPL G G+YA E   T+CT+   +   S   Q+++  ++    L P  + +  +   ++      +++  F+ +  NN + ++ L           L +W  Y V+ +       DS   I  S V  ++ K      P++Y
Sbjct:   79 DLGISVTGKPFAIVSCFSHRWVFGWNACRWYGWAGFFFGCGSLITLTVVSLDRYLKICHLRYGTWLKRRHAFIALAVIWAYATLWATLPLVGVGNYAPEPFGTTCTLDWWLAQASVKGQIFVLSMLFFCLLFPTMVIVFSYAKIIAKVKSSAKEVAHFDTRNQNNHTLEIKLTKVAMLICAGFLIAWFPYAVVSVWSAFGQPDSI-PIELSVVPTMMAKSASMYNPIIY 306          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Mouse
Match: Rrh (retinal pigment epithelium derived rhodopsin homolog [Source:MGI Symbol;Acc:MGI:1097709])

HSP 1 Score: 80.1073 bits (196), Expect = 8.931e-16
Identity = 62/230 (26.96%), Postives = 109/230 (47.39%), Query Frame = 3
Query:  621 YSSLGVV-LGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYSTRKIQLPWNVNQILYV-----CWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFH----------LFTLSLETRKTEKINSFEKIMNNVSRKLFLMDLFSWCGYLVLCLIGLVSNQDS-PWAILFSSVSPLLTKFGIALLPMLY 1259
            ++ +GV  +G  ++A S   G W FG   CQ YA     FG+ +I ++ V+AM+RY +     +   +    Y+      WI GLFW+L+P+ G+ SYA +    +CTI   +   +   Y   +I+V F++P++  +MF+          L+  S  T    +  + +  +  +S  + LM L +W  Y ++CL     N    P ++    ++PL  K      P +Y
Sbjct:   69 FTDIGVSSIGYPMSAASDLHGSWKFGHAGCQIYAGLNIFFGMVSIGLLTVVAMDRYLTISCPDVGRRMTTNTYLSMILGAWINGLFWALMPIIGWASYAPDPTGATCTINWRNNDTSFVSYTMMVIVVNFIVPLT--VMFYCYYHVSRSLRLYAASDCTAHLHRDWADQADVTKMSVIMILMFLLAWSPYSIVCLWACFGNPKKIPPSMAI--IAPLFAKSSTFYNPCIY 294          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Mouse
Match: Rrh (retinal pigment epithelium derived rhodopsin homolog [Source:MGI Symbol;Acc:MGI:1097709])

HSP 1 Score: 80.1073 bits (196), Expect = 8.931e-16
Identity = 62/230 (26.96%), Postives = 109/230 (47.39%), Query Frame = 3
Query:  621 YSSLGVV-LGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYSTRKIQLPWNVNQILYV-----CWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFH----------LFTLSLETRKTEKINSFEKIMNNVSRKLFLMDLFSWCGYLVLCLIGLVSNQDS-PWAILFSSVSPLLTKFGIALLPMLY 1259
            ++ +GV  +G  ++A S   G W FG   CQ YA     FG+ +I ++ V+AM+RY +     +   +    Y+      WI GLFW+L+P+ G+ SYA +    +CTI   +   +   Y   +I+V F++P++  +MF+          L+  S  T    +  + +  +  +S  + LM L +W  Y ++CL     N    P ++    ++PL  K      P +Y
Sbjct:   69 FTDIGVSSIGYPMSAASDLHGSWKFGHAGCQIYAGLNIFFGMVSIGLLTVVAMDRYLTISCPDVGRRMTTNTYLSMILGAWINGLFWALMPIIGWASYAPDPTGATCTINWRNNDTSFVSYTMMVIVVNFIVPLT--VMFYCYYHVSRSLRLYAASDCTAHLHRDWADQADVTKMSVIMILMFLLAWSPYSIVCLWACFGNPKKIPPSMAI--IAPLFAKSSTFYNPCIY 294          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Mouse
Match: Opn5 (opsin 5 [Source:MGI Symbol;Acc:MGI:2662912])

HSP 1 Score: 70.4774 bits (171), Expect = 1.801e-12
Identity = 56/224 (25.00%), Postives = 98/224 (43.75%), Query Frame = 3
Query:  639 VLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYSTRKIQLP-WNVNQILYVC----WIVGLFWSLLPLFGFGSYALELHQTSCTIK--IFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLFTLSLETRKTEKINSF----------EKIMNNVSRKLFLMDLFSWCGYLVLCLIGLVSNQDSPWAILFSSVSPLLTKFGIALLPMLY 1259
            V+G      S F  RW+FG F C++Y + GF FG  ++  +  ++++RY     +    W   +  Y+C    W    FW+ +PL G G YA E   TSCT+   +   S   Q+++  ++    LLP ++ +  +   ++     ++++  F          E  +  V+  +    L +W  Y V+ +       DS   I  S V  LL K      P++Y
Sbjct:   84 VVGKPFTIISCFCHRWVFGWFGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICYLSYGVWLKRKHAYICLAVIWAYASFWTTMPLVGLGDYAPEPFGTSCTLDWWLAQASGGGQVFILSILFFCLLLPTAVIVFSYAKIIAKVKSSSKEVAHFDSRIHSSHVLEVKLTKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSI-PIQLSVVPTLLAKSAAMYNPIIY 306          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Mouse
Match: Rgr (retinal G protein coupled receptor [Source:MGI Symbol;Acc:MGI:1929473])

HSP 1 Score: 67.3958 bits (163), Expect = 8.242e-12
Identity = 44/133 (33.08%), Postives = 69/133 (51.88%), Query Frame = 3
Query:  624 SSLGVVLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERY--YSTRKIQLPWN--VNQILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSI 1010
            +  G+ L A++AA S  + RW  G   CQ + F+GF   +++I     +A  RY  Y TR+ QL W+  +  +L+V W+   FW+ LPL G+G Y  E   T CT+       N   ++  +    FL+P+ I
Sbjct:   61 ADTGISLNALVAAVSSLLRRWPHGSEGCQVHGFQGFATALASICGSAAVAWGRYHHYCTRR-QLAWDTAIPLVLFV-WMSSAFWASLPLMGWGHYDYEPVGTCCTLDYSRGDRNFISFLFTMAFFNFLVPLFI 191          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Mouse
Match: Rgr (retinal G protein coupled receptor [Source:MGI Symbol;Acc:MGI:1929473])

HSP 1 Score: 67.0106 bits (162), Expect = 8.786e-12
Identity = 44/133 (33.08%), Postives = 69/133 (51.88%), Query Frame = 3
Query:  624 SSLGVVLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERY--YSTRKIQLPWN--VNQILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSI 1010
            +  G+ L A++AA S  + RW  G   CQ + F+GF   +++I     +A  RY  Y TR+ QL W+  +  +L+V W+   FW+ LPL G+G Y  E   T CT+       N   ++  +    FL+P+ I
Sbjct:   61 ADTGISLNALVAAVSSLLRRWPHGSEGCQVHGFQGFATALASICGSAAVAWGRYHHYCTRR-QLAWDTAIPLVLFV-WMSSAFWASLPLMGWGHYDYEPVGTCCTLDYSRGDRNFISFLFTMAFFNFLVPLFI 191          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. UniProt/SwissProt
Match: sp|P23820|REIS_TODPA (Retinochrome OS=Todarodes pacificus OX=6637 PE=1 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.023e-21
Identity = 70/227 (30.84%), Postives = 112/227 (49.34%), Query Frame = 3
Query:  612 HFIYSSLGVVLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYSTRKIQLPWNVNQILY-----VCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIG---IMFHLFTLS----LETRKTEKINSFEKIMNNVSRKLFLMDLFSWCGYLVLCLIGLVSNQDSPWAILFSSVSPLLTKFGIALLPML 1256
            H + +++ V  G    A S  VGRWL+G   CQ   F GF  G+S+I ++   AMERY +    +    +  + Y     + +  G FW+ +PL G+ SY LE+H TSCTI       ++Q Y+  L I  F+ P+  G   I      LS     E  K + I S E+ +  ++    L+ L SW G+  + +   +++  +  + L   V P+++K G AL P+L
Sbjct:   59 HVLITAMAVNGGDPAHASSSIVGRWLYGSVGCQLMGFWGFFGGMSHIWMLFAFAMERYMAVCHREFYQQMPSVYYSIIVGLMYTFGTFWATMPLLGWASYGLEVHGTSCTINYSVSDESYQSYVFFLAIFSFIFPMVSGWYAISKAWSGLSAIPDAEKEKDKDILS-EEQLTALAGAFILISLISWSGFGYVAIYSALTHGGAQLSHLRGHVPPIMSKTGCALFPLL 284          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. UniProt/SwissProt
Match: sp|P47804|RGR_HUMAN (RPE-retinal G protein-coupled receptor OS=Homo sapiens OX=9606 GN=RGR PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.235e-15
Identity = 61/209 (29.19%), Postives = 97/209 (46.41%), Query Frame = 3
Query:  570 QNNQINEDCRKIHRHFIYSSLGVVLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERY--YSTRKIQLPWN--VNQILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLFTLSLETRKTEKINSFEKIMNNVSRKLFLMDLFSWCGYLVLCLIGLVSNQDS 1184
            +  ++   C  +      +  G+ L A++AA S  + RW +G   CQ + F+GFV  +++I     IA  RY  Y TR  QL WN  V+ +L+V W+   FW+ LPL G+G Y  E   T CT+       N   ++  +    F +P+ I I  +    SL  +K  K    +      +R L    L  W  Y +L L  ++++  S
Sbjct:   43 KTPELRTPCHLLVLSLALADSGISLNALVAATSSLLRRWPYGSDGCQAHGFQGFVTALASICSSAAIAWGRYHHYCTRS-QLAWNSAVSLVLFV-WLSSAFWAALPLLGWGHYDYEPLGTCCTLDYSKGDRNFTSFLFTMSFFNFAMPLFITITSY----SLMEQKLGKSGHLQVNTTLPARTL----LLGWGPYAILYLYAVIADVTS 241          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. UniProt/SwissProt
Match: sp|O35214|OPSX_MOUSE (Visual pigment-like receptor peropsin OS=Mus musculus OX=10090 GN=Rrh PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 6.247e-15
Identity = 62/230 (26.96%), Postives = 109/230 (47.39%), Query Frame = 3
Query:  621 YSSLGVV-LGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYSTRKIQLPWNVNQILYV-----CWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFH----------LFTLSLETRKTEKINSFEKIMNNVSRKLFLMDLFSWCGYLVLCLIGLVSNQDS-PWAILFSSVSPLLTKFGIALLPMLY 1259
            ++ +GV  +G  ++A S   G W FG   CQ YA     FG+ +I ++ V+AM+RY +     +   +    Y+      WI GLFW+L+P+ G+ SYA +    +CTI   +   +   Y   +I+V F++P++  +MF+          L+  S  T    +  + +  +  +S  + LM L +W  Y ++CL     N    P ++    ++PL  K      P +Y
Sbjct:   69 FTDIGVSSIGYPMSAASDLHGSWKFGHAGCQIYAGLNIFFGMVSIGLLTVVAMDRYLTISCPDVGRRMTTNTYLSMILGAWINGLFWALMPIIGWASYAPDPTGATCTINWRNNDTSFVSYTMMVIVVNFIVPLT--VMFYCYYHVSRSLRLYAASDCTAHLHRDWADQADVTKMSVIMILMFLLAWSPYSIVCLWACFGNPKKIPPSMAI--IAPLFAKSSTFYNPCIY 294          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. UniProt/SwissProt
Match: sp|O14718|OPSX_HUMAN (Visual pigment-like receptor peropsin OS=Homo sapiens OX=9606 GN=RRH PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 6.601e-15
Identity = 63/224 (28.12%), Postives = 108/224 (48.21%), Query Frame = 3
Query:  642 LGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYSTRKIQLPWNVNQILYV-----CWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLF---TLSLE----TRKTEKIN---SFEKIMNNVSRKLFLMDLFSWCGYLVLCL---IGLVSNQDSPWAILFSSVSPLLTKFGIALLPMLY 1259
            +G  ++A S   G W FG   CQ YA     FG+++I ++ V+A++RY +     +   +    Y+      WI GLFW+L+P+ G+ SYA +    +CTI       +   Y   +I + F++P++  +MF+ +   TLS++    +  TE +N   S +  +  +S  +  M L +W  Y ++CL    G       P AI    ++PL  K      P +Y
Sbjct:   77 IGYPMSAASDLYGSWKFGYAGCQVYAGLNIFFGMASIGLLTVVAVDRYLTICLPDVGRRMTTNTYIGLILGAWINGLFWALMPIIGWASYAPDPTGATCTINWRKNDRSFVSYTMTVIAINFIVPLT--VMFYCYYHVTLSIKHHTTSDCTESLNRDWSDQIDVTKMSVIMICMFLVAWSPYSIVCLWASFGDPKKIPPPMAI----IAPLFAKSSTFYNPCIY 294          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. UniProt/SwissProt
Match: sp|O15973|OPSD1_MIZYE (Rhodopsin, GQ-coupled OS=Mizuhopecten yessoensis OX=6573 GN=SCOP1 PE=1 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.393e-14
Identity = 53/190 (27.89%), Postives = 92/190 (48.42%), Query Frame = 3
Query:  666 SRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYS-TRKIQLPWNVNQ-----ILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSI----------GIMFH-----LFTLSLET---RKTEKINSFEKIMNNVSRKLFLMDLFSWCGYLVLCLIG 1163
            S F  +W+FG   CQ Y F G VFG+ +IN +  I+++RY   T+ +Q    + +     ++ + W++ +  S+ P FG+G+Y  E  QTSCT      +   + Y+  L + GFL+P+ I          G+  H       T S++T   R   K    E  ++ ++  +  + + SW  Y ++ LI 
Sbjct:  112 SSFHQKWIFGSLFCQLYGFVGGVFGLMSINTLTAISIDRYVVITKPLQASQTMTRRKVHLMIVIVWVLSILLSIPPFFGWGAYIPEGFQTSCTFDYLTKTARTRTYIVVLYLFGFLIPLIIIGVCYVLIIRGVRRHDQKMLTITRSMKTEDARANNKRARSELRISKIAMTVTCLFIISWSPYAIIALIA 301          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. TrEMBL
Match: A0A4Z2CMU9 (Opsin-5 isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_009156 PE=4 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 3.692e-25
Identity = 77/234 (32.91%), Postives = 122/234 (52.14%), Query Frame = 3
Query:  600 KIHRHFIYSSLGVVLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINI---IVVIAMERYYSTRKIQ--LPWNVNQILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGI--MFHLFTLSLET-RKTEKINSFEKIMNNVSRKLFLMDLFSWCGYLVLCLIGLVSNQDS--PWAILFSSVSPLLTKFGIALLPMLYWSVK 1271
            K H H   +SLG +L     A   +   W FG+F CQ Y+F+G  FG+++I++   I  I M    +   I+  +    NQIL   WI+G  W+ LPLFG+G Y LE H+TSC +   ++  + +LYM  +  +G++LP  I I   + L      +   T+K N   +I+  ++  + L  LF W  Y VL +  LV+   +  P+A     ++ LL K   A LP+ Y+S++
Sbjct:   23 KSHYHLTIASLGCILITPFTAIGVYRKGWPFGEFACQLYSFDGMFFGMTSIHLSCFICFITMIEVLNITYIRDFISNRYNQILCGIWIIGAIWATLPLFGYGRYTLEPHKTSCLLDWNNMDESMKLYMFAISTLGYILPFGIAIWSQYKLIQRPKSSGGDTDKNNEKIEILMKLNNSILLFSLFGWLSYGVLAINSLVAGHITLNPFAY---CITQLLAKISQAFLPIAYYSIE 253          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. TrEMBL
Match: A0A0L8HQC0 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22010085mg PE=4 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 7.120e-22
Identity = 70/240 (29.17%), Postives = 121/240 (50.42%), Query Frame = 3
Query:  570 QNNQINEDCRKIHRHFIYSSLGVVLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYSTRKIQLPWNVNQILY-----VCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMF------HLFTLSLETRKTEKINSFEKIMNNVSRKLFLMDLFSWCGYLVLCLIGLVSNQDSPWAILFSSVSPLLTKFGIALLPML 1256
            QN Q       +  +F+ +S  V +G  L + S   GRWLFG+F C FY F GFV GIS+I ++    +ERY +T   +    +  I Y       + VG FW+++PL G+G Y LE   TSCTI   + + + Q  +  ++IV +  P+ +           L  +S   ++ ++    E+ +  ++     + L SW G+  + +   +++  +  + L  S++PLL+K G+ L PM+
Sbjct:   49 QNTQPRRKYSTL-IYFLLTSALVNIGFPLNSSSSIAGRWLFGNFGCHFYGFIGFVVGISHIWMLFAFCIERYVATCHREFYKRMPSIYYTLLFAAMYSVGTFWAVMPLLGWGEYGLEPTGTSCTISYINATDSFQSLIMSMVIVTYSFPIIVSCYAVSKAWTALGNMSDSEKEKDRDLLSEEQLTAMATVFIPIALISWSGFAYVSIYSAITDGGTTLSHLSVSMAPLLSKAGVILYPMI 287          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. TrEMBL
Match: W5XRX9 (Peropsin (Fragment) OS=Platynereis dumerilii OX=6359 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.301e-21
Identity = 66/241 (27.39%), Postives = 125/241 (51.87%), Query Frame = 3
Query:  570 QNNQINEDCRKIHRHFIYSSLGVVLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMER--------YYSTRKIQLPWNVNQILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLP---VSIGIMFHLFTLSLETRKTEKINSFEKIMNNVSRKLFLMDLFSWCGYLVLCLIGLVSNQDSPWAILFSSVSPLLTKFGIALLPMLY 1259
            + N ++     +H     S+ GV+ G    A S F GRWLFG+  CQFYAFEG  FGIS+I ++ V++++R        YY    ++  W     + VC++   FWS +P+ G+  YAL+    +C +   + + +++ Y+  + +  F+LP   ++IG +         +   EK++  ++  + + R L ++ + +W  + +LCL  LV +     +I  +++  L+ K   A +P++Y
Sbjct:   54 RENLVSRGSAAVHVAMAISNAGVLAGFPFTASSAFAGRWLFGEAGCQFYAFEGMFFGISSILLLGVLSVDRFINIHWPQYYGDLYLRPYW---LAILVCYLTAAFWSTVPIVGWARYALDKTHVACVVDWANPTSSYKSYIFAITMSCFMLPYALMAIGFIRTCLGRKATSTNVEKLS--DRDHDLIVRSLSIVSMVTWTPFAILCLQFLVRDPYDT-SITMAAMPALICKAVTAGVPLVY 288          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. TrEMBL
Match: A0A4E0RMI5 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_000926 PE=4 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.945e-21
Identity = 71/243 (29.22%), Postives = 120/243 (49.38%), Query Frame = 3
Query:  603 IHRHFIYSSLGVVLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYSTRK--IQLPWNVNQILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLFTLSLETRKTEKINSFEKIMNNVSRKL-------------FLMDLFSWCGYLVLCLIGLVSNQDSPWAILF--SSVSP-------LLTKFGIALLPMLY 1259
            +H H   ++LGVV      A S F  +W+FG   CQ YA EG + G++ I +   I +  +   R   I   W    ++ + WI G+FWS+LPLFGFG Y LE H+T+C +++     N ++Y+  L ++G+++PV +  + +    S+  +  ++I + +K   N+++K+              +  + +W    VL          + W+I F  S V+P       LL KFG A  P+ Y
Sbjct:   69 LHFHLALNNLGVVAAFPFGAISTFYNQWMFGSLGCQIYAVEGMICGMNTIALTCYICLLHWLDVRYGIIFSTWFYRIVVALSWIFGIFWSILPLFGFGKYDLEPHKTTCGLRMPPSDWNDKVYLIALTLLGYVVPVFVAAVTY---SSVVKQYCDEIGNSDKTEENIAKKMEKFGTQIKLNGCILVQSILTWLALGVL----------ACWSISFGLSDVNPLVLYIPQLLAKFGCATAPISY 298          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. TrEMBL
Match: A0A5K4FAE3 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 2.971e-21
Identity = 70/242 (28.93%), Postives = 118/242 (48.76%), Query Frame = 3
Query:  597 RKIHRHFIYSSLGVVLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNI------------NIIVVIAMERYYSTRKIQLPWNVNQILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIG-------IMFHLFTLSLETRKTEKINSFEKIMNNVSRKLFLMDLFSWCGYLVLCLIGLVSNQDS--PWAILFSSVSPLLTKFGIALLPMLY 1259
            +  H H   + LG +     +A   +   W FG F CQ Y+F G +FG+++I             ++ +  +  + S R   +P+ +       WI+G FW++LPL G+G Y LE H+TSC +   ++  + +LYM  L I G++LP  IG       I + +   S   + T+KI    K+ N++     L ++F W  Y +L +  L+S Q +  P++     ++ LL K   A LP+ Y
Sbjct:   42 KTFHYHLAAACLGCIAITPFSAIGVYQKGWPFGHFGCQSYSFAGMLFGMTSIYLSCFICFLTMVEVLNLTYIRNFISNRYNYIPFGI-------WIIGAFWAILPLLGYGRYTLEPHKTSCLLDWTNMDESMKLYMFSLFIFGYILPFGIGIWSQHKLIQYAVSNASKNNKNTKKIEILIKLNNSI----LLFNIFGWLSYGLLAIHSLISGQLTLNPFSY---CITQLLAKISQAFLPIAY 269          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Cavefish
Match: rrh (retinal pigment epithelium-derived rhodopsin homolog [Source:NCBI gene;Acc:103046733])

HSP 1 Score: 84.3445 bits (207), Expect = 2.899e-17
Identity = 61/235 (25.96%), Postives = 112/235 (47.66%), Query Frame = 3
Query:  612 HFIYSSLGVV-LGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYSTRKIQLPWNVNQILY-----VCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHL-FTLSLETRKTEKINSFEKI---------MNNVSRKLFLMDLFSWCGYLVLCLIGLVSNQD---SPWAILFSSVSPLLTKFGIALLPMLY 1259
            +  ++ +GV  +G  ++A S   G W FG   CQ YA     FG+++I ++ V+A++RY S  +  +   +    Y       W+  +FWS +P+ G+  YA +    +CTI   +   +   Y   +I V F++P+S  +MF+  + +S+  ++ +  N  E I         +  +S  + +M L +W  Y ++CL    S+     +P AI    ++PL  K      P +Y
Sbjct:   72 NLAFTDVGVAGIGYPMSAASDLYGSWKFGHTGCQIYAALNIFFGMASIGLLTVVAIDRYISICRPDIGQKMTTCSYTILIVAAWLNAVFWSSMPIVGWAGYAPDPTGATCTINWRNNDASFISYTMAVIFVNFIVPLS--VMFYCYYNVSVTIKRYKASNCLESINIDWSDQMDVTKMSVVMIVMFLVAWSPYSIVCLWASFSDPKMIPAPMAI----IAPLFAKSSTFYNPCIY 300          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Cavefish
Match: rgra (RPE-retinal G protein-coupled receptor-like [Source:NCBI gene;Acc:103044937])

HSP 1 Score: 75.8702 bits (185), Expect = 9.461e-15
Identity = 64/220 (29.09%), Postives = 101/220 (45.91%), Query Frame = 3
Query:  624 SSLGVVLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERY--YSTRKIQLPWN-VNQILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIM----FHLFTLSLETRKTEKINSFEKIMNNVSRKLFLMDLFSWCGYLVLCLIGLVSNQD--SPW----AILFSSVSPLLTKFGIAL 1244
            + +G+ + A +AA S F+  W +G   CQ + F GF+  +S+I+ I  IA +RY  Y TR  +L W+ V  +    W+   FW+ +PL G+G Y  E  +T CT+ I     N+         + +++P++I  M    F + +      K  K    +K   +   K     LF W  Y +L     V N +  SP     A + +  SPL   F  AL
Sbjct:   61 ADMGICMNATIAAFSSFLRYWPYGSEGCQTHGFHGFLTALSSIHFIAAIAWDRYHQYCTR-TKLQWSRVITLAIFIWLFTAFWAAMPLIGWGEYDYEPLRTCCTLDISKGDRNY---------ISYVIPMAICNMGIQTFIVMSCYKSIDKKFKKTGQDKFSCSTPLKTL---LFCWGPYGILAFYATVQNANLLSPKLKMIAPIVAKTSPLCNVFVYAL 267          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Cavefish
Match: opn4xb (opsin 4xb [Source:NCBI gene;Acc:563080])

HSP 1 Score: 70.4774 bits (171), Expect = 4.717e-13
Identity = 52/171 (30.41%), Postives = 88/171 (51.46%), Query Frame = 3
Query:  585 NEDCRKIHRHFIYS-SLGVVLGAILAAPSRFVG----RWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYS-TRKIQ-LPWNVNQ----ILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLFTLSLETRKTEK 1064
            N   R +   FI + ++  +L A+  +P  F+     +W+ G+  C+ YAF G +FGIS++  ++ I+++RY   TR +Q + WN       I+ + WI  L WSL PL G+ +Y  E   TSCT      +  ++ Y   L    F +P+ I I++    + L  R+T +
Sbjct:   47 NRKLRTLPNFFIINLAVSDLLMALTQSPVFFINCLHTQWMMGELGCEIYAFCGALFGISSMITLLAISVDRYLVITRPLQAMQWNSKCRTFIIITLVWIYSLAWSLAPLIGWSAYVPEGLMTSCTWDYASPAAGNRSYTLSLCCCVFFIPLII-ILYCYTCMFLSVRRTSR 216          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Cavefish
Match: opn4a (opsin 4 [Source:NCBI gene;Acc:103023553])

HSP 1 Score: 71.2478 bits (173), Expect = 1.434e-12
Identity = 62/218 (28.44%), Postives = 102/218 (46.79%), Query Frame = 3
Query:  681 RWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYS-TRKIQLPWNVNQ-----ILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLF---TLSLETRKTEKIN---------SFEKIMN-----NVSRKLFLMDLFSWCGYLVLCLIGLVSNQD--SPWAILFSSVSPLLTKFGIALLPMLY 1259
            RW+FG+  C+ YAF G +FGI ++  + VIA++RY+  TR +     ++Q     IL   W   L WSL P FG+ +Y  E   TSCT      + + + Y   L I  F +P+ + I  + F    + +  +  EKIN          F+++ N      V+  + L+ + SW  Y  + L       D  +P+    +SV  ++ K      P++Y
Sbjct:  128 RWIFGEKGCELYAFCGALFGICSMITLTVIAVDRYFVITRPLASIGVLSQKRALLILTCAWAYSLGWSLPPFFGWSAYVPEGLLTSCTWDYVTFTPSVRAYTMLLFIFVFFIPLIVIIYCYFFIFRAIRITNQDVEKINGNNTRDTIKKFQRLRNEWKMAKVALIVILLYVISWSPYSSVALTAFAGYADMLTPY---MNSVPAVIAKASAIHNPIIY 342          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Cavefish
Match: opn4b (opsin 4b [Source:ZFIN;Acc:ZDB-GENE-080415-3])

HSP 1 Score: 69.707 bits (169), Expect = 2.331e-12
Identity = 58/217 (26.73%), Postives = 102/217 (47.00%), Query Frame = 3
Query:  681 RWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYS-TRKIQLPWNVNQ-----ILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLFTLSLETRKTEK--------INSFEKI--------MNNVSRKLFLMDLFSWCGYLVLCLIGLVSNQD--SPWAILFSSVSPLLTKFGIALLPMLY 1259
            RW+FG+  C+ YAF G +FG+ ++  ++VIA++RY+  TR +     ++      IL + W+  + WSL P FG+ +Y  E   TSCT      + + + Y   L +  F +P+ + I++  F +    R T +         NS +K         M  V+  + L+ + SW  Y  + L       D  +P+    +SV  ++ K      P++Y
Sbjct:   92 RWIFGEKGCELYAFCGALFGMCSMITLMVIAVDRYFVITRPLASIGKMSHKRALFILVIAWLYTMCWSLPPFFGWSAYVPEGLMTSCTWDYMTFTPSVRAYTMLLFVFVFFIPLFV-IIYCYFCIFRAIRNTTRSWQCFGCLTNSIKKFHRMKSEWKMAKVALIVILLYVISWSPYSCVALTAFAGYADMLTPY---MNSVPAVIAKASAIHNPIIY 304          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Sea Lamprey
Match: opn4a (opsin 4a (melanopsin) [Source:NCBI gene;Acc:571624])

HSP 1 Score: 62.003 bits (149), Expect = 1.551e-10
Identity = 55/219 (25.11%), Postives = 98/219 (44.75%), Query Frame = 3
Query:  681 RWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYS-TRKIQLPWNVNQ-----ILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLFTL------------------SLETRKTEKINSFEKIMNNVSRKLFLMDLFSWCGYLVLCLIGLVSNQD--SPWAILFSSVSPLLTKFGIALLPMLY 1259
            RW+FG+  C+ YAF G +FGI+++  ++VIA +RY   TR +     +++     I    W   L WSL P FG+ +Y  E   TSCT      +   + Y   L    F +P+ + I  ++                     S E++K ++  + E  +  ++  + L+ + SW  Y  + L+      D  +P+    +SV  ++ K      P++Y
Sbjct:   79 RWIFGEKGCELYAFCGALFGIASMVTLMVIATDRYLVLTRPLASIGAMSKRRAMYITAAVWFYSLAWSLPPFFGWSAYVPEGLMTSCTWDYVTFTPAVRSYTMLLFCFVFFIPLIVIIFCYVRIFAAIKNTNRAVKTLGDAHDSKESQKQQQRMNAEWKLAKIALIVILLYVVSWSPYSCVALVAWAGYADMLTPY---MNSVPAIIAKASAIHNPIVY 294          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Sea Lamprey
Match: opn3 (opsin 3 [Source:ZFIN;Acc:ZDB-GENE-080227-16])

HSP 1 Score: 52.373 bits (124), Expect = 1.647e-7
Identity = 50/212 (23.58%), Postives = 85/212 (40.09%), Query Frame = 3
Query:  681 RWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYSTRKIQL---PWNVNQILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYM---------GGLIIVGF-----LLPVSIGIMFHLFTLSLETRKTEKINSFEKIMNNVSRKLFLMDLFSWCGYLVLCLIGLVSNQD--SPWAILFSSVSPLLTKFGIALLPMLY 1259
            RW++G+  C +  F   +FGI +I+ +  ++ ERY    K Q+    W    + Y  W+    W+  PL G+  Y LE H   C+I     +     ++           L+++GF      L ++     H+  +    R  + +   E     ++  +    L  W  Y VL L+    N D  +P     S +     K  IA  P+LY
Sbjct:   71 RWVWGNGGCVWDGFSNSLFGIVSISTLTALSYERYARLIKAQVLDFSWAWRAVTYT-WLYSAAWTGAPLLGWSRYVLEKHGLGCSIDWASSNPPDAAFVLFFFLGCLAAPLLVMGFCFGRIALAITQFRYLHVAQVHTAGRMAQTLRG-ESRAARLALLVVATFLLCWMPYAVLALLTAAGNGDLINP---ATSVIPSFFAKSSIAYNPILY 277          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Sea Lamprey
Match: parapinopsina (parapinopsin a [Source:ZFIN;Acc:ZDB-GENE-101129-1])

HSP 1 Score: 45.8246 bits (107), Expect = 9.386e-6
Identity = 51/186 (27.42%), Postives = 77/186 (41.40%), Query Frame = 3
Query:  738 GISNINIIVVIAMERYYSTRKIQLPWNVNQILYVC-----WIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLFTLSLETRKTEKINSFEKIMNNVSRKLFLMDL-------FSWCGYLVLCLIGLVSNQDSPWAILFSSVSPLLTKFGIALLPMLY 1259
            G++ +  + V+A+ERY    K     +      +C     W   L WS  PLFG+G Y  E   TSC     D S + + YM    I  F LP+ I I+F    L +   K  K+       +   RK+ +M +         W  Y  L  I +V   D   + + +S+   L K   A  P++Y
Sbjct:    1 GMTALITVCVLAVERYVVVCKPLGGVHFGTQHGLCGVAISWTWALAWSAPPLFGWGRYHYEGVGTSCAPDWADSSPSGRSYMTTYFIFCFALPMII-ILFCYTKLMIAIHKVSKLGLSAN--DTAERKVGIMVVVMVFAFFLCWLPYAALA-IAVVIKPDLKVSPVTASIPVYLAKSSGAYNPIIY 182          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Nematostella
Match: NVOP42 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWR8])

HSP 1 Score: 60.4622 bits (145), Expect = 3.732e-10
Identity = 52/221 (23.53%), Postives = 97/221 (43.89%), Query Frame = 3
Query:  630 LGVVLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYSTRKIQLPWNVNQILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLFTLSL----------ETRKTEKINSFEKIMNNVSRKLFLMDLFSWCGYLVLCLIGLVSNQD-SPWAILFSSVSPLLTKFGIALLPMLY 1259
            L  VLG  +      VG W     LC FY       G  ++  +  +A +R+ +  K      +  ++   W  G+ W++ P+ G+  Y LE  +T C I   D S  ++ Y+  +  + FLLP+++ I  + +   L           T ++EK N++   +      +FL  L +W  Y ++ L   ++ +  SP A   +++  +L K      P++Y
Sbjct:   58 LQAVLGKPVVIYGNVVGWWNADRALCVFYGLSTAALGFVSLLHLAALAFQRWLAITKPMTYKRIYPLVGTLWAWGMLWAVFPVLGWSGYELEPGETGCAITWNDQSTTNKSYIFIIFGIFFLLPITLVIGCYAWVAKLARNIDAAASQATLRSEKENAWTSFV------MFLGFLIAWLPYAIVSLYSAITGERVSPEA---ATIPGMLAKSASCYNPLIY 269          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Nematostella
Match: EDO32903 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STR1])

HSP 1 Score: 57.3806 bits (137), Expect = 5.088e-9
Identity = 32/117 (27.35%), Postives = 62/117 (52.99%), Query Frame = 3
Query:  681 RWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYST----RKIQLPWNVNQILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIM 1019
            +W+FGD +CQF  F   +F +S++  +  I++E+Y++      K+        ++   W+  L ++ LPLFGF  Y  +   T C ++I  ++    ++   + I G+ +P  +GIM
Sbjct:   86 KWIFGDSVCQFNGFVNILFAMSSLFTLTAISVEKYFANVKPLYKVVTRRRAQLMVVSAWLGSLVFASLPLFGFTRYKYKKDMTQCGVQI-PVTPGQMIHAILVFICGYTVP--LGIM 199          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Nematostella
Match: EDO29612 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T351])

HSP 1 Score: 56.6102 bits (135), Expect = 7.358e-9
Identity = 32/117 (27.35%), Postives = 62/117 (52.99%), Query Frame = 3
Query:  681 RWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYST----RKIQLPWNVNQILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIM 1019
            +W+FGD +CQF  F   +F +S++  +  I++E+Y++      K+        ++   W+  L ++ LPLFGF  Y  +   T C ++I  ++    ++   + I G+ +P  +GIM
Sbjct:   60 KWIFGDSVCQFNGFVNILFAMSSLFTLTAISVEKYFAIVKPLYKVVTRRRAQLMVVSAWLGSLVFASLPLFGFTRYKYKKDMTQCGVQI-PVTPGQMIHAILVFICGYTVP--LGIM 173          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Nematostella
Match: NVOP5 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI24])

HSP 1 Score: 56.9954 bits (136), Expect = 1.219e-8
Identity = 59/228 (25.88%), Postives = 102/228 (44.74%), Query Frame = 3
Query:  630 LGVVLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYSTRKIQLPWN-------VNQILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKI-----FDLSHNHQLYMGGLII-VGFLLPVSIGIMFHLFTLSLETRKTEKINSFEKIMNNV--SRKLFLM---DLFSWCGYLVLCLIGLVSNQDSPWAILFSSVSPLLTKFGIALLPMLY 1259
            L   +G  LA  +   G W +    C+ +AF  + FG+ ++  + ++A E+Y +  K    W         + I+   W+  LF+++ PLFG+ +Y LE    +C+IK       D+S+   +Y+GG  I +G +L     I      +++    +  +N    I  NV  + KL L+    L SW  Y V+  + ++  + S  A+   S   L  K      P LY
Sbjct:   85 LSCAVGIPLAIHASIAGTWPYCLEGCKAHAFFIYTFGLVSLVHLAIMAFEKYLTIFKHMSKWGNFLSKRGASLIVVGLWVYCLFFTVPPLFGWAAYGLENGNLTCSIKFDSRHPVDISYYVVMYIGGFFIPLGLILYSYYHINKVKHRVAVRKYASNDVNRVAHIRRNVKYAVKLALLIGGYLLSWAPYSVITFLIVLQVELSDQAVYVPS---LFAKTSFMYNPFLY 309          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Nematostella
Match: EDO42547 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S169])

HSP 1 Score: 56.6102 bits (135), Expect = 1.273e-8
Identity = 31/102 (30.39%), Postives = 59/102 (57.84%), Query Frame = 3
Query:  666 SRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYY---STRKIQLPWNVNQILYV----CWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSH 950
            S + GRW+F  F+C   +F  F FG ++I  + VIA+ RY+      K +  +   ++++V     W+VG+ ++  PL+G+G Y   +  ++C++ I+DL+ 
Sbjct:   78 SLYHGRWIFPQFVCDLDSFTMFAFGSASILTMAVIALNRYFKVVKANKYKRLFGSRKVVWVYCAATWLVGMMFATPPLYGWGLYEYHIQFSTCSL-IWDLNR 178          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Medaka
Match: rgra (RPE-retinal G protein-coupled receptor [Source:NCBI gene;Acc:101157001])

HSP 1 Score: 83.1889 bits (204), Expect = 3.198e-17
Identity = 68/223 (30.49%), Postives = 108/223 (48.43%), Query Frame = 3
Query:  624 SSLGVVLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERY--YSTRKIQLPWNVNQILYV-CWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSI---GIMFHLFTLSLETRKTEKINSFEKIMN---NVSRKLFLMDLFSWCGYLVLCLIGLVSNQD--SPWAILFSSVSPLLTKFGIALLPMLY 1259
            + +G+ + A +AA S F+  W +G   CQ + F GF+  +++I+ I  IA +RY  Y TR  +L W+    L V  WI   FW+ +PL G+G Y  E  +T CT+ I     N+         V +++P+SI   GI   +   S ++   +    F+K  N   N S  L  + LF W  Y +L     V++ +  SP       ++P+L K      P+LY
Sbjct:   61 ADIGISMNATIAAFSSFLRYWPYGSEGCQTHGFHGFLTALASIHFIAAIAWDRYHQYCTRT-KLQWSTAITLAVLVWIFTAFWAAMPLIGWGEYDYEPLRTCCTLDISKGDRNY---------VSYVIPMSIFNMGIQVFVVMSSYQSIAQK----FQKTGNPRFNASTPLKTL-LFCWGPYGILAFYAAVADANLVSP---KIRMIAPILAKTSPTFNPLLY 265          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Medaka
Match: rgra (RPE-retinal G protein-coupled receptor [Source:NCBI gene;Acc:101157001])

HSP 1 Score: 82.4185 bits (202), Expect = 5.830e-17
Identity = 68/223 (30.49%), Postives = 108/223 (48.43%), Query Frame = 3
Query:  624 SSLGVVLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERY--YSTRKIQLPWNVNQILYV-CWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSI---GIMFHLFTLSLETRKTEKINSFEKIMN---NVSRKLFLMDLFSWCGYLVLCLIGLVSNQD--SPWAILFSSVSPLLTKFGIALLPMLY 1259
            + +G+ + A +AA S F+  W +G   CQ + F GF+  +++I+ I  IA +RY  Y TR  +L W+    L V  WI   FW+ +PL G+G Y  E  +T CT+ I     N+         V +++P+SI   GI   +   S ++   +    F+K  N   N S  L  + LF W  Y +L     V++ +  SP       ++P+L K      P+LY
Sbjct:   61 ADIGISMNATIAAFSSFLRYWPYGSEGCQTHGFHGFLTALASIHFIAAIAWDRYHQYCTRT-KLQWSTAITLAVLVWIFTAFWAAMPLIGWGEYDYEPLRTCCTLDISKGDRNY---------VSYVIPMSIFNMGIQVFVVMSSYQSIAQK----FQKTGNPRFNASTPLKTL-LFCWGPYGILAFYAAVADANLVSP---KIRMIAPILAKTSPTFNPLLY 265          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Medaka
Match: rrh (retinal pigment epithelium-derived rhodopsin homolog [Source:NCBI gene;Acc:101160531])

HSP 1 Score: 77.7962 bits (190), Expect = 3.296e-15
Identity = 59/235 (25.11%), Postives = 111/235 (47.23%), Query Frame = 3
Query:  612 HFIYSSLGVV-LGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYSTRKIQLPWNV-----NQILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHL-FTLSLETRKTEKINSFEKI---------MNNVSRKLFLMDLFSWCGYLVLCL---IGLVSNQDSPWAILFSSVSPLLTKFGIALLPMLY 1259
            +  ++ +GV  +G  ++A S   G W FG   CQ YA     FG+++I ++ V+A++RY +  +  L   +     N ++   W+  +FWS +P+ G+  YA +    +CTI       +   Y   +I V F++P++  +MF+  + +S   ++ +  N  + I         +  +S  + +M L +W  Y ++CL    G      +P AI    ++PL  K      P +Y
Sbjct:   58 NLAFTDVGVAGIGYPMSAASDIHGSWKFGYTGCQIYAALNIFFGMASIGLLTVVAIDRYLTICRPDLGQKMTMQSYNLLILAAWLNAVFWSSMPIVGWAGYAPDPTGATCTINWRQNDASFVSYTMAVIAVNFVVPLT--VMFYCYYNVSATVKRYKASNCLDSINIDWSDQMDVTKMSIVMIVMFLVAWSPYSMVCLWASFGDPKTIPAPMAI----IAPLFAKSSTFYNPCIY 286          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Medaka
Match: opn5 (opsin-5 [Source:NCBI gene;Acc:101157504])

HSP 1 Score: 74.7146 bits (182), Expect = 4.196e-14
Identity = 59/215 (27.44%), Postives = 106/215 (49.30%), Query Frame = 3
Query:  666 SRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYSTRKIQL-PWNVNQILYVC----WIVGLFWSLLPLFGFGSYALELHQTSCTIK--IFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLFTLSLETRKTEKINSFE-KIMNNVSRKLFLMD---------LFSWCGYLVLCLIGLVSNQDSPWAILFSSVSPLLTKFGIALLPMLY 1259
            S F  RWLFG   C+FY + GF FG  ++  + V++++RY     ++   W   Q +++C    WI   FW+ +PL G+GSYA E   TSCT+   +   S + Q ++  ++    +LP  I +  ++  +      +++++SF+ +I N+ + ++ L           L +W  Y V+ ++      DS   I  S +  LL K      P++Y
Sbjct:   91 SSFSHRWLFGWEGCRFYGWAGFFFGCGSLITMTVVSLDRYLKICHLRYGTWLKRQHIFLCLVFVWIYAAFWATMPLVGWGSYAPEPFGTSCTLDWWLAQASVSGQSFVMSILFFCLVLPAGIIVFSYVMIICKVKSSSKEVSSFDARIKNSHTLEIKLTKVAMLICAGFLIAWIPYAVVSVVSAFGEPDSI-PIPVSVIPTLLAKSSAMYNPIIY 304          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Medaka
Match: opn5 (opsin-5 [Source:NCBI gene;Acc:101157504])

HSP 1 Score: 74.7146 bits (182), Expect = 4.362e-14
Identity = 59/215 (27.44%), Postives = 106/215 (49.30%), Query Frame = 3
Query:  666 SRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYSTRKIQL-PWNVNQILYVC----WIVGLFWSLLPLFGFGSYALELHQTSCTIK--IFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLFTLSLETRKTEKINSFE-KIMNNVSRKLFLMD---------LFSWCGYLVLCLIGLVSNQDSPWAILFSSVSPLLTKFGIALLPMLY 1259
            S F  RWLFG   C+FY + GF FG  ++  + V++++RY     ++   W   Q +++C    WI   FW+ +PL G+GSYA E   TSCT+   +   S + Q ++  ++    +LP  I +  ++  +      +++++SF+ +I N+ + ++ L           L +W  Y V+ ++      DS   I  S +  LL K      P++Y
Sbjct:   93 SSFSHRWLFGWEGCRFYGWAGFFFGCGSLITMTVVSLDRYLKICHLRYGTWLKRQHIFLCLVFVWIYAAFWATMPLVGWGSYAPEPFGTSCTLDWWLAQASVSGQSFVMSILFFCLVLPAGIIVFSYVMIICKVKSSSKEVSSFDARIKNSHTLEIKLTKVAMLICAGFLIAWIPYAVVSVVSAFGEPDSI-PIPVSVIPTLLAKSSAMYNPIIY 306          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Planmine SMEST
Match: SMESG000045023.1 (SMESG000045023.1)

HSP 1 Score: 491.5 bits (1264), Expect = 1.344e-172
Identity = 276/310 (89.03%), Postives = 276/310 (89.03%), Query Frame = 3
Query:  342 MFLLIEPCVI*FSNYFNTSVVVICNCFANKKVVL*FSFKLTLFILNFTF*DQXXXXXXXXXXXXXAKLYYDLRNTLQNNQINEDCRKIHRHFIYSSLGVVLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYSTRKIQLPWNVNQILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLFTLSLETRKTEKINSFEKIMNNVSRKLFLMDLFSWCGYLVLCLIGLVSNQDSPWAILFSSVSPLLTKFGIALLPMLYWSVK 1271
            MFLLIEP              VICNCFANKK                   DQLYGILLGISGILGAKLYYDLRNTLQNNQINEDCRKIHRHFIYSSLGVVLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYSTRKIQLPWNVN ILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLFTLSLETRKTEKINSFEKIMNNVSRKLFLMDLFSWCGYLVLCLIGLVSNQDSPWAILFSSVSPLLTKFGIALLPMLYWSVK
Sbjct:    1 MFLLIEP-------------FVICNCFANKK-------------------DQLYGILLGISGILGAKLYYDLRNTLQNNQINEDCRKIHRHFIYSSLGVVLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYSTRKIQLPWNVNHILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLFTLSLETRKTEKINSFEKIMNNVSRKLFLMDLFSWCGYLVLCLIGLVSNQDSPWAILFSSVSPLLTKFGIALLPMLYWSVK 278          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Planmine SMEST
Match: SMESG000074489.1 (SMESG000074489.1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.462e-15
Identity = 63/239 (26.36%), Postives = 110/239 (46.03%), Query Frame = 3
Query:  627 SLGVVLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYY-------STRKIQLPWNVNQILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLFTLSLETRKTE--------KIN-SFEKIMNNVSRK-----------LFLMDLFSWCGYLVLCLIGLVSNQD--SPW----AILFSSVSPLLTKFGIAL 1244
            +   V G  L   S F  RW +G   C+ Y F G +FG  +IN + +I+++RY+       + + + +   +  +++V W+  L WS  P FG+G+Y  E  QTSCT      S  + ++  G+ I  F++PV I I+F  + +    R  E        K+N S    M   ++K           +  + + SW  Y ++ L+ L   +D  +P+     +LF+  S +   F  A+
Sbjct:  102 TFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFV-WLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFIIPVGI-IIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAI 338          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Planmine SMEST
Match: SMESG000025307.1 (SMESG000025307.1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.661e-10
Identity = 56/221 (25.34%), Postives = 100/221 (45.25%), Query Frame = 3
Query:  666 SRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERY----YSTRKIQLPWNVNQILYV--CWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLFTLSLETRK---------TEKINSFEKIM-NNVSRKLFLMD-------LFSWCGYLVLCLIGLVSNQDSPWAILFSSVSPLLTKFGIALLPMLY 1259
            S F   W+F    C  YAF   + G+ +I I+ VIA+ER+    Y  + ++       I +V  CW +G+  S+ PL G+  Y LE  Q SC+  +FD S   + Y+  ++++G  L +   I+     +  + R          T+  N+ ++I  + V RKL  M        + SW  Y ++ ++ L +      ++L  ++     K      P++Y
Sbjct:   75 SSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYI--MLLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIY 293          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Planmine SMEST
Match: SMESG000025307.1 (SMESG000025307.1)

HSP 1 Score: 63.1586 bits (152), Expect = 2.046e-10
Identity = 56/221 (25.34%), Postives = 100/221 (45.25%), Query Frame = 3
Query:  666 SRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERY----YSTRKIQLPWNVNQILYV--CWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLFTLSLETRK---------TEKINSFEKIM-NNVSRKLFLMD-------LFSWCGYLVLCLIGLVSNQDSPWAILFSSVSPLLTKFGIALLPMLY 1259
            S F   W+F    C  YAF   + G+ +I I+ VIA+ER+    Y  + ++       I +V  CW +G+  S+ PL G+  Y LE  Q SC+  +FD S   + Y+  ++++G  L +   I+     +  + R          T+  N+ ++I  + V RKL  M        + SW  Y ++ ++ L +      ++L  ++     K      P++Y
Sbjct:   80 SSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYI--MLLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIY 298          
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Planmine SMEST
Match: SMESG000025308.1 (SMESG000025308.1)

HSP 1 Score: 55.8398 bits (133), Expect = 3.025e-8
Identity = 46/163 (28.22%), Postives = 81/163 (49.69%), Query Frame = 3
Query:  639 VLGAILAAPSRFVGRWLFGDFLCQFYAFEGFVFGISNINIIVVIAMERYYS-TRKIQLPWNVNQ-----ILYVCWIVGLFWSLLPLFGFGSYALELHQTSCTIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLFTLSLETRKTEKINSFEKIMNNVSRKL 1109
            +LG      S F   W+F +  C  YAF   V G+ +I I+ ++A+ER    +R +++   V++     ++ + W   +F S+ PL G+  Y LE    SC+  +FD S   + Y+  + ++G  L V + I+F    L L   K ++  +  ++M   SR L
Sbjct:   21 ILGFPFLTISGFCKEWIFSEAGCSAYAFSMSVTGMHSIFILTILAVERLKVISRPLKMVKIVSKKRSFLLVLISWTFAIFVSIPPLLGWNRYVLEGLHISCSYDMFDGSWRSKSYI--VFLIGIFLVVLLIIIFCYLALFL---KVQRQATSMRVMIKDSRDL 178          
The following BLAST results are available for this feature:
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RGR6.737e-1629.19retinal G protein coupled receptor [Source:HGNC Sy... [more]
RRH1.375e-1528.13retinal pigment epithelium-derived rhodopsin homol... [more]
RGR2.667e-1532.03retinal G protein coupled receptor [Source:HGNC Sy... [more]
RGR4.298e-1532.03retinal G protein coupled receptor [Source:HGNC Sy... [more]
RGR5.266e-1532.03retinal G protein coupled receptor [Source:HGNC Sy... [more]
back to top
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ninaE2.737e-925.81gene:FBgn0002940 transcript:FBtr0083857[more]
Rh61.398e-824.62gene:FBgn0019940 transcript:FBtr0347603[more]
Rh25.703e-823.66gene:FBgn0003248 transcript:FBtr0083697[more]
back to top
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rrh1.467e-1525.53retinal pigment epithelium-derived rhodopsin homol... [more]
rgra1.635e-1531.51retinal G protein coupled receptor a [Source:ZFIN;... [more]
opn4a2.450e-1328.44opsin 4a (melanopsin) [Source:NCBI gene;Acc:571624... [more]
opn4a2.532e-1328.44opsin 4a (melanopsin) [Source:NCBI gene;Acc:571624... [more]
opn4xb2.811e-1328.15opsin 4xb [Source:NCBI gene;Acc:563080][more]
back to top
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hes5.15.115e-1630.48hes family bHLH transcription factor 5 [Source:Xen... [more]
ENSXETT00000008004.12.895e-1329.91opsin 5, gene 2 [Source:NCBI gene;Acc:100493595][more]
camk2d1.960e-1225.76calcium/calmodulin dependent protein kinase (CaM k... [more]
ENSXETT00000039733.17.473e-1023.72melanopsin-B-like [Source:NCBI gene;Acc:100485437][more]
OPN51.017e-924.45opsin 5 [Source:NCBI gene;Acc:100497642][more]
back to top
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rrh8.931e-1626.96retinal pigment epithelium derived rhodopsin homol... [more]
Rrh8.931e-1626.96retinal pigment epithelium derived rhodopsin homol... [more]
Opn51.801e-1225.00opsin 5 [Source:MGI Symbol;Acc:MGI:2662912][more]
Rgr8.242e-1233.08retinal G protein coupled receptor [Source:MGI Sym... [more]
Rgr8.786e-1233.08retinal G protein coupled receptor [Source:MGI Sym... [more]
back to top
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P23820|REIS_TODPA1.023e-2130.84Retinochrome OS=Todarodes pacificus OX=6637 PE=1 S... [more]
sp|P47804|RGR_HUMAN3.235e-1529.19RPE-retinal G protein-coupled receptor OS=Homo sap... [more]
sp|O35214|OPSX_MOUSE6.247e-1526.96Visual pigment-like receptor peropsin OS=Mus muscu... [more]
sp|O14718|OPSX_HUMAN6.601e-1528.13Visual pigment-like receptor peropsin OS=Homo sapi... [more]
sp|O15973|OPSD1_MIZYE1.393e-1427.89Rhodopsin, GQ-coupled OS=Mizuhopecten yessoensis O... [more]
back to top
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2CMU93.692e-2532.91Opsin-5 isoform 2 OS=Schistosoma japonicum OX=6182... [more]
A0A0L8HQC07.120e-2229.17G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
W5XRX91.301e-2127.39Peropsin (Fragment) OS=Platynereis dumerilii OX=63... [more]
A0A4E0RMI51.945e-2129.22G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A5K4FAE32.971e-2128.93Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rrh2.899e-1725.96retinal pigment epithelium-derived rhodopsin homol... [more]
rgra9.461e-1529.09RPE-retinal G protein-coupled receptor-like [Sourc... [more]
opn4xb4.717e-1330.41opsin 4xb [Source:NCBI gene;Acc:563080][more]
opn4a1.434e-1228.44opsin 4 [Source:NCBI gene;Acc:103023553][more]
opn4b2.331e-1226.73opsin 4b [Source:ZFIN;Acc:ZDB-GENE-080415-3][more]
back to top
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
opn4a1.551e-1025.11opsin 4a (melanopsin) [Source:NCBI gene;Acc:571624... [more]
opn31.647e-723.58opsin 3 [Source:ZFIN;Acc:ZDB-GENE-080227-16][more]
parapinopsina9.386e-627.42parapinopsin a [Source:ZFIN;Acc:ZDB-GENE-101129-1][more]
back to top
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
NVOP423.732e-1023.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329035.088e-927.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO296127.358e-927.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NVOP51.219e-825.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425471.273e-830.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgra3.198e-1730.49RPE-retinal G protein-coupled receptor [Source:NCB... [more]
rgra5.830e-1730.49RPE-retinal G protein-coupled receptor [Source:NCB... [more]
rrh3.296e-1525.11retinal pigment epithelium-derived rhodopsin homol... [more]
opn54.196e-1427.44opsin-5 [Source:NCBI gene;Acc:101157504][more]
opn54.362e-1427.44opsin-5 [Source:NCBI gene;Acc:101157504][more]
back to top
BLAST of Retinal pigment epithelium-derived rhodopsin homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045023.11.344e-17289.03SMESG000045023.1[more]
SMESG000074489.12.462e-1526.36SMESG000074489.1[more]
SMESG000025307.11.661e-1025.34SMESG000025307.1[more]
SMESG000025307.12.046e-1025.34SMESG000025307.1[more]
SMESG000025308.13.025e-828.22SMESG000025308.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001792 ID=SMED30001792|Name=Retinal pigment epithelium-derived rhodopsin homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1839bp
ATCGATCACCTCCTCCTAGTCGAGTTGGTTATTAATTAGTTATTTTTTTT
AATCAATTTTAATAATAATAATAATTTAATTATTTATTTATTACTTTAAT
TTTAATATTATTTATTGAAAATCATTAAAAATTTATTTTTTAAAGTACTA
TATATATACTTACTTTTGTCATTAATTATCTTATTATTCTCGAATTCCAT
TGTTTCTTTTGCATTCATCTTCGTTTAATTTACGTTATTAAGTATTCAAA
ATTAATTCACGAGAATAACAACTTTATTAGAATCATCAAACTGTGATAAC
TTTGAAGTAATTGTTGAATTTGTGCTTAATCACATCTTGAAATGTTTCTG
TTAATTGAACCGTGTGTGATTTAATTTAGTAATTACTTCAATACTTCAGT
AGTTGTAATTTGTAATTGCTTTGCTAATAAGAAGGTTGTGCTCTAATTTT
CATTTAAATTAACTTTATTCATTTTAAATTTCACATTTTAGGATCAACTT
TACGGAATTCTATTAGGAATTTCAGGAATTTTGGGTGCAAAACTCTACTA
TGATTTACGTAATACCTTGCAAAACAACCAGATCAACGAAGATTGCCGGA
AAATTCACCGACATTTCATCTATTCCAGCTTAGGAGTTGTCCTCGGTGCA
ATCCTTGCTGCCCCTTCTCGATTCGTTGGAAGATGGCTTTTCGGAGATTT
CTTGTGCCAATTTTATGCCTTTGAAGGCTTTGTTTTTGGTATTTCTAATA
TTAATATTATCGTTGTTATTGCCATGGAACGATACTATTCTACAAGAAAG
ATTCAATTACCTTGGAATGTTAATCAGATTCTTTATGTTTGCTGGATAGT
GGGACTTTTTTGGTCATTACTGCCATTATTTGGATTTGGCAGCTATGCGT
TGGAACTCCATCAAACGTCTTGCACGATAAAGATATTTGACTTGTCACAT
AATCATCAATTGTATATGGGAGGTCTCATTATTGTCGGATTTTTATTGCC
GGTTTCTATTGGTATAATGTTTCATTTGTTTACACTGAGTCTAGAGACTA
GAAAAACGGAGAAAATTAATTCGTTTGAAAAAATAATGAATAACGTTTCA
CGTAAACTTTTTTTGATGGATCTATTTTCATGGTGTGGATATTTGGTGTT
GTGTTTGATTGGATTGGTTTCCAATCAAGATTCTCCCTGGGCGATATTGT
TTTCCTCCGTGTCACCTTTACTTACAAAATTTGGAATCGCACTTTTACCA
ATGTTATATTGGTCTGTGAAATAATGAAAATTCGTTGAATTTTCAATTTG
CGCACAAATTTATGATTACTGCATCTCATTGAATTAATTAATAATATAAT
TCAGTATTTAATTTAGATTTTTTCGTAATGTTTTTCATTGGTCATGGAGA
TGGTTAAATATATCTGGAATTTACCAGACCTCTGAACCTGATCGTGGTTC
ACTAATTTTATATGTGAATAGTGTTTAATTCATCGAATTTAAATTTTACA
ATATCATTTAATTTTAATCGTCAGTATGATGTTTATTACAATCTTCGACT
TTGCATGTTATTTATTCCATTTAGTTTTCTTTGATTATACAACAAATATT
ATTTGGTCTCTAATCTCCGTTAACTATTTTTTAAAATTTCATCTCAGTTT
TTATCTTTTCAACACAAATAAATAATATAAAATTTAGAATTTACGAGAGA
TGTACTTTTGTATTTATTACGGTTATACAAAAACATGTAAAAATCAATAT
TTTTTCTGAGGAAAAGCAGAGTCATGTAATAAATCGAAAGATAACGAACA
GTGTGTACAACTAAATCTAGAAACCCAACAATATAAAAT
back to top

protein sequence of SMED30001792-orf-1

>SMED30001792-orf-1 ID=SMED30001792-orf-1|Name=SMED30001792-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=167bp
MERYYSTRKIQLPWNVNQILYVCWIVGLFWSLLPLFGFGSYALELHQTSC
TIKIFDLSHNHQLYMGGLIIVGFLLPVSIGIMFHLFTLSLETRKTEKINS
FEKIMNNVSRKLFLMDLFSWCGYLVLCLIGLVSNQDSPWAILFSSVSPLL
TKFGIALLPMLYWSVK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0009584detection of visible light
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
GO:0007601visual perception
GO:0018298protein-chromophore linkage
GO:0050896response to stimulus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
GO:0009881photoreceptor activity
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM