Phosphoglucomutase

Overview
NamePhosphoglucomutase
Smed IDSMED30001788
Length (bp)1948
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphoglucomutase (SMED30001788) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphoglucomutase (SMED30001788) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphoglucomutase (SMED30001788) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphoglucomutase (SMED30001788) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001788

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30001788h1SMcG0016081 dd_Smed_v4_4058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30001788h1SMcG0016081 dd_Smed_v4_4058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001788h1SMcG0016081 dd_Smed_v4_4058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001788h1SMcG0016081 dd_Smed_v4_4058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001788h1SMcG0016081 Contig38039uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001788h1SMcG0016081 Contig38039newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30001788h1SMcG0016081 dd_Smed_v4_4058_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphoglucomutase vs. Ensembl Human
Match: PGM2 (phosphoglucomutase 2 [Source:HGNC Symbol;Acc:HGNC:8906])

HSP 1 Score: 513.457 bits (1321), Expect = 3.728e-175
Identity = 281/597 (47.07%), Postives = 383/597 (64.15%), Query Frame = 2
Query:   95 DNRVQIEYEKWMKLDKNEKTRFEMQQL--QFNPEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKKY--DFK-KGIIVGYDARYN------SEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSW--KWDDIRKYVKDPLEELEKAYYER-QFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERF-KGSWKIISGNEFGALLGWWIWSTNKIKSENNDQF---VMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQ 1822
            D R+  E  +W++ DKN  T   +++L  + N EEL+     R++FGTAGLRA MG G + MNDL IIQTTQG     +K   D K KGI++ +DAR +      S ++A++ A  F + GIPVYLFS+I PTPF+ F V+  +   G+MITASHNPK DNGYK+YW+NG QII+P DK I+  I  NL P   +W     D    + +P   +   Y+E  +  C  R++N E K  F  V+T +HGVG  + +     F       VP+Q  PDPEFPTV +PNPEE KG L L+   A+     ++ ANDPDADRLAVAE+   G W++ SGNE GALLGWW++++ K K+++        M+SSTVSSKIL++IA KE F F ETLTGFKW+GN+A ++  +GKTVLFAFEEAIGYMC   +LDKDG+SA  I AE+++ L     +L++QL  IY EYG H+    Y      E  K++FE LRN++G + +YP+ CG  KF+I  IRDLTTGY   + + K  LP+  +++MITFTF+N    T+R SGTEPKIKYY+E+     +     E LK EL+EL++ +++HF+Q
Sbjct:   12 DARLDQETAQWLRWDKNSLTLEAVKRLIAEGNKEELRKCFGARMEFGTAGLRAAMGPGISRMNDLTIIQTTQGFCRYLEKQFSDLKQKGIVISFDARAHPSSGGSSRRFARLAATTFISQGIPVYLFSDITPTPFVPFTVSHLKLCAGIMITASHNPKQDNGYKVYWDNGAQIISPHDKGISQAIEENLEPWPQAWDDSLIDSSPLLHNPSASINNDYFEDLKKYCFHRSVNRETKVKF--VHTSVHGVGHSFVQSAFKAFDLVPPEAVPEQKDPDPEFPTVKYPNPEEGKGVLTLSFALADKTKARIVLANDPDADRLAVAEKQDSGEWRVFSGNELGALLGWWLFTSWKEKNQDRSALKDTYMLSSTVSSKILRAIALKEGFHFEETLTGFKWMGNRAKQLIDQGKTVLFAFEEAIGYMCCPFVLDKDGVSAAVISAELASFLATKNLSLSQQLKAIYVEYGYHITKASYFICHDQETIKKLFENLRNYDGKN-NYPKACG--KFEISAIRDLTTGYDDSQPDKKAVLPTSKSSQMITFTFANGGVATMRTSGTEPKIKYYAELCAPPGNSDP--EQLKKELNELVSAIEEHFFQ 601          
BLAST of Phosphoglucomutase vs. Ensembl Human
Match: PGM2L1 (phosphoglucomutase 2 like 1 [Source:HGNC Symbol;Acc:HGNC:20898])

HSP 1 Score: 483.026 bits (1242), Expect = 3.838e-163
Identity = 263/597 (44.05%), Postives = 372/597 (62.31%), Query Frame = 2
Query:   95 DNRVQIEYEKWMKLDKNEKTRFEMQQLQFNP--EELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKK--YDFK-KGIIVGYDAR------YNSEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWD--DIRKYVKDPLEELEKAYYER-QFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAE-RFKGSWKIISGNEFGALLGWWI---WSTNKIKSENNDQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQ 1822
            D ++     +W++ DKN KT+ +++ L  N   +EL+ RL  R+ FGTAGLR+ MGAGF ++NDL +IQ+TQG+    ++   DFK +G +VGYD R       +S++ AK+ A +     +PVYLFS  VPTPF+ + V   + + GVMITASHN K+DNGYK+YWE G QI +P DKEI   I   + P   SW  +  D     +DPL+++ + Y E  +  C  R +N   K   + V+T  HGVG +Y +     FGF   + VP+Q  PDP+F TV  PNPEE +  L L++  A   N  ++ A DPDADRLA AE +  G WK+ +GNE  AL GWW+   W  NK ++ +     M+++TVSSKILK+IA KE F F ETL GFKWIG++  ++   GK VLFAFEE+IG++C  ++LDKDG+SA  + AEM++ L     TL +QL K+YE+YG H++   Y         K +FE+LRN++ S + YP+FCG   F I+ +RD+TTGY S + N K  LP    ++MITFTF N C  T+R SGTEPKIKYY+E+  + +    ++  L+ EL +LI  + ++F Q
Sbjct:   22 DPQLDTAIGQWLRWDKNPKTKEQIENLLRNGMNKELRDRLCCRMTFGTAGLRSAMGAGFCYINDLTVIQSTQGMYKYLERCFSDFKQRGFVVGYDTRGQVTSSCSSQRLAKLTAAVLLAKDVPVYLFSRYVPTPFVPYAVQKLKAVAGVMITASHNRKEDNGYKVYWETGAQITSPHDKEILKCIEECVEPWNGSWNDNLVDTSPLKRDPLQDICRRYMEDLKKICFYRELN--SKTTLKFVHTSFHGVGHDYVQLAFKVFGFKPPIPVPEQKDPDPDFSTVKCPNPEEGESVLELSLRLAEKENARVVLATDPDADRLAAAELQENGCWKVFTGNELAALFGWWMFDCWKKNKSRNADVKNVYMLATTVSSKILKAIALKEGFHFEETLPGFKWIGSRIIDLLENGKEVLFAFEESIGFLCGTSVLDKDGVSAAVVVAEMASYLETMNITLKQQLVKVYEKYGYHISKTSYFLCYEPPTIKSIFERLRNFD-SPKEYPKFCG--TFAILHVRDVTTGYDSSQPNKKSVLPVSKNSQMITFTFQNGCVATLRTSGTEPKIKYYAEMCASPDQSDTAL--LEEELKKLIDALIENFLQ 611          
BLAST of Phosphoglucomutase vs. Ensembl Human
Match: PGM2 (phosphoglucomutase 2 [Source:HGNC Symbol;Acc:HGNC:8906])

HSP 1 Score: 107.457 bits (267), Expect = 4.520e-26
Identity = 62/136 (45.59%), Postives = 86/136 (63.24%), Query Frame = 2
Query:   95 DNRVQIEYEKWMKLDKNEKTRFEMQQL--QFNPEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKK--YDFK-KGIIVGYDARY------NSEKWAKIVANIFHNAGIPVYLFSNIVPTPFL 469
            D R+  E  +W++ DKN  T   +++L  + N EEL+     R++FGTAGLRA MG G + MNDL IIQTTQG     +K   D K KGI++ +DAR       +S ++A++ A  F + GIPVYLFS+I PTPF+
Sbjct:   12 DARLDQETAQWLRWDKNSLTLEAVKRLIAEGNKEELRKCFGARMEFGTAGLRAAMGPGISRMNDLTIIQTTQGFCRYLEKQFSDLKQKGIVISFDARAHPSSGGSSRRFARLAATTFISQGIPVYLFSDITPTPFV 147          
BLAST of Phosphoglucomutase vs. Ensembl Human
Match: PGM2 (phosphoglucomutase 2 [Source:HGNC Symbol;Acc:HGNC:8906])

HSP 1 Score: 107.457 bits (267), Expect = 4.520e-26
Identity = 62/136 (45.59%), Postives = 86/136 (63.24%), Query Frame = 2
Query:   95 DNRVQIEYEKWMKLDKNEKTRFEMQQL--QFNPEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKK--YDFK-KGIIVGYDARY------NSEKWAKIVANIFHNAGIPVYLFSNIVPTPFL 469
            D R+  E  +W++ DKN  T   +++L  + N EEL+     R++FGTAGLRA MG G + MNDL IIQTTQG     +K   D K KGI++ +DAR       +S ++A++ A  F + GIPVYLFS+I PTPF+
Sbjct:   12 DARLDQETAQWLRWDKNSLTLEAVKRLIAEGNKEELRKCFGARMEFGTAGLRAAMGPGISRMNDLTIIQTTQGFCRYLEKQFSDLKQKGIVISFDARAHPSSGGSSRRFARLAATTFISQGIPVYLFSDITPTPFV 147          
BLAST of Phosphoglucomutase vs. Ensembl Human
Match: PGM2 (phosphoglucomutase 2 [Source:HGNC Symbol;Acc:HGNC:8906])

HSP 1 Score: 107.457 bits (267), Expect = 4.520e-26
Identity = 62/136 (45.59%), Postives = 86/136 (63.24%), Query Frame = 2
Query:   95 DNRVQIEYEKWMKLDKNEKTRFEMQQL--QFNPEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKK--YDFK-KGIIVGYDARY------NSEKWAKIVANIFHNAGIPVYLFSNIVPTPFL 469
            D R+  E  +W++ DKN  T   +++L  + N EEL+     R++FGTAGLRA MG G + MNDL IIQTTQG     +K   D K KGI++ +DAR       +S ++A++ A  F + GIPVYLFS+I PTPF+
Sbjct:   12 DARLDQETAQWLRWDKNSLTLEAVKRLIAEGNKEELRKCFGARMEFGTAGLRAAMGPGISRMNDLTIIQTTQGFCRYLEKQFSDLKQKGIVISFDARAHPSSGGSSRRFARLAATTFISQGIPVYLFSDITPTPFV 147          
BLAST of Phosphoglucomutase vs. Ensembl Celegans
Match: Y43F4B.5 (pep chromosome:WBcel235:III:13299378:13302760:1 gene:WBGene00012803.1 transcript:Y43F4B.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y43F4B.5)

HSP 1 Score: 429.483 bits (1103), Expect = 4.321e-143
Identity = 242/592 (40.88%), Postives = 357/592 (60.30%), Query Frame = 2
Query:  125 WMKLDKNEKTRFEMQQL--QFNPEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKKY--DFKKGIIVGYDARYNSEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWDDIRK--------YVKDPLEELEKAYYERQFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGF--NKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERFK-GSWKIISGNEFGALLGWWIWSTNKIKSENND--QFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQKDIFGF 1840
            W+  DKN+K R E+Q+L  + N + LK R+  R+ FGTAG+R+ M AGF  +NDL IIQ T G            K G+ +G+D RYNS ++A++ AN+F    IPVYLFS + PTP +++         G++ITASHNPK+DNGYK YW NG QII P D EI         P +  W   +++          V DP  E+EK+         +R IN       +  Y+  HG+G+ Y KRM  +FGF  +  + V +Q  P+P+FPT+PFPNPEE +  L LA+ETA+ +  ++I ANDPDADR+ +AE+ K G W++ +GNE GAL+ WWIW+  +  + N D  +  +++S VSS+I+K+IA+ E F+   TLTGFKW+GN+A+E++  G  V+ A+EE+IGYM   + +DKDG+SA A+FAE++A L+A G +L +QL  +Y  YG H+  + Y    + E+TK++F  LR    +   +P   G+   ++  +RDLT GY + + ++K  LP   ++EM+TF        T+RASGTEPKIKYY E++         +E + SE+D+L  +V     +   FG 
Sbjct:   15 WLAWDKNDKNRNEIQKLVDEKNVDALKARMDTRLVFGTAGVRSPMQAGFGRLNDLTIIQITHGFARHMLNVYGQPKNGVAIGFDGRYNSRRFAELSANVFVRNNIPVYLFSEVSPTPVVSWATIKLGCDAGLIITASHNPKEDNGYKAYWSNGAQIIGPHDTEIVRIKEAEPQPRDEYWDLSELKSSPLFHSADVVIDPYFEVEKSL------NFTREIN--GSTPLKFTYSAFHGIGYHYTKRMFAEFGFPASSFISVAEQQDPNPDFPTIPFPNPEEGRKVLTLAMETADKNGSTVILANDPDADRIQMAEKQKDGEWRVFTGNEMGALITWWIWTNWRKANPNADASKVYILNSAVSSQIVKTIADAEGFKNETTLTGFKWMGNRAEELRADGNQVILAWEESIGYMPG-HTMDKDGVSAAAVFAEIAAFLHAEGKSLQDQLYALYNRYGFHLVRSTYWMVPAPEVTKKLFSTLR----ADLKFPTKIGEA--EVASVRDLTIGYDNSKPDNKPVLPLSTSSEMVTFFLKTGSVTTLRASGTEPKIKYYIELITAPGKTQNDLESVISEMDQLEKDVVATLLRPQQFGL 591          
BLAST of Phosphoglucomutase vs. Ensembl Celegans
Match: Y43F4B.5 (pep chromosome:WBcel235:III:13299378:13302750:1 gene:WBGene00012803.1 transcript:Y43F4B.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y43F4B.5)

HSP 1 Score: 244.202 bits (622), Expect = 1.519e-73
Identity = 133/316 (42.09%), Postives = 186/316 (58.86%), Query Frame = 2
Query:  125 WMKLDKNEKTRFEMQQL--QFNPEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKKY--DFKKGIIVGYDARYNSEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWDDIRK--------YVKDPLEELEKAYYERQFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGF--NKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERFK 1027
            W+  DKN+K R E+Q+L  + N + LK R+  R+ FGTAG+R+ M AGF  +NDL IIQ T G            K G+ +G+D RYNS ++A++ AN+F    IPVYLFS + PTP +++         G++ITASHNPK+DNGYK YW NG QII P D EI         P +  W   +++          V DP  E+EK+         +R IN       +  Y+  HG+G+ Y KRM  +FGF  +  + V +Q  P+P+FPT+PFPNPEE +  L LA+ETA+ +  ++I ANDPDADR+ +AE+ K
Sbjct:   15 WLAWDKNDKNRNEIQKLVDEKNVDALKARMDTRLVFGTAGVRSPMQAGFGRLNDLTIIQITHGFARHMLNVYGQPKNGVAIGFDGRYNSRRFAELSANVFVRNNIPVYLFSEVSPTPVVSWATIKLGCDAGLIITASHNPKEDNGYKAYWSNGAQIIGPHDTEIVRIKEAEPQPRDEYWDLSELKSSPLFHSADVVIDPYFEVEKSL------NFTREINGSTP--LKFTYSAFHGIGYHYTKRMFAEFGFPASSFISVAEQQDPNPDFPTIPFPNPEEGRKVLTLAMETADKNGSTVILANDPDADRIQMAEKQK 322          
BLAST of Phosphoglucomutase vs. Ensembl Fly
Match: Pgm2a (gene:FBgn0033377 transcript:FBtr0088630)

HSP 1 Score: 484.182 bits (1245), Expect = 6.029e-164
Identity = 268/607 (44.15%), Postives = 380/607 (62.60%), Query Frame = 2
Query:   71 FKYIVMEIDNRVQIEYEKWMKLDKNEKTRFEMQQL--QFNPEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKKY-----DFK-KGIIVGYDARYNSEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWDD----IRKYVKDPLEELEKAYYE---RQFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAE-RFKGSWKIISGNEFGALLGWWIWSTNKIKSENND--QFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGC-TLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWN-GSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQ 1822
             K + +  D  +  E  KW++ DK   T  ++       + + L+ RL  RI FGTAGLRA M AGF  MN+L++IQT QGL    K+      D+  +GI+ GYD RYNS ++A++ A +F N    V+LF   V TP + F +   Q L GVM+TASHNPK+DNGYK+YW NG QII P D+ I + I+ NL P  +S  WDD        ++DP + +   Y++   +Q  C S   N     +F   YT MHGVG+ + K+   +      + V +Q +PDPEFPT P PNPEE K +L L+I+TA A++  +I ANDPDADRLAVAE R  GS+K+ SGNE GALLGWW    +K++  + D    VMI+STVSSKIL+++AE+E FQF+ETLTGFKW+GNKA E++  GKTVLFAFEEAIG+M    +LDKDG+SA    A M+  L    C TL E+L  IYE YG H   + Y+  +   + +++FE+LR W+ G + +YP    + +++I  +RDLTTG+ S   + K  LP+  +++MITFTF N   +T+R SGTEPK+KYY+E+    ++K+ +   L + ++ ++  + + FY+
Sbjct:   12 IKNMALSGDPELDGEIRKWIRWDKCASTACQIMDAVRAKDWDTLRKRLCTRISFGTAGLRACMRAGFDSMNELVVIQTAQGLCEYIKEQYPDPADWSGRGIVFGYDGRYNSHRFAELSAIVFLNNDFKVWLFKRYVATPMVPFAILRLQCLAGVMVTASHNPKEDNGYKVYWTNGAQIIPPHDEGIQESILNNLEPKGSS--WDDSAMCSNTMLEDPYDIVVPPYFDILKKQLPCTSLEANGRCSLSF--TYTAMHGVGYAFVKQAFARINLKPFISVCEQQEPDPEFPTTPMPNPEEGKTSLDLSIKTAKANSSQIILANDPDADRLAVAEVREDGSYKLFSGNEVGALLGWWSLELHKMREPDCDVSNCVMIASTVSSKILRAMAEREGFQFFETLTGFKWMGNKAIELQQAGKTVLFAFEEAIGFMVGTTVLDKDGVSAAGHLATMACYLRCKLCMTLQEKLRDIYETYGFHTTVSSYVICRCPPVIEQIFERLRTWDEGKADTYPTSILNGEYEIENVRDLTTGFDSSTGDKKATLPTSSSSQMITFTFKNGLVVTLRTSGTEPKMKYYAEMCGKPDEKNWA--KLTNTMNTMVEAIVEEFYE 612          
BLAST of Phosphoglucomutase vs. Ensembl Fly
Match: Pgm2b (gene:FBgn0033969 transcript:FBtr0087464)

HSP 1 Score: 405.601 bits (1041), Expect = 3.157e-133
Identity = 231/616 (37.50%), Postives = 359/616 (58.28%), Query Frame = 2
Query:   68 FFKYIVMEIDNRVQIEYEKWMKLDKNEKTRFEMQQLQFNPE--ELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLA-------TCKKYDFKKGIIVGYDARYNSEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWDDIRKY--VKDPLEELEKAYYERQFNCLSRNINLEMK--NNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAE-RFKGSWKIISGNEFGALLGWWIWSTNKIKSENN--DQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYAN-GCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQKDIFGFTE*KT 1855
              K + +  +  + ++ + W+  D+NE T  ++ +   + +   L++RL  RI + T GLR  M AGF  +ND++II+  QG+ A       + +K    +G++VGYD RYNS+++A+++A +F N    V+LF+ ++PTPF+ F V   Q L G+++TASHN K+DNG K+YW NG Q +AP D+ I D +M NL P  +SW+   +  +  V+DP  ++   +YE     L   I LE    +  R +YT +HGVG+ + +    +     ++ V +Q + DPEFPT+  PNPEE K AL LAI+ A+A + +L+ ANDPD DRLAVAE   +G WK+ +GNE GALLGWW     K ++        +MI++ VSS+IL ++A  E F F E +  F W+ ++A E++  G+TVLFAFEE  GYM   ++ DKDGI A    A M+  L +    TL E+L +IY+ YG H + +    + S E    +F+ LRN+    + YP+F  DE+F+++ IRDLT G  +   + K  +P     ++ITFTF+N   +T+R++  + KIK  +EI     +K    E L  +L+ +   V + F Q +  G T+  T
Sbjct:   16 LLKTLELSGEEDLDLQIKNWVMWDRNEATLQQVTEAVRDQDWKALRVRLCHRITYLTTGLRGVMRAGFDSLNDVVIIEVAQGICAYLVDAYPSIQKRQ-TQGVVVGYDGRYNSKRFAQLIATVFLNNDFKVFLFTRMIPTPFIPFTVVTLQCLAGIVVTASHNVKEDNGIKVYWSNGAQAMAPHDQRIHDYMMNNLEPKPSSWETSLVLDHPLVEDPYRQIYPLFYE-ALKTLIPPIYLETNECSQLRFIYTALHGVGYPFMREAFYQARLKPVIPVVEQKEADPEFPTLVKPNPEEGKEALKLAIKKADAEHCTLVLANDPDVDRLAVAELDPRGRWKLFNGNELGALLGWWALENYKTRTPKPAVTNCIMIATLVSSRILAAMARVEGFIFVEGMPSFPWMAHRALELEKSGRTVLFAFEECFGYMFGMSLPDKDGIGAAMQLASMACYLRSTRNVTLIEKLREIYDTYGYHSSISSVYMADSPETITSVFDHLRNFT-DEEGYPKFILDEEFEVVHIRDLTIGLDTSFSDGKARMPVTPDAQLITFTFTNGYVVTLRSAPNDIKIKLNAEICGLPEEK--QWEELHDKLNRMTNAVVEEFLQPEENGLTDAST 626          
BLAST of Phosphoglucomutase vs. Ensembl Zebrafish
Match: pgm2 (phosphoglucomutase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2218])

HSP 1 Score: 510.375 bits (1313), Expect = 3.846e-174
Identity = 277/605 (45.79%), Postives = 384/605 (63.47%), Query Frame = 2
Query:   95 DNRVQIEYEKWMKLDKNEKTRFEMQQLQFNP--EELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKK--YDFK-KGIIVGYDARYN------SEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWDDIRK--YVKDPLEELEKAYYER-QFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERFK-GSWKIISGNEFGALLGWWI---WSTNKIKSENNDQFV-MISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQKDIFGFT 1843
            D+R+     +W++ DKN KT   ++ +  +    EL+     R++FGTAGLRA MG G + MNDL IIQTTQG  A  ++   D K +G+++G+DAR +      S+++A + A +  + G+PV+LFS+I PTP++ F V+      G+M+TASHNPK DNGYK+YW NG QII P DK IA  I  NL P   SW  D+  +   + DP +++ + Y +  Q +C  R +N       ++V+T +HGVG  + +     F       V +Q  PDPEFPTV +PNPEE +G L L+   A+    S+I ANDPDADRLA+AE+ + G W++ SGNE GALLGWWI   W   K++ + + + V M+SSTVSSKIL++IA KE F F ETLTGFKW+GN+A E+  +GKTVLFAFEEAIGYMC+  +LDKDG+SA AI  E  + L +   TL+ QL  IYEEYG H+  N Y    + +  K++FE+LRN+ G   SYP+ CG   F I  +RDLTTGY S + N+K  LP+  +++MITF+F+N    T+R SGTEPKIKYY+E+     +    +  L  ELD L+  + +HFYQ +  G T
Sbjct:   10 DSRLDQAVTQWLQYDKNPKTAAAVRSMVKDGALSELQKCFGARMEFGTAGLRAAMGPGVSCMNDLTIIQTTQGFCAYLEECFVDLKQRGVVIGFDARAHPPSGGSSKRFACLAACVLMSRGVPVHLFSDITPTPYVPFAVSHLGLCAGIMVTASHNPKQDNGYKVYWANGAQIIPPHDKGIAAAIEQNLEPWPESWDTDEGLRSSLLNDPYQDIHREYCQTIQQHCFHRELN--RNTAVKIVHTSVHGVGHIFVQAAFKAFDLQPPYAVEEQKDPDPEFPTVKYPNPEEGEGVLTLSFALADKEGASVILANDPDADRLAIAEKQESGKWRVFSGNELGALLGWWIFQCWKQQKVEGKGSIKDVYMLSSTVSSKILRAIAVKEGFHFEETLTGFKWMGNRARELMDQGKTVLFAFEEAIGYMCSPAVLDKDGVSAAAIAGEFISYLASKNITLSHQLRSIYEEYGYHITKNSYFICHNQDTIKKLFERLRNY-GVDNSYPKECGG--FAISAVRDLTTGYDSNQPNNKAVLPTSKSSQMITFSFANGGVATMRTSGTEPKIKYYTELCAAPGNS--DLNQLTKELDNLVDAIVEHFYQPEKNGLT 607          
BLAST of Phosphoglucomutase vs. Ensembl Zebrafish
Match: pgm2l1 (phosphoglucomutase 2-like 1 [Source:ZFIN;Acc:ZDB-GENE-041008-205])

HSP 1 Score: 473.011 bits (1216), Expect = 1.980e-159
Identity = 260/589 (44.14%), Postives = 353/589 (59.93%), Query Frame = 2
Query:  122 KWMKLDKNEKTRFEMQQL--QFNPEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGL---LATCKKYDFKKGIIVGYDARY------NSEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWDDIRKYV--KDPLEELEKAYYERQFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERFKG-SWKIISGNEFGALLGWWI---WSTNKIKSENNDQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQKD 1828
            +WM  DKN  TR +++ L  +    EL+ RL  R+ FGTAGLRA MGAGFA +NDL IIQ+TQGL   LA C      +G++VGYD R        SE+ AK+ A +     +PVYLFS  VPTPF+ + V       GVMITASHN K+DNGYK+YW NG QI +P DKEI   I  +  P   SW  D +   +  +DPLE++   Y E + N L  +  L  K+  + V++  HGVG  Y +R   +FGF   + VP+Q  PDP+F TV  PNPEE +  L L++  A      ++ A DPDADRLAVAE+     WK+ +GNE  ALLGWW+   W        + ++  M+++TVSSKIL++ A  E F F ETL GFKWIGN+  E+K  GK V+F+FEE+IG++C   +LDKDG+S  A+ AEM++ L+    +L +QL  IYE YG H++   Y+         R+F +LRN+ G    YP  CGD  + I  IRD+TTGY S + + K  LP   +++M+TFTF N    T+R SGTEPKIKYY+E   +  +  R I  L  EL ++ A + + F + D
Sbjct:   28 QWMTWDKNPLTREQIESLVQEGRVVELRRRLCSRMTFGTAGLRAAMGAGFARINDLTIIQSTQGLYKYLAKCFPDLKTRGLVVGYDTRAQASSGCTSERLAKLTAAVMLCKDVPVYLFSTYVPTPFVPYAVMKYGAAAGVMITASHNRKEDNGYKVYWHNGAQIASPHDKEILHCIEESAEPWAESWNEDLVENSLLKRDPLEDVCHWYME-ELNTLCFHRELNAKSPLKFVHSSFHGVGHNYVQRAFQQFGFPPPIPVPEQKDPDPDFSTVSCPNPEEGESVLELSLRLAEREKARIVVATDPDADRLAVAEQNDNCGWKVFTGNELAALLGWWMLFNWKEAHPDPADTERVYMLATTVSSKILEAFARIEGFHFEETLPGFKWIGNRIHELKKAGKEVIFSFEESIGFLCGNMVLDKDGVSTAAVVAEMASYLHTKNLSLNQQLCNIYEIYGYHISRTSYVLCNDPPTIHRIFSRLRNFGGQG-VYPTSCGD--YCITHIRDVTTGYDSSQPDKKCVLPLSKSSQMLTFTFQNGIVATLRTSGTEPKIKYYTEFCASPGE--RDISSLDEELRKVAAALVEEFLEPD 610          
BLAST of Phosphoglucomutase vs. Ensembl Zebrafish
Match: pgm2l1 (phosphoglucomutase 2-like 1 [Source:ZFIN;Acc:ZDB-GENE-041008-205])

HSP 1 Score: 394.815 bits (1013), Expect = 1.452e-130
Identity = 212/491 (43.18%), Postives = 293/491 (59.67%), Query Frame = 2
Query:  383 KWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWDDIRKYV--KDPLEELEKAYYERQFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERFKG-SWKIISGNEFGALLGWWI---WSTNKIKSENNDQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQKD 1828
            + AK+ A +     +PVYLFS  VPTPF+ + V       GVMITASHN K+DNGYK+YW NG QI +P DKEI   I  +  P   SW  D +   +  +DPLE++   Y E + N L  +  L  K+  + V++  HGVG  Y +R   +FGF   + VP+Q  PDP+F TV  PNPEE +  L L++  A      ++ A DPDADRLAVAE+     WK+ +GNE  ALLGWW+   W        + ++  M+++TVSSKIL++ A  E F F ETL GFKWIGN+  E+K  GK V+F+FEE+IG++C   +LDKDG+S  A+ AEM++ L+    +L +QL  IYE YG H++   Y+         R+F +LRN+ G    YP  CGD  + I  IRD+TTGY S + + K  LP   +++M+TFTF N    T+R SGTEPKIKYY+E   +  +  R I  L  EL ++ A + + F + D
Sbjct:   17 RLAKLTAAVMLCKDVPVYLFSTYVPTPFVPYAVMKYGAAAGVMITASHNRKEDNGYKVYWHNGAQIASPHDKEILHCIEESAEPWAESWNEDLVENSLLKRDPLEDVCHWYME-ELNTLCFHRELNAKSPLKFVHSSFHGVGHNYVQRAFQQFGFPPPIPVPEQKDPDPDFSTVSCPNPEEGESVLELSLRLAEREKARIVVATDPDADRLAVAEQNDNCGWKVFTGNELAALLGWWMLFNWKEAHPDPADTERVYMLATTVSSKILEAFARIEGFHFEETLPGFKWIGNRIHELKKAGKEVIFSFEESIGFLCGNMVLDKDGVSTAAVVAEMASYLHTKNLSLNQQLCNIYEIYGYHISRTSYVLCNDPPTIHRIFSRLRNFGGQG-VYPTSCGD--YCITHIRDVTTGYDSSQPDKKCVLPLSKSSQMLTFTFQNGIVATLRTSGTEPKIKYYTEFCASPGE--RDISSLDEELRKVAAALVEEFLEPD 501          
BLAST of Phosphoglucomutase vs. Ensembl Zebrafish
Match: pgm1 (phosphoglucomutase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1245])

HSP 1 Score: 54.6842 bits (130), Expect = 2.671e-7
Identity = 96/405 (23.70%), Postives = 171/405 (42.22%), Query Frame = 2
Query:  221 KFGTAGLRARMGAGFAFMNDLIIIQT-TQGLLATCKKYDFKKG-IIVGYDARYNSEKWAKIVANIFHNAGIPVYLFS--NIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNG---YKLYWENGCQIIAPLDKEIADDIM--------LNLVPD---------ENSWKWDDIRKYVKDPLEELEKAYYERQ---FNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRM----LNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEEKGALGLAIETANAHNISLIAANDPDADRLAVAERFKGSWKIISGNEFGALLGWWIWSTNKIKSENNDQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISAL 1342
            K GT+GLR R+     F  +    +   Q +++T      ++G ++VG D R+  +   +++  I    GI   +     I+ TP ++  +   + + G+++TASHNP   NG    K    +G     P  + I D I          ++ P+         + +++ D  + +  + ++ +E +Y E     F+  +    L   N+  +    MHGV   Y K++    L     + + CVP +     +F     P+P    A  L + T         AA D D DR  V  +       ++ ++  A++G  I S    +        +  S  +S  L ++A+  K   YET TG+K+ GN  D     GK  L   EE+ G   + +I +KDG+ A+
Sbjct:   16 KPGTSGLRKRV---TVFQQNQHYAENFIQSIISTVDPAQRQEGALVVGGDGRFFMKDAIQLIIQIAAANGIGRLVIGQDGIMSTPAVSCVIRKIKAIGGIILTASHNPGGPNGDFGIKFNISSG----GPAPEGITDKIFQISKSLQEYHICPELKVDLSTIGKQTFEVDTFKPFTVEIVDSVE-SYAEMLRDIFDFAALKELLSGPNHINVRLDAMHGVVGPYVKKIVCEELGSPANSAVNCVPSE-----DFGG-HHPDPNLTYAADL-VNTMKGGEYDFGAAFDGDGDRNMVLGK---HGFFVNPSDSVAVIGANITSIPYFQKTGVKG--LARSMPTSGALDNVAKALKMPLYETPTGWKFFGNLMD----AGKLSLCG-EESFGTGSD-HIREKDGLWAV 394          
BLAST of Phosphoglucomutase vs. Ensembl Xenopus
Match: actn3 (actinin alpha 3 (gene/pseudogene) [Source:Xenbase;Acc:XB-GENE-920242])

HSP 1 Score: 502.286 bits (1292), Expect = 7.234e-171
Identity = 276/599 (46.08%), Postives = 383/599 (63.94%), Query Frame = 2
Query:   95 DNRVQIEYEKWMKLDKNEKTRFEMQQLQFN--PEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKKY--DFK-KGIIVGYDARYN------SEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWD--DIRKYVKDPLEELEKAYYER-QFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERFK-GSWKIISGNEFGALLGWWIWSTNKIKSENND---QFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQKD 1828
            D R+      W+  DKN KT   ++Q+  +   E+L+     R++FGTAGLRA MG G + MNDL IIQTTQG     +K   D K +G+++GYDAR +      S+++A++ A  F + GI VY+FS+I PTPF+ + VT  +   G+M+TASHNPK DNGYK+YWENG QII P D  IA  I  NL P   +W     D    ++DP + + K Y++  Q +C  R+IN   K  F  V+T +HGVG ++ +     F F+  + V +Q  PDPEF TV +PNPEE KG L L+   A      +I ANDPDADRLAVAE+ + G WK+ SGNE GALLGWWI++  K K+++ +      M++STVSSKIL++IA KE F F ETLTGFKW+GN+A ++  +GKTVLFAFEEAIGYMC   +LDKDG+SA  I AE+++ L     TLT+QL  I+ +YG H++ N Y      +    +FE LRN+NG  ++YP+ CG  K  +  +RDLTTGY S + ++K  LP+  +++MITFTF+N    T+R SGTEPKIKYY+E+     +     + LK ELD+L   ++++F+Q +
Sbjct:   10 DARLDKAVTDWLTWDKNPKTLELVKQMVADGKKEDLQACFGSRMEFGTAGLRAAMGPGISQMNDLTIIQTTQGFCRYLEKNINDLKERGVVIGYDARAHPASGGSSKRFARLAATTFVSQGIKVYMFSDITPTPFVPYAVTHLKLCAGIMVTASHNPKQDNGYKVYWENGAQIIPPHDSGIAQSIEENLEPWPTAWDDTVIDDSSLLQDPYQSINKDYFKDIQKHCFHRDINKASKVKF--VHTSVHGVGHKFVQSAFKAFDFSPPLPVEEQKDPDPEFTTVKYPNPEEGKGVLKLSFALAEKEGARIILANDPDADRLAVAEKQESGEWKVFSGNELGALLGWWIFTCWKEKNQDPEAVKNVYMLASTVSSKILRAIAVKEGFHFEETLTGFKWMGNRAKQLIDQGKTVLFAFEEAIGYMCCPFVLDKDGVSAAVIAAELASYLATKNVTLTQQLNSIFNKYGYHISQNSYFICYDQKTIHDLFEHLRNYNG-EKAYPKLCG--KIDVSSVRDLTTGYDSNQPDNKAILPTSKSSQMITFTFANGGVATMRTSGTEPKIKYYAELCAAPGNS--DFDMLKKELDDLADAIEEYFFQPE 601          
BLAST of Phosphoglucomutase vs. Ensembl Xenopus
Match: actn3 (actinin alpha 3 (gene/pseudogene) [Source:Xenbase;Acc:XB-GENE-920242])

HSP 1 Score: 495.352 bits (1274), Expect = 2.514e-168
Identity = 272/584 (46.58%), Postives = 377/584 (64.55%), Query Frame = 2
Query:  140 KNEKTRFEMQQLQFN--PEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKKY--DFK-KGIIVGYDARYN------SEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWD--DIRKYVKDPLEELEKAYYER-QFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERFK-GSWKIISGNEFGALLGWWIWSTNKIKSENND---QFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQKD 1828
            KN KT   ++Q+  +   E+L+     R++FGTAGLRA MG G + MNDL IIQTTQG     +K   D K +G+++GYDAR +      S+++A++ A  F + GI VY+FS+I PTPF+ + VT  +   G+M+TASHNPK DNGYK+YWENG QII P D  IA  I  NL P   +W     D    ++DP + + K Y++  Q +C  R+IN   K  F  V+T +HGVG ++ +     F F+  + V +Q  PDPEF TV +PNPEE KG L L+   A      +I ANDPDADRLAVAE+ + G WK+ SGNE GALLGWWI++  K K+++ +      M++STVSSKIL++IA KE F F ETLTGFKW+GN+A ++  +GKTVLFAFEEAIGYMC   +LDKDG+SA  I AE+++ L     TLT+QL  I+ +YG H++ N Y      +    +FE LRN+NG  ++YP+ CG  K  +  +RDLTTGY S + ++K  LP+  +++MITFTF+N    T+R SGTEPKIKYY+E+     +     + LK ELD+L   ++++F+Q +
Sbjct:   10 KNPKTLELVKQMVADGKKEDLQACFGSRMEFGTAGLRAAMGPGISQMNDLTIIQTTQGFCRYLEKNINDLKERGVVIGYDARAHPASGGSSKRFARLAATTFVSQGIKVYMFSDITPTPFVPYAVTHLKLCAGIMVTASHNPKQDNGYKVYWENGAQIIPPHDSGIAQSIEENLEPWPTAWDDTVIDDSSLLQDPYQSINKDYFKDIQKHCFHRDINKASKVKF--VHTSVHGVGHKFVQSAFKAFDFSPPLPVEEQKDPDPEFTTVKYPNPEEGKGVLKLSFALAEKEGARIILANDPDADRLAVAEKQESGEWKVFSGNELGALLGWWIFTCWKEKNQDPEAVKNVYMLASTVSSKILRAIAVKEGFHFEETLTGFKWMGNRAKQLIDQGKTVLFAFEEAIGYMCCPFVLDKDGVSAAVIAAELASYLATKNVTLTQQLNSIFNKYGYHISQNSYFICYDQKTIHDLFEHLRNYNG-EKAYPKLCG--KIDVSSVRDLTTGYDSNQPDNKAILPTSKSSQMITFTFANGGVATMRTSGTEPKIKYYAELCAAPGNS--DFDMLKKELDDLADAIEEYFFQPE 586          
BLAST of Phosphoglucomutase vs. Ensembl Xenopus
Match: actn3 (actinin alpha 3 (gene/pseudogene) [Source:Xenbase;Acc:XB-GENE-920242])

HSP 1 Score: 494.582 bits (1272), Expect = 6.313e-168
Identity = 272/584 (46.58%), Postives = 377/584 (64.55%), Query Frame = 2
Query:  140 KNEKTRFEMQQLQFN--PEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKKY--DFK-KGIIVGYDARYN------SEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWD--DIRKYVKDPLEELEKAYYER-QFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERFK-GSWKIISGNEFGALLGWWIWSTNKIKSENND---QFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQKD 1828
            KN KT   ++Q+  +   E+L+     R++FGTAGLRA MG G + MNDL IIQTTQG     +K   D K +G+++GYDAR +      S+++A++ A  F + GI VY+FS+I PTPF+ + VT  +   G+M+TASHNPK DNGYK+YWENG QII P D  IA  I  NL P   +W     D    ++DP + + K Y++  Q +C  R+IN   K  F  V+T +HGVG ++ +     F F+  + V +Q  PDPEF TV +PNPEE KG L L+   A      +I ANDPDADRLAVAE+ + G WK+ SGNE GALLGWWI++  K K+++ +      M++STVSSKIL++IA KE F F ETLTGFKW+GN+A ++  +GKTVLFAFEEAIGYMC   +LDKDG+SA  I AE+++ L     TLT+QL  I+ +YG H++ N Y      +    +FE LRN+NG  ++YP+ CG  K  +  +RDLTTGY S + ++K  LP+  +++MITFTF+N    T+R SGTEPKIKYY+E+     +     + LK ELD+L   ++++F+Q +
Sbjct:   17 KNPKTLELVKQMVADGKKEDLQACFGSRMEFGTAGLRAAMGPGISQMNDLTIIQTTQGFCRYLEKNINDLKERGVVIGYDARAHPASGGSSKRFARLAATTFVSQGIKVYMFSDITPTPFVPYAVTHLKLCAGIMVTASHNPKQDNGYKVYWENGAQIIPPHDSGIAQSIEENLEPWPTAWDDTVIDDSSLLQDPYQSINKDYFKDIQKHCFHRDINKASKVKF--VHTSVHGVGHKFVQSAFKAFDFSPPLPVEEQKDPDPEFTTVKYPNPEEGKGVLKLSFALAEKEGARIILANDPDADRLAVAEKQESGEWKVFSGNELGALLGWWIFTCWKEKNQDPEAVKNVYMLASTVSSKILRAIAVKEGFHFEETLTGFKWMGNRAKQLIDQGKTVLFAFEEAIGYMCCPFVLDKDGVSAAVIAAELASYLATKNVTLTQQLNSIFNKYGYHISQNSYFICYDQKTIHDLFEHLRNYNG-EKAYPKLCG--KIDVSSVRDLTTGYDSNQPDNKAILPTSKSSQMITFTFANGGVATMRTSGTEPKIKYYAELCAAPGNS--DFDMLKKELDDLADAIEEYFFQPE 593          
BLAST of Phosphoglucomutase vs. Ensembl Xenopus
Match: actn3 (actinin alpha 3 (gene/pseudogene) [Source:Xenbase;Acc:XB-GENE-920242])

HSP 1 Score: 494.967 bits (1273), Expect = 7.569e-168
Identity = 272/584 (46.58%), Postives = 377/584 (64.55%), Query Frame = 2
Query:  140 KNEKTRFEMQQLQFN--PEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKKY--DFK-KGIIVGYDARYN------SEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWD--DIRKYVKDPLEELEKAYYER-QFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERFK-GSWKIISGNEFGALLGWWIWSTNKIKSENND---QFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQKD 1828
            KN KT   ++Q+  +   E+L+     R++FGTAGLRA MG G + MNDL IIQTTQG     +K   D K +G+++GYDAR +      S+++A++ A  F + GI VY+FS+I PTPF+ + VT  +   G+M+TASHNPK DNGYK+YWENG QII P D  IA  I  NL P   +W     D    ++DP + + K Y++  Q +C  R+IN   K  F  V+T +HGVG ++ +     F F+  + V +Q  PDPEF TV +PNPEE KG L L+   A      +I ANDPDADRLAVAE+ + G WK+ SGNE GALLGWWI++  K K+++ +      M++STVSSKIL++IA KE F F ETLTGFKW+GN+A ++  +GKTVLFAFEEAIGYMC   +LDKDG+SA  I AE+++ L     TLT+QL  I+ +YG H++ N Y      +    +FE LRN+NG  ++YP+ CG  K  +  +RDLTTGY S + ++K  LP+  +++MITFTF+N    T+R SGTEPKIKYY+E+     +     + LK ELD+L   ++++F+Q +
Sbjct:   33 KNPKTLELVKQMVADGKKEDLQACFGSRMEFGTAGLRAAMGPGISQMNDLTIIQTTQGFCRYLEKNINDLKERGVVIGYDARAHPASGGSSKRFARLAATTFVSQGIKVYMFSDITPTPFVPYAVTHLKLCAGIMVTASHNPKQDNGYKVYWENGAQIIPPHDSGIAQSIEENLEPWPTAWDDTVIDDSSLLQDPYQSINKDYFKDIQKHCFHRDINKASKVKF--VHTSVHGVGHKFVQSAFKAFDFSPPLPVEEQKDPDPEFTTVKYPNPEEGKGVLKLSFALAEKEGARIILANDPDADRLAVAEKQESGEWKVFSGNELGALLGWWIFTCWKEKNQDPEAVKNVYMLASTVSSKILRAIAVKEGFHFEETLTGFKWMGNRAKQLIDQGKTVLFAFEEAIGYMCCPFVLDKDGVSAAVIAAELASYLATKNVTLTQQLNSIFNKYGYHISQNSYFICYDQKTIHDLFEHLRNYNG-EKAYPKLCG--KIDVSSVRDLTTGYDSNQPDNKAILPTSKSSQMITFTFANGGVATMRTSGTEPKIKYYAELCAAPGNS--DFDMLKKELDDLADAIEEYFFQPE 609          
BLAST of Phosphoglucomutase vs. Ensembl Xenopus
Match: actn3 (actinin alpha 3 (gene/pseudogene) [Source:Xenbase;Acc:XB-GENE-920242])

HSP 1 Score: 494.197 bits (1271), Expect = 9.836e-168
Identity = 267/566 (47.17%), Postives = 368/566 (65.02%), Query Frame = 2
Query:  188 EELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKKY--DFK-KGIIVGYDARYN------SEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWD--DIRKYVKDPLEELEKAYYER-QFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERFK-GSWKIISGNEFGALLGWWIWSTNKIKSENND---QFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQKD 1828
            E+L+     R++FGTAGLRA MG G + MNDL IIQTTQG     +K   D K +G+++GYDAR +      S+++A++ A  F + GI VY+FS+I PTPF+ + VT  +   G+M+TASHNPK DNGYK+YWENG QII P D  IA  I  NL P   +W     D    ++DP + + K Y++  Q +C  R+IN   K  F  V+T +HGVG ++ +     F F+  + V +Q  PDPEF TV +PNPEE KG L L+   A      +I ANDPDADRLAVAE+ + G WK+ SGNE GALLGWWI++  K K+++ +      M++STVSSKIL++IA KE F F ETLTGFKW+GN+A ++  +GKTVLFAFEEAIGYMC   +LDKDG+SA  I AE+++ L     TLT+QL  I+ +YG H++ N Y      +    +FE LRN+NG  ++YP+ CG  K  +  +RDLTTGY S + ++K  LP+  +++MITFTF+N    T+R SGTEPKIKYY+E+     +     + LK ELD+L   ++++F+Q +
Sbjct:   41 EDLQACFGSRMEFGTAGLRAAMGPGISQMNDLTIIQTTQGFCRYLEKNINDLKERGVVIGYDARAHPASGGSSKRFARLAATTFVSQGIKVYMFSDITPTPFVPYAVTHLKLCAGIMVTASHNPKQDNGYKVYWENGAQIIPPHDSGIAQSIEENLEPWPTAWDDTVIDDSSLLQDPYQSINKDYFKDIQKHCFHRDINKASKVKF--VHTSVHGVGHKFVQSAFKAFDFSPPLPVEEQKDPDPEFTTVKYPNPEEGKGVLKLSFALAEKEGARIILANDPDADRLAVAEKQESGEWKVFSGNELGALLGWWIFTCWKEKNQDPEAVKNVYMLASTVSSKILRAIAVKEGFHFEETLTGFKWMGNRAKQLIDQGKTVLFAFEEAIGYMCCPFVLDKDGVSAAVIAAELASYLATKNVTLTQQLNSIFNKYGYHISQNSYFICYDQKTIHDLFEHLRNYNG-EKAYPKLCG--KIDVSSVRDLTTGYDSNQPDNKAILPTSKSSQMITFTFANGGVATMRTSGTEPKIKYYAELCAAPGNS--DFDMLKKELDDLADAIEEYFFQPE 599          
BLAST of Phosphoglucomutase vs. Ensembl Mouse
Match: Pgm2 (phosphoglucomutase 2 [Source:MGI Symbol;Acc:MGI:97564])

HSP 1 Score: 509.22 bits (1310), Expect = 1.413e-173
Identity = 277/600 (46.17%), Postives = 381/600 (63.50%), Query Frame = 2
Query:   86 MEIDNRVQIEYEKWMKLDKNEKTRFEMQQL--QFNPEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKKY--DFK-KGIIVGYDARYN------SEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWD--DIRKYVKDPLEELEKAYYER-QFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERF-KGSWKIISGNEFGALLGWWIWSTNKIKSENNDQF---VMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQ 1822
            + +D R+  E  +W++ D+N  T   ++QL    N EEL+     R++FGTAGLRA MGAG + MNDL IIQTTQG     +K   D K +G+++ +DAR +      S ++A++ A  F   G+PVYLFS+I PTPF+ + V+  +   G+MITASHNPK DNGYK+YW+NG QII+P D+ I+  I  NL P   +W+    D    + +P   +   Y+E  +  C  R +N E K  F  V+T +HGVG E+ +     F       VPQQ  PDPEFPTV +PNPEE KG L L+   A+     ++ ANDPDADRLAVAE+   G W++ SGNE GALLGWW++++ K K+++        M+SSTVSSKIL++IA KE F F ETLTGFKW+GN+A ++  +GKTVLFAFEEAIGYMC   +LDKDG+SA  I AE+++ L     +L++QL  IY EYG H+    Y         + +F  LRN++G + +YP+ CG  KF+I  IRDLTTGY   + + K  LP+  +++MITFTF+N    T+R SGTEPKIKYY+E+     +     E LK ELDEL+  +++HF+Q
Sbjct:   17 LGMDARLDQETAQWLRWDQNPLTSESVKQLIAGGNKEELRKCFGARMEFGTAGLRAPMGAGISRMNDLTIIQTTQGFCRYLEKQFSDLKQRGVVISFDARAHPASGGSSRRFARLAATAFITQGVPVYLFSDITPTPFVPYTVSHLKLCAGIMITASHNPKQDNGYKVYWDNGAQIISPHDRGISQAIEENLEPWPQAWEESLVDSSPLLHNPSASIGNDYFEDLKKYCFHRTVNKESKVKF--VHTSVHGVGHEFVQLAFKAFDLAPPEAVPQQKDPDPEFPTVKYPNPEEGKGVLTLSFALADKIKAKIVLANDPDADRLAVAEKQDSGEWRVFSGNELGALLGWWLFTSWKEKNQDQSNLKDTYMLSSTVSSKILRAIALKEGFHFEETLTGFKWMGNRAQQLGDQGKTVLFAFEEAIGYMCCPFVLDKDGVSAAVICAELASFLATKNLSLSQQLNAIYVEYGYHITTASYFICHDQGTIQNLFGNLRNYDGKN-NYPKMCG--KFEISAIRDLTTGYDDSQPDKKAVLPTSKSSQMITFTFANGGVATMRTSGTEPKIKYYAELCAPPGNSDP--EHLKKELDELVGAIEEHFFQ 609          
BLAST of Phosphoglucomutase vs. Ensembl Mouse
Match: Pgm2l1 (phosphoglucomutase 2-like 1 [Source:MGI Symbol;Acc:MGI:1918224])

HSP 1 Score: 484.182 bits (1245), Expect = 9.534e-164
Identity = 269/592 (45.44%), Postives = 371/592 (62.67%), Query Frame = 2
Query:   95 DNRVQIEYEKWMKLDKNEKTRFEMQQLQFNP--EELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKK--YDFK-KGIIVGYDAR------YNSEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWD--DIRKYVKDPLEELEKAYYER-QFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAE-RFKGSWKIISGNEFGALLGWWI---WSTNKIKSENNDQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQN--HNDKSRSIEGLKSELDELIAN 1801
            D ++     +W++ DKN KT+ +++ L  N   +EL+ RL  R+ FGTAGLR+ MGAGF ++NDL +IQ+TQG+    ++   DFK +G +VGYD R       +S++ AK+ A +     IPVYLFS  VPTPF+ + V   + + GVMITASHN K+DNGYK+YWE G QI +P DKEI   I   + P  +SW  +  D     KDPL+++ K Y E  +  C  R++N   K   + V+T  HGVG +Y +     FGF   + VP+Q  PDP+F TV  PNPEE +  L L++  A   N  ++ A DPDADRLAVAE +  G WK+ +GNE  AL GWW+   W  NK  ++  + + M+++TVSSKILK+IA KE F F ETL GFKWIG++  ++   GK VLFAFEE+IG++C  ++LDKDG+SA A+ AEM++ L     TL EQL K+YE YG H++   Y         K +FE++RN+  S + YP+FCG   F I+ +RD+TTGY S + N K  LP    ++MITFTF N C  T+R SGTEPKIKYY+E+  +   +D +   E LK  +D LI N
Sbjct:   22 DPQLDTAIGQWLRWDKNPKTKEQIENLLRNGMNKELRDRLCCRMTFGTAGLRSAMGAGFCYINDLTVIQSTQGMYKYLERCFSDFKQRGFVVGYDTRGQVTSSCSSQRLAKLTAAVLLAKDIPVYLFSRYVPTPFVPYAVQELKAVAGVMITASHNRKEDNGYKVYWETGAQITSPHDKEILKCIEECVEPWNDSWNDNLVDTSPLKKDPLQDICKKYMEDLKKICFYRDLN--SKTTLKFVHTSFHGVGHDYVQLAFQVFGFKPPIPVPEQKDPDPDFSTVKCPNPEEGESVLELSLRLAEKENARIVLATDPDADRLAVAELQENGRWKVFTGNELAALFGWWMFDCWKKNKPNADVKNVY-MLATTVSSKILKAIALKEGFHFEETLPGFKWIGSRIKDLLGNGKEVLFAFEESIGFLCGTSVLDKDGVSAAAVVAEMASFLDTRKVTLMEQLTKVYEIYGYHMSKTSYFLCYDPPTIKTIFERIRNFE-SPKEYPKFCG--AFAILHVRDITTGYDSSQPNKKSVLPVSKNSQMITFTFQNGCVATLRTSGTEPKIKYYAEMCASPGQSDTTFLEEELKKLIDALIEN 607          
BLAST of Phosphoglucomutase vs. Ensembl Mouse
Match: Pgm2l1 (phosphoglucomutase 2-like 1 [Source:MGI Symbol;Acc:MGI:1918224])

HSP 1 Score: 484.182 bits (1245), Expect = 9.534e-164
Identity = 269/592 (45.44%), Postives = 371/592 (62.67%), Query Frame = 2
Query:   95 DNRVQIEYEKWMKLDKNEKTRFEMQQLQFNP--EELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKK--YDFK-KGIIVGYDAR------YNSEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWD--DIRKYVKDPLEELEKAYYER-QFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAE-RFKGSWKIISGNEFGALLGWWI---WSTNKIKSENNDQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQN--HNDKSRSIEGLKSELDELIAN 1801
            D ++     +W++ DKN KT+ +++ L  N   +EL+ RL  R+ FGTAGLR+ MGAGF ++NDL +IQ+TQG+    ++   DFK +G +VGYD R       +S++ AK+ A +     IPVYLFS  VPTPF+ + V   + + GVMITASHN K+DNGYK+YWE G QI +P DKEI   I   + P  +SW  +  D     KDPL+++ K Y E  +  C  R++N   K   + V+T  HGVG +Y +     FGF   + VP+Q  PDP+F TV  PNPEE +  L L++  A   N  ++ A DPDADRLAVAE +  G WK+ +GNE  AL GWW+   W  NK  ++  + + M+++TVSSKILK+IA KE F F ETL GFKWIG++  ++   GK VLFAFEE+IG++C  ++LDKDG+SA A+ AEM++ L     TL EQL K+YE YG H++   Y         K +FE++RN+  S + YP+FCG   F I+ +RD+TTGY S + N K  LP    ++MITFTF N C  T+R SGTEPKIKYY+E+  +   +D +   E LK  +D LI N
Sbjct:   22 DPQLDTAIGQWLRWDKNPKTKEQIENLLRNGMNKELRDRLCCRMTFGTAGLRSAMGAGFCYINDLTVIQSTQGMYKYLERCFSDFKQRGFVVGYDTRGQVTSSCSSQRLAKLTAAVLLAKDIPVYLFSRYVPTPFVPYAVQELKAVAGVMITASHNRKEDNGYKVYWETGAQITSPHDKEILKCIEECVEPWNDSWNDNLVDTSPLKKDPLQDICKKYMEDLKKICFYRDLN--SKTTLKFVHTSFHGVGHDYVQLAFQVFGFKPPIPVPEQKDPDPDFSTVKCPNPEEGESVLELSLRLAEKENARIVLATDPDADRLAVAELQENGRWKVFTGNELAALFGWWMFDCWKKNKPNADVKNVY-MLATTVSSKILKAIALKEGFHFEETLPGFKWIGSRIKDLLGNGKEVLFAFEESIGFLCGTSVLDKDGVSAAAVVAEMASFLDTRKVTLMEQLTKVYEIYGYHMSKTSYFLCYDPPTIKTIFERIRNFE-SPKEYPKFCG--AFAILHVRDITTGYDSSQPNKKSVLPVSKNSQMITFTFQNGCVATLRTSGTEPKIKYYAEMCASPGQSDTTFLEEELKKLIDALIEN 607          
BLAST of Phosphoglucomutase vs. Ensembl Mouse
Match: Pgm2l1 (phosphoglucomutase 2-like 1 [Source:MGI Symbol;Acc:MGI:1918224])

HSP 1 Score: 174.866 bits (442), Expect = 8.554e-50
Identity = 98/220 (44.55%), Postives = 138/220 (62.73%), Query Frame = 2
Query:   95 DNRVQIEYEKWMKLDKNEKTRFEMQQLQFNP--EELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKK--YDFK-KGIIVGYDAR------YNSEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWD--DIRKYVKDPLEELEKAYYE 715
            D ++     +W++ DKN KT+ +++ L  N   +EL+ RL  R+ FGTAGLR+ MGAGF ++NDL +IQ+TQG+    ++   DFK +G +VGYD R       +S++ AK+ A +     IPVYLFS  VPTPF+ + V   + + GVMITASHN K+DNGYK+YWE G QI +P DKEI   I   + P  +SW  +  D     KDPL+++ K Y E
Sbjct:   22 DPQLDTAIGQWLRWDKNPKTKEQIENLLRNGMNKELRDRLCCRMTFGTAGLRSAMGAGFCYINDLTVIQSTQGMYKYLERCFSDFKQRGFVVGYDTRGQVTSSCSSQRLAKLTAAVLLAKDIPVYLFSRYVPTPFVPYAVQELKAVAGVMITASHNRKEDNGYKVYWETGAQITSPHDKEILKCIEECVEPWNDSWNDNLVDTSPLKKDPLQDICKKYME 241          
BLAST of Phosphoglucomutase vs. Ensembl Mouse
Match: Pgm2 (phosphoglucomutase 2 [Source:MGI Symbol;Acc:MGI:97564])

HSP 1 Score: 69.707 bits (169), Expect = 1.668e-14
Identity = 32/53 (60.38%), Postives = 40/53 (75.47%), Query Frame = 2
Query:  497 LC-GVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWK 652
            LC G+MITASHNPK DNGYK+YW+NG QII+P D+ I+  I  NL P   +W+
Sbjct:    5 LCAGIMITASHNPKQDNGYKVYWDNGAQIISPHDRGISQAIEENLEPWPQAWE 57          
BLAST of Phosphoglucomutase vs. UniProt/SwissProt
Match: sp|Q96G03|PGM2_HUMAN (Phosphoglucomutase-2 OS=Homo sapiens OX=9606 GN=PGM2 PE=1 SV=4)

HSP 1 Score: 513.457 bits (1321), Expect = 1.790e-174
Identity = 281/597 (47.07%), Postives = 383/597 (64.15%), Query Frame = 2
Query:   95 DNRVQIEYEKWMKLDKNEKTRFEMQQL--QFNPEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKKY--DFK-KGIIVGYDARYN------SEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSW--KWDDIRKYVKDPLEELEKAYYER-QFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERF-KGSWKIISGNEFGALLGWWIWSTNKIKSENNDQF---VMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQ 1822
            D R+  E  +W++ DKN  T   +++L  + N EEL+     R++FGTAGLRA MG G + MNDL IIQTTQG     +K   D K KGI++ +DAR +      S ++A++ A  F + GIPVYLFS+I PTPF+ F V+  +   G+MITASHNPK DNGYK+YW+NG QII+P DK I+  I  NL P   +W     D    + +P   +   Y+E  +  C  R++N E K  F  V+T +HGVG  + +     F       VP+Q  PDPEFPTV +PNPEE KG L L+   A+     ++ ANDPDADRLAVAE+   G W++ SGNE GALLGWW++++ K K+++        M+SSTVSSKIL++IA KE F F ETLTGFKW+GN+A ++  +GKTVLFAFEEAIGYMC   +LDKDG+SA  I AE+++ L     +L++QL  IY EYG H+    Y      E  K++FE LRN++G + +YP+ CG  KF+I  IRDLTTGY   + + K  LP+  +++MITFTF+N    T+R SGTEPKIKYY+E+     +     E LK EL+EL++ +++HF+Q
Sbjct:   12 DARLDQETAQWLRWDKNSLTLEAVKRLIAEGNKEELRKCFGARMEFGTAGLRAAMGPGISRMNDLTIIQTTQGFCRYLEKQFSDLKQKGIVISFDARAHPSSGGSSRRFARLAATTFISQGIPVYLFSDITPTPFVPFTVSHLKLCAGIMITASHNPKQDNGYKVYWDNGAQIISPHDKGISQAIEENLEPWPQAWDDSLIDSSPLLHNPSASINNDYFEDLKKYCFHRSVNRETKVKF--VHTSVHGVGHSFVQSAFKAFDLVPPEAVPEQKDPDPEFPTVKYPNPEEGKGVLTLSFALADKTKARIVLANDPDADRLAVAEKQDSGEWRVFSGNELGALLGWWLFTSWKEKNQDRSALKDTYMLSSTVSSKILRAIALKEGFHFEETLTGFKWMGNRAKQLIDQGKTVLFAFEEAIGYMCCPFVLDKDGVSAAVISAELASFLATKNLSLSQQLKAIYVEYGYHITKASYFICHDQETIKKLFENLRNYDGKN-NYPKACG--KFEISAIRDLTTGYDDSQPDKKAVLPTSKSSQMITFTFANGGVATMRTSGTEPKIKYYAELCAPPGNSDP--EQLKKELNELVSAIEEHFFQ 601          
BLAST of Phosphoglucomutase vs. UniProt/SwissProt
Match: sp|Q7TSV4|PGM2_MOUSE (Phosphoglucomutase-2 OS=Mus musculus OX=10090 GN=Pgm2 PE=1 SV=1)

HSP 1 Score: 509.22 bits (1310), Expect = 9.884e-173
Identity = 277/600 (46.17%), Postives = 381/600 (63.50%), Query Frame = 2
Query:   86 MEIDNRVQIEYEKWMKLDKNEKTRFEMQQL--QFNPEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKKY--DFK-KGIIVGYDARYN------SEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWD--DIRKYVKDPLEELEKAYYER-QFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERF-KGSWKIISGNEFGALLGWWIWSTNKIKSENNDQF---VMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQ 1822
            + +D R+  E  +W++ D+N  T   ++QL    N EEL+     R++FGTAGLRA MGAG + MNDL IIQTTQG     +K   D K +G+++ +DAR +      S ++A++ A  F   G+PVYLFS+I PTPF+ + V+  +   G+MITASHNPK DNGYK+YW+NG QII+P D+ I+  I  NL P   +W+    D    + +P   +   Y+E  +  C  R +N E K  F  V+T +HGVG E+ +     F       VPQQ  PDPEFPTV +PNPEE KG L L+   A+     ++ ANDPDADRLAVAE+   G W++ SGNE GALLGWW++++ K K+++        M+SSTVSSKIL++IA KE F F ETLTGFKW+GN+A ++  +GKTVLFAFEEAIGYMC   +LDKDG+SA  I AE+++ L     +L++QL  IY EYG H+    Y         + +F  LRN++G + +YP+ CG  KF+I  IRDLTTGY   + + K  LP+  +++MITFTF+N    T+R SGTEPKIKYY+E+     +     E LK ELDEL+  +++HF+Q
Sbjct:   17 LGMDARLDQETAQWLRWDQNPLTSESVKQLIAGGNKEELRKCFGARMEFGTAGLRAPMGAGISRMNDLTIIQTTQGFCRYLEKQFSDLKQRGVVISFDARAHPASGGSSRRFARLAATAFITQGVPVYLFSDITPTPFVPYTVSHLKLCAGIMITASHNPKQDNGYKVYWDNGAQIISPHDRGISQAIEENLEPWPQAWEESLVDSSPLLHNPSASIGNDYFEDLKKYCFHRTVNKESKVKF--VHTSVHGVGHEFVQLAFKAFDLAPPEAVPQQKDPDPEFPTVKYPNPEEGKGVLTLSFALADKIKAKIVLANDPDADRLAVAEKQDSGEWRVFSGNELGALLGWWLFTSWKEKNQDQSNLKDTYMLSSTVSSKILRAIALKEGFHFEETLTGFKWMGNRAQQLGDQGKTVLFAFEEAIGYMCCPFVLDKDGVSAAVICAELASFLATKNLSLSQQLNAIYVEYGYHITTASYFICHDQGTIQNLFGNLRNYDGKN-NYPKMCG--KFEISAIRDLTTGYDDSQPDKKAVLPTSKSSQMITFTFANGGVATMRTSGTEPKIKYYAELCAPPGNSDP--EHLKKELDELVGAIEEHFFQ 609          
BLAST of Phosphoglucomutase vs. UniProt/SwissProt
Match: sp|Q5RFI8|PGM2_PONAB (Phosphoglucomutase-2 OS=Pongo abelii OX=9601 GN=PGM2 PE=2 SV=3)

HSP 1 Score: 508.064 bits (1307), Expect = 1.956e-172
Identity = 279/597 (46.73%), Postives = 382/597 (63.99%), Query Frame = 2
Query:   95 DNRVQIEYEKWMKLDKNEKTRFEMQQL--QFNPEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKKY--DFK-KGIIVGYDARYN------SEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSW--KWDDIRKYVKDPLEELEKAYYER-QFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERF-KGSWKIISGNEFGALLGWWIWSTNKIKSENNDQF---VMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQ 1822
            D R+  E  +W+  DKN  T   +++L  + N EEL+     R++FGTAGLRA MG G + MNDL IIQTTQG     +K   D K KGI++ +DAR +      S ++A++ A  F + GIPVYLFS+I PTPF+ F V+  +   G+MITASHNPK DNGYK+YW+NG QII+P DK I+  I  NL P   +W     D    + +P   +   Y+E  +  C  R++N E K  F  V+T +HGVG  + +     F       VP+Q  PDPEFPTV +PNPEE KG L L+   A+     ++ ANDPDADRLAVAE+   G W++ SGNE GALLGWW++++ K K+++        M+SSTVSSKIL++IA KE F F ETLTGFKW+GN+A ++  +GKTVLFAFEEAIGYMC   +LDKDG+SA  I AE+++ L     +L++QL  IY EYG H+    Y      +  K++FE LR+++G + +YP+ CG  KF+I  IRDLTTGY   + + K  LP+  +++MITFTF+N    T+R SGTEPKIKYY+E+     +     E LK EL+EL++ +++HF+Q
Sbjct:   12 DARLDQETAQWLHWDKNSLTLEAVKRLIAEGNEEELRKCFGARMEFGTAGLRAAMGPGISRMNDLTIIQTTQGFCRYLEKQFSDLKQKGIVISFDARAHPSSGGSSRRFARLAATTFISQGIPVYLFSDITPTPFVPFTVSRLKLCAGIMITASHNPKQDNGYKVYWDNGAQIISPHDKGISQAIEENLEPWPQAWDDSLIDSSPLLHNPSASINNDYFEDLKKYCFHRSVNRETKVKF--VHTSVHGVGHSFVQSAFKAFDLVPPEAVPEQKDPDPEFPTVKYPNPEEGKGVLTLSFALADKTKARIVLANDPDADRLAVAEKQDSGEWRVFSGNELGALLGWWLFTSWKEKNQDRSALKDTYMLSSTVSSKILRAIALKEGFHFEETLTGFKWMGNRAKQLIDQGKTVLFAFEEAIGYMCCPFVLDKDGVSAAVISAELASFLATKNLSLSQQLKAIYVEYGYHITKASYFICHDQDTIKKLFENLRSYDGKN-NYPKACG--KFEISAIRDLTTGYDDNQPDKKAVLPTSKSSQMITFTFANGGVATMRTSGTEPKIKYYAELCAPPGNSDP--EQLKKELNELVSAIEEHFFQ 601          
BLAST of Phosphoglucomutase vs. UniProt/SwissProt
Match: sp|Q8CAA7|PGM2L_MOUSE (Glucose 1,6-bisphosphate synthase OS=Mus musculus OX=10090 GN=Pgm2l1 PE=1 SV=1)

HSP 1 Score: 484.182 bits (1245), Expect = 6.669e-163
Identity = 269/592 (45.44%), Postives = 371/592 (62.67%), Query Frame = 2
Query:   95 DNRVQIEYEKWMKLDKNEKTRFEMQQLQFNP--EELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKK--YDFK-KGIIVGYDAR------YNSEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWD--DIRKYVKDPLEELEKAYYER-QFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAE-RFKGSWKIISGNEFGALLGWWI---WSTNKIKSENNDQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQN--HNDKSRSIEGLKSELDELIAN 1801
            D ++     +W++ DKN KT+ +++ L  N   +EL+ RL  R+ FGTAGLR+ MGAGF ++NDL +IQ+TQG+    ++   DFK +G +VGYD R       +S++ AK+ A +     IPVYLFS  VPTPF+ + V   + + GVMITASHN K+DNGYK+YWE G QI +P DKEI   I   + P  +SW  +  D     KDPL+++ K Y E  +  C  R++N   K   + V+T  HGVG +Y +     FGF   + VP+Q  PDP+F TV  PNPEE +  L L++  A   N  ++ A DPDADRLAVAE +  G WK+ +GNE  AL GWW+   W  NK  ++  + + M+++TVSSKILK+IA KE F F ETL GFKWIG++  ++   GK VLFAFEE+IG++C  ++LDKDG+SA A+ AEM++ L     TL EQL K+YE YG H++   Y         K +FE++RN+  S + YP+FCG   F I+ +RD+TTGY S + N K  LP    ++MITFTF N C  T+R SGTEPKIKYY+E+  +   +D +   E LK  +D LI N
Sbjct:   22 DPQLDTAIGQWLRWDKNPKTKEQIENLLRNGMNKELRDRLCCRMTFGTAGLRSAMGAGFCYINDLTVIQSTQGMYKYLERCFSDFKQRGFVVGYDTRGQVTSSCSSQRLAKLTAAVLLAKDIPVYLFSRYVPTPFVPYAVQELKAVAGVMITASHNRKEDNGYKVYWETGAQITSPHDKEILKCIEECVEPWNDSWNDNLVDTSPLKKDPLQDICKKYMEDLKKICFYRDLN--SKTTLKFVHTSFHGVGHDYVQLAFQVFGFKPPIPVPEQKDPDPDFSTVKCPNPEEGESVLELSLRLAEKENARIVLATDPDADRLAVAELQENGRWKVFTGNELAALFGWWMFDCWKKNKPNADVKNVY-MLATTVSSKILKAIALKEGFHFEETLPGFKWIGSRIKDLLGNGKEVLFAFEESIGFLCGTSVLDKDGVSAAAVVAEMASFLDTRKVTLMEQLTKVYEIYGYHMSKTSYFLCYDPPTIKTIFERIRNFE-SPKEYPKFCG--AFAILHVRDITTGYDSSQPNKKSVLPVSKNSQMITFTFQNGCVATLRTSGTEPKIKYYAEMCASPGQSDTTFLEEELKKLIDALIEN 607          
BLAST of Phosphoglucomutase vs. UniProt/SwissProt
Match: sp|Q6PCE3|PGM2L_HUMAN (Glucose 1,6-bisphosphate synthase OS=Homo sapiens OX=9606 GN=PGM2L1 PE=1 SV=3)

HSP 1 Score: 483.026 bits (1242), Expect = 1.843e-162
Identity = 263/597 (44.05%), Postives = 372/597 (62.31%), Query Frame = 2
Query:   95 DNRVQIEYEKWMKLDKNEKTRFEMQQLQFNP--EELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKK--YDFK-KGIIVGYDAR------YNSEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWD--DIRKYVKDPLEELEKAYYER-QFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAE-RFKGSWKIISGNEFGALLGWWI---WSTNKIKSENNDQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQ 1822
            D ++     +W++ DKN KT+ +++ L  N   +EL+ RL  R+ FGTAGLR+ MGAGF ++NDL +IQ+TQG+    ++   DFK +G +VGYD R       +S++ AK+ A +     +PVYLFS  VPTPF+ + V   + + GVMITASHN K+DNGYK+YWE G QI +P DKEI   I   + P   SW  +  D     +DPL+++ + Y E  +  C  R +N   K   + V+T  HGVG +Y +     FGF   + VP+Q  PDP+F TV  PNPEE +  L L++  A   N  ++ A DPDADRLA AE +  G WK+ +GNE  AL GWW+   W  NK ++ +     M+++TVSSKILK+IA KE F F ETL GFKWIG++  ++   GK VLFAFEE+IG++C  ++LDKDG+SA  + AEM++ L     TL +QL K+YE+YG H++   Y         K +FE+LRN++ S + YP+FCG   F I+ +RD+TTGY S + N K  LP    ++MITFTF N C  T+R SGTEPKIKYY+E+  + +    ++  L+ EL +LI  + ++F Q
Sbjct:   22 DPQLDTAIGQWLRWDKNPKTKEQIENLLRNGMNKELRDRLCCRMTFGTAGLRSAMGAGFCYINDLTVIQSTQGMYKYLERCFSDFKQRGFVVGYDTRGQVTSSCSSQRLAKLTAAVLLAKDVPVYLFSRYVPTPFVPYAVQKLKAVAGVMITASHNRKEDNGYKVYWETGAQITSPHDKEILKCIEECVEPWNGSWNDNLVDTSPLKRDPLQDICRRYMEDLKKICFYRELN--SKTTLKFVHTSFHGVGHDYVQLAFKVFGFKPPIPVPEQKDPDPDFSTVKCPNPEEGESVLELSLRLAEKENARVVLATDPDADRLAAAELQENGCWKVFTGNELAALFGWWMFDCWKKNKSRNADVKNVYMLATTVSSKILKAIALKEGFHFEETLPGFKWIGSRIIDLLENGKEVLFAFEESIGFLCGTSVLDKDGVSAAVVVAEMASYLETMNITLKQQLVKVYEKYGYHISKTSYFLCYEPPTIKSIFERLRNFD-SPKEYPKFCG--TFAILHVRDVTTGYDSSQPNKKSVLPVSKNSQMITFTFQNGCVATLRTSGTEPKIKYYAEMCASPDQSDTAL--LEEELKKLIDALIENFLQ 611          
BLAST of Phosphoglucomutase vs. TrEMBL
Match: A0A0R3WI02 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS197 PE=3 SV=1)

HSP 1 Score: 575.089 bits (1481), Expect = 0.000e+0
Identity = 304/598 (50.84%), Postives = 404/598 (67.56%), Query Frame = 2
Query:   92 IDNRVQIEYEKWMKLDKNEKTRFEMQQLQFNPEEL-KLR--LIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLA--TCKKYDFK-KGIIVGYDARYNSEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWDDIRKY--VKDPLEELEKAYYERQFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERFK-GSWKIISGNEFGALLGWWIWSTNKIKSENND--QFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSY--EENDKLPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQKDIFGFT 1843
            +D +++ + ++++K DKNE TR ++  +  +  +L KLR  L+ R++FGTAGLR++MG G++ MNDL I+QT QGLL   T      K KGIIVG+D R+NS+KWA I ANIF  AG  VYLF +  PTPFLA+GV   +T CGVM+TASHNPKDDNGYK+YWENG QI++P DK IA+ I+ +L P E SW+++D+  +    DP+ ELE  Y + Q   +        K++ R VYT MHGVG   A+R+ + FGF  ++ V +Q+KPDPEF TV FPNPEE K AL LAI TAN   + +I ANDPDADR+AVAE+   G WKI+SGNE   LLGWW+W+  + ++ + D  +  MISSTVSSKIL++IA+KE F F ETLTGFKWI NKA E+  KG  V+F+FEEAIG+MC   +LDKDGI A +   EM+++LY    TL +QL  I++ YG HV+NN Y          +MFE+LR   GS   YP  CG  +FK+  +RDLT  Y S   ++  +LP   +++MITFTF N   +T+R SGTEPKIKYYSE+     DK RS+  L++EL ELI  + + FYQ  + GFT
Sbjct:    1 MDPQLKAKVDEYLKWDKNETTRSQIAAMAASTHDLEKLRKLLMVRMEFGTAGLRSKMGPGYSQMNDLTIVQTAQGLLKYLTDNHSHLKPKGIIVGFDGRHNSKKWASITANIFTRAGWKVYLFRDFNPTPFLAYGVRHFKTACGVMVTASHNPKDDNGYKVYWENGAQILSPHDKGIANAILHSLEPQETSWQYEDVTNHPLCLDPMPELEDTYMKIQKEKICFTEEENKKSDVRFVYTAMHGVGAPAAQRIFHHFGFKHLIPVKEQIKPDPEFSTVKFPNPEEGKSALELAIATANVAGVPVICANDPDADRMAVAEKLPDGKWKILSGNELATLLGWWMWTNWRHRNPHADLSKVYMISSTVSSKILRAIAQKEGFHFEETLTGFKWIANKAYEIMQKGGEVIFSFEEAIGFMCGTTVLDKDGIGAFSAVCEMTSHLYNRKLTLIKQLENIFDTYGKHVSNNSYYFCYEPPKIVKMFERLRRMPGSGH-YPVACG--RFKVTGVRDLTVDYDSSYPDKKARLPVSASSQMITFTFDNGAIVTLRTSGTEPKIKYYSELCGKPGDK-RSMADLEAELAELINLMVEDFYQPKLNGFT 594          
BLAST of Phosphoglucomutase vs. TrEMBL
Match: A0A564YSH4 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS9050 PE=3 SV=1)

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 299/600 (49.83%), Postives = 404/600 (67.33%), Query Frame = 2
Query:   86 MEIDNRVQIEYEKWMKLDKNEKTRFEMQQLQFNP---EELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKKYDFK---KGIIVGYDARYNSEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWDDIRKYVK--DPLEELEKAYYERQFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERFK-GSWKIISGNEFGALLGWWIWSTNKIKSENND--QFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSY--EENDKLPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQKDIFGFT 1843
            M+ D + +++  +W+K DKNE TR E++ +  +P   EELK  +++R++FGTAGLR++MG G++ MNDL I+QT QGLL   ++   K   KGIIVGYD RYNS+ WA I ANIF  +G  VYLF ++  TPFLA+GV   +T CGVM+TASHNPKDDNGYK+YWENG QI++P DK IA  I  +L P  +SW++ D+  + +  +P+ ELE  Y + Q   +        K+N + VYT MHGVG+  AKR+   FGF  ++ V +Q+ PDPEF TV FPNPEE + AL LA+ TAN H + +I ANDPDADR+AVAE+   G+WKI++GNE   +LGWW+W     ++ + D  +  MISSTVSSKIL++IA+KE F F ETLTGFKWI NKA ++  +G  V+F FEEAIG+MC   +LDKDGI    +  EM ++LY+   +L +QL  ++E YG HV+NN Y          +MFE+LR+   +   YP+  G  +FKI  +RDLT GY S   +   +LP   +++MITFTF N+  LTIR SGTEPKIKYYSE+    +DK RS+  L++EL ELI  + K FYQ D+ GFT
Sbjct:    1 MQADLKAKVD--EWLKWDKNETTRKEIEAMASSPARFEELKKLMLNRMEFGTAGLRSKMGPGYSQMNDLTIVQTAQGLLKYMEEKHLKLKPKGIIVGYDGRYNSKTWACITANIFVRSGWKVYLFRDVNTTPFLAYGVRHFKTACGVMVTASHNPKDDNGYKVYWENGAQILSPHDKGIATAITESLEPRASSWQYHDVMNHPQCLNPMPELEDTYIKVQKEKICFTEEENKKSNVQFVYTAMHGVGYNAAKRIFETFGFKHMIPVEEQIHPDPEFSTVKFPNPEEGRSALELAMATANKHGVKIICANDPDADRMAVAEKLPDGTWKILNGNELATVLGWWMWMNWHKRNPDADLSKVYMISSTVSSKILRAIAQKEGFNFEETLTGFKWIANKAYDIMQEGGEVIFCFEEAIGFMCGTTVLDKDGIGTFGVVCEMVSHLYSKNISLVQQLHSVFEMYGKHVSNNSYYFCYEPPKIVQMFERLRHMPKTG-GYPQTLG--RFKINGLRDLTVGYDSNYPDHKARLPVSASSQMITFTFDNDVVLTIRTSGTEPKIKYYSELCGKCDDK-RSMAELEAELTELIGLMVKEFYQPDVNGFT 594          
BLAST of Phosphoglucomutase vs. TrEMBL
Match: A0A068YF10 (Phosphoglucomutase 2 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001087500 PE=3 SV=1)

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 305/598 (51.00%), Postives = 404/598 (67.56%), Query Frame = 2
Query:   92 IDNRVQIEYEKWMKLDKNEKTRFEMQQLQFNPEEL-KLR--LIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATC---KKYDFKKGIIVGYDARYNSEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWDDIRKY--VKDPLEELEKAYYERQFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERF-KGSWKIISGNEFGALLGWWIWSTNKIKSENND--QFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSY--EENDKLPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQKDIFGFT 1843
            +D +++ + E+++K DKNE TR ++  +  +  +L KLR  L+ R++FGTAGLR+RMG G++ MNDL I+QT QGLL        Y   KGIIVG+D R+NS+KWA I ANIF  AG  VYLF +  PTPFLA+GV   +T CGVM+TASHNPKDDNGYK+YWENG QI++P DK IA  I+ +L P E SW+++D+ K+    DP+ ELE  Y + Q   +        K++ + VYT MHGVG   A+R+ + FGF  +V V +Q+KPDPEFPTV FPNPEE K AL LAI TAN   +++I ANDPDADR+AVAE+   G+WKI+SGNE   LLGWW+W+  + ++   D  +  MI+STVSSKIL++IA+KE F F ETLTGFKWI NKA E+  KG  V+FAFEEAIG+MC   +LDKDGI A +   EM+++LY    +L +QL  I++ YG HV+NN Y          +MFE+LR   G    YP  CG  +FK+  +RDLT  Y S   ++  +LP   +++MITFTF N   +T+R SGTEPKIKYYSE+     DK RS+  L++EL ELI  + + FYQ  + GFT
Sbjct:    1 MDLQLKAKVEEYLKWDKNESTRSQIAAMAASSHDLEKLRKLLMVRMEFGTAGLRSRMGPGYSQMNDLTIVQTAQGLLKYLTDNHSYLKPKGIIVGFDGRHNSKKWASITANIFTRAGWKVYLFRDFNPTPFLAYGVRHFKTACGVMVTASHNPKDDNGYKVYWENGAQILSPHDKGIASAILQSLEPQETSWQYEDVTKHPLCLDPMPELEDTYMKMQKESICFTKEENGKSDVKFVYTAMHGVGAPAAQRIFHHFGFKHLVLVEEQIKPDPEFPTVKFPNPEEGKSALELAIATANRAGVAVICANDPDADRMAVAEKLPSGNWKILSGNELATLLGWWMWTNWRKRNPYADLSKVYMIASTVSSKILRAIAQKEGFNFEETLTGFKWIANKAYEIMQKGGEVIFAFEEAIGFMCGTTVLDKDGIGAFSTVCEMTSHLYNQNLSLVKQLDHIFDIYGKHVSNNSYYFCYEPPKIVKMFERLRRMPGGGH-YPLACG--RFKVTGVRDLTVDYDSSYPDKKARLPVSASSQMITFTFDNGAIVTLRTSGTEPKIKYYSELCGKPGDK-RSMAELEAELAELIGLMVEEFYQPKLNGFT 594          
BLAST of Phosphoglucomutase vs. TrEMBL
Match: A0A068WZL7 (Phosphoglucomutase 2 OS=Echinococcus granulosus OX=6210 GN=EgrG_001087500 PE=3 SV=1)

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 304/598 (50.84%), Postives = 403/598 (67.39%), Query Frame = 2
Query:   92 IDNRVQIEYEKWMKLDKNEKTRFEMQQLQFNPEEL-KLR--LIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATC---KKYDFKKGIIVGYDARYNSEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWDDIRK--YVKDPLEELEKAYYERQFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERF-KGSWKIISGNEFGALLGWWIWSTNKIKSENND--QFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSY--EENDKLPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQKDIFGFT 1843
            +D +++ + E+++K DKNE TR ++  +  +  +L KLR  L+ R++FGTAGLR+RMG G++ MNDL I+QT QGLL        Y   KGIIVG+D R+NS+KWA I ANIF  AG  VYLF +   TPFLA+GV   +T CGVM+TASHNPKDDNGYK+YWENG QI++P DK IA  I+ +L P E SW+++D+ K     DP+ ELE  Y + Q   +        K++ + VYT MHGVG   A+R+ + FGF  +V V +Q+KPDPEFPTV FPNPEE K AL LAI TAN   +++I ANDPDADR+AVAE+   G+WKI+SGNE   LLGWW+W+  + ++ + D  +  MI+STVSSKIL++IA+KE F F ETLTGFKWI NKA E+  KG  V+FAFEEAIG+MC   +LDKDGI A +   EM+++LY    +L +QL  I++ YG HV+NN Y          +MFE+LR   G    YP  CG  +FK+  +RDLT  Y S   ++  +LP   +++MITFTF N   +T+R SGTEPKIKYYSE+     DK RS+  L++EL ELI  + + FYQ  + GFT
Sbjct:    1 MDPQLKAKVEEYLKWDKNESTRSQIAAMAASSHDLDKLRKLLMVRMEFGTAGLRSRMGPGYSQMNDLTIVQTAQGLLKYLTDNHSYLKPKGIIVGFDGRHNSKKWASITANIFTRAGWKVYLFRDFNSTPFLAYGVRHFKTACGVMVTASHNPKDDNGYKVYWENGAQILSPHDKGIASAILQSLEPQETSWQYEDVTKNPLCLDPMPELEDTYMKVQKETICFTEEENGKSDVKFVYTAMHGVGAPAAQRIFHHFGFKHLVLVEEQIKPDPEFPTVKFPNPEEGKSALELAIATANRAGVTVICANDPDADRMAVAEKLPSGNWKILSGNELATLLGWWMWTNWRKRNPHADLSKVYMIASTVSSKILRAIAQKEGFNFEETLTGFKWIANKAYEIMQKGGEVIFAFEEAIGFMCGTTVLDKDGIGAFSAVCEMTSHLYNQNLSLVKQLDHIFDIYGKHVSNNSYYFCYEPPKIVKMFERLRRMPGGGH-YPFACG--RFKVTGVRDLTVDYDSSYPDKKARLPVSASSQMITFTFDNGAIVTLRTSGTEPKIKYYSELCGKPGDK-RSMAELEAELAELIGLMVEEFYQPKLNGFT 594          
BLAST of Phosphoglucomutase vs. TrEMBL
Match: A0A3Q0KIP8 (Putative phosphoglucomutase OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 307/604 (50.83%), Postives = 407/604 (67.38%), Query Frame = 2
Query:   92 IDNRVQIEYEKWMKLDKNEKTRFEMQQLQFNP--EELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKKYDFKK-------GIIVGYDARYNSEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWDDIR--KYVKDPLEELEKAYYERQFN--CLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERFK-GSWKIISGNEFGALLGWWIWSTNKIKSE--NNDQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNW--NGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQKDIFGF 1840
            +DN++    E+WMK DKNE TR +++ L+     +EL+  L++R+ FGTAGLRARMG G++ MNDL IIQTTQGLL    KY  K        GIIVGYDAR+NS+KWA IVANIF NAG  VYLF +  PTP +AFGV   +T  GVMITASHNPKDDNGYK+YW NGCQII+P D  I+  I+ +L P E SW  D++       DP+ +L K Y   Q +  C + + N++ K +F  VYTPMHGVGWE  K +++ FGF  +  VP+Q+ P+P+FPTV +PNPEE + AL L I+ A +   ++I ANDPDADRLAVAE+ K G WKI SGNE GAL GWW+    KI +   N     ++SSTVSSKILK+IAE E F+F ETLTGFKW+GN++ E++ +    +FAFEEAIG+MC   + DKDG+ ALA+ AE++A ++ NG  L+EQL +IY  YG H++NNGY      E   +MF ++RNW      + YP+  G  +F+I  IRDLT GY  +  + K  LP   ++++ITF FSN  TLT+R SGTEPKIKYYSE+ ++ +    S+E L +EL EL+  + + FY+ +  GF
Sbjct:    1 MDNKLAESLEEWMKYDKNESTRSQIKLLKEKEAWDELRKLLLERMAFGTAGLRARMGPGYSQMNDLTIIQTTQGLL----KYSLKTFSGLKSDGIIVGYDARHNSKKWAFIVANIFVNAGCKVYLFKDTFPTPMVAFGVRLFKTALGVMITASHNPKDDNGYKVYWSNGCQIISPHDSGISSCILESLEPLETSWNIDNVEANPLCLDPMPKLLKTYCRLQKSRLCFTESENIKCKTSF--VYTPMHGVGWEAVKTLVSCFGFPPLEPVPEQITPNPDFPTVNYPNPEEGRSALNLGIKHAESIKSTIIFANDPDADRLAVAEKQKSGQWKIFSGNELGALFGWWLSLQWKIHNPHVNPSSVAVLSSTVSSKILKTIAEHEGFRFEETLTGFKWLGNRSCELESQNIKTIFAFEEAIGFMCGDVVWDKDGVGALAVMAELTAYVHRNGKLLSEQLIEIYNIYGQHISNNGYYFCHEPEKIVKMFNRIRNWPNEPGPKGYPQKLG--RFQITGIRDLTVGYDDHYPDLKPVLPVSKSSQLITFDFSNGVTLTLRTSGTEPKIKYYSEL-RSKSGSEASVESLTNELQELVNKMIEEFYEPEKNGF 595          
BLAST of Phosphoglucomutase vs. Ensembl Cavefish
Match: pgm2 (phosphoglucomutase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2218])

HSP 1 Score: 451.055 bits (1159), Expect = 4.083e-151
Identity = 249/598 (41.64%), Postives = 358/598 (59.87%), Query Frame = 2
Query:   95 DNRVQIEYEKWMKLDKNEKTRFEMQQLQFNP--EELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGL---LATCKKYDFKKGIIVGYDARYN------SEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWDDIRK--YVKDPLEELEKAYYERQFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAER----FKGSWKIISGNEFGALLGWWIWSTNKIKSENNDQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQKD 1828
            D  +     +W++ D+N KT   ++++  N   +ELK     R++FGTAGLRA MG G + MNDL IIQTTQG    L  C     ++G+++G+DAR +      S+++A + A I  + G+PVYLFS   PTP++ F V+      G+M+TASHNPK DNGYK+YWENG QII P DK IA  I  NL P   SW      +   +KDP +++ + Y           + +  ++  ++V+T +HGVG  + +     F       V +Q  PDP+FPTV +PNPEE  G L L+   A+    +++ ANDPDADRLAVAE+     +  + I +G    ++L    W     K        M++STVSSKIL++IA KE F F ETLTGFKW+GN+  ++  +GKTVLFAFEEAIGYMC+  +LDKDG+SA AI  E+ + L     +L++QL  IY+EYG H+  N Y         K++FE+LRN+ G + SYP+ C    F +  +RDLTTGY S + ++K  LP+  +++MITFTF+N    T+R SGTEPKIKYY+E+     +    +  L +ELD L+  + ++F+Q +
Sbjct:   20 DPGLDTAIRQWLEFDRNAKTAACVREMVKNGAIDELKKCFGARMEFGTAGLRAAMGPGVSRMNDLTIIQTTQGFCRYLEQCFTDLKERGVVIGFDAREHTASGGSSKRFASLAAAILTSRGVPVYLFSVFTPTPYVPFTVSHLGLCAGIMVTASHNPKQDNGYKVYWENGAQIIPPHDKGIAASIEKNLEPWPESWDTTAASQSPLLKDPYQDIHREY-----------LQINKQSEVKIVHTSVHGVGHVFVQAAFKAFDLRAPYAVEEQKDPDPDFPTVEYPNPEEGAGVLNLSFALADKEGATVVFANDPDADRLAVAEKQPRFVRVCFVIFAGLVGVSVLEAAAWG----KKAAVKDLYMLASTVSSKILRAIALKEGFHFEETLTGFKWMGNRGKQLLDQGKTVLFAFEEAIGYMCSPAVLDKDGVSAAAIAGELVSYLATKNTSLSQQLKCIYDEYGYHITKNSYFICHDQNTIKQLFERLRNYEGEN-SYPKEC--RGFSVTAVRDLTTGYDSNQSDNKAILPTSKSSQMITFTFANGGVATMRTSGTEPKIKYYTELCAAPGNS--DLNQLNAELDSLVDAIVENFFQPE 597          
BLAST of Phosphoglucomutase vs. Ensembl Cavefish
Match: pgm2l1 (phosphoglucomutase 2 like 1 [Source:NCBI gene;Acc:103027253])

HSP 1 Score: 449.129 bits (1154), Expect = 3.234e-150
Identity = 257/590 (43.56%), Postives = 355/590 (60.17%), Query Frame = 2
Query:  122 KWMKLDKNEKTRFEMQQL--QFNPEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGL---LATCKKYDFKKGIIVGYDARY------NSEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWDDIR--KYVKDPLEELEKAYYER-QFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERF-KGSWKIISGNEFGALLGWWI---WSTNKIKSENNDQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQKD 1828
            +W+  DKN  TR +++ L  +   EEL+  L  R+ FGTAGLRA MGAGF+ +NDL +IQ+TQG+   LA C      +G++VGYD R        SE+ A++ A +     IPVYLFS  VPTPF+ + V       GVMITASHN K+DNGYK+YW+NG QI +P DKEI   I  N  P   SW  D +       DPLE++ + Y E  +  C  R +N   +   + V++  HGVG  Y +R    FGF   + VP+Q+ PDP F TV  PNPEE +  L L++  A      ++ A DPDADRLAVAE+  K  WK+ +GNE  ALLGWW+   W       E+ ++  M+++TVSSKIL+++A+KE F F ETL GFKWIGNK  E+   GK V+F+FEE+IG++C   +LDKDG+SA A+ AEM+A+L+    TL +QL  IYE YG H++   Y+        KR+F +LRN+      YP  CG   + I  +RD+TTGY S + + +  LP   +++M+TFTF N    T+R SGTEPKIKYY+E         R +  L+ EL +L + + + F + +
Sbjct:   28 QWISWDKNGATREQIKILVQEGRVEELRRILGSRMTFGTAGLRAAMGAGFSRVNDLTVIQSTQGMYVYLAKCFPDLSSRGLVVGYDTRAQECSGCTSERLARLTAAVMLCKDIPVYLFSTYVPTPFVPYAVKKIGAAAGVMITASHNRKEDNGYKVYWQNGAQISSPHDKEILRCIEENTEPWPESWNEDLVEDSPLRSDPLEDVCRWYMEELRTVCFQRELN--TRCPLKFVHSSFHGVGHSYVQRAFQAFGFPPPIPVPEQMNPDPNFSTVSCPNPEEGESVLELSLRLAEREEAKIVLATDPDADRLAVAEQCDKCGWKVFTGNELAALLGWWMLYNWKEAHPDPEDTERVYMLATTVSSKILQALAQKEGFHFQETLPGFKWIGNKIHELTKTGKEVIFSFEESIGFLCGSMVLDKDGVSAAAVVAEMAAHLHTKNITLKQQLQYIYEIYGFHISRTSYVICNDPPTVKRIFTRLRNFEDEG-VYPRKCGG--YSIAHVRDVTTGYDSSQPDKRSVLPVTKSSQMVTFTFHNGIVATLRTSGTEPKIKYYTEFCAPPG--KRDLFSLEDELKKLASALLEEFLEPE 610          
BLAST of Phosphoglucomutase vs. Ensembl Cavefish
Match: pgm2l1 (phosphoglucomutase 2 like 1 [Source:NCBI gene;Acc:103027253])

HSP 1 Score: 435.647 bits (1119), Expect = 8.574e-146
Identity = 245/556 (44.06%), Postives = 336/556 (60.43%), Query Frame = 2
Query:  218 IKFGTAGLRARMGAGFAFMNDLIIIQTTQGL---LATCKKYDFKKGIIVGYDARY------NSEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWDDIR--KYVKDPLEELEKAYYER-QFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERF-KGSWKIISGNEFGALLGWWI---WSTNKIKSENNDQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQKD 1828
            + FGTAGLRA MGAGF+ +NDL +IQ+TQG+   LA C      +G++VGYD R        SE+ A++ A +     IPVYLFS  VPTPF+ + V       GVMITASHN K+DNGYK+YW+NG QI +P DKEI   I  N  P   SW  D +       DPLE++ + Y E  +  C  R +N   +   + V++  HGVG  Y +R    FGF   + VP+Q+ PDP F TV  PNPEE +  L L++  A      ++ A DPDADRLAVAE+  K  WK+ +GNE  ALLGWW+   W       E+ ++  M+++TVSSKIL+++A+KE F F ETL GFKWIGNK  E+   GK V+F+FEE+IG++C   +LDKDG+SA A+ AEM+A+L+    TL +QL  IYE YG H++   Y+        KR+F +LRN+      YP  CG   + I  +RD+TTGY S + + +  LP   +++M+TFTF N    T+R SGTEPKIKYY+E         R +  L+ EL +L + + + F + +
Sbjct:    1 MTFGTAGLRAAMGAGFSRVNDLTVIQSTQGMYVYLAKCFPDLSSRGLVVGYDTRAQECSGCTSERLARLTAAVMLCKDIPVYLFSTYVPTPFVPYAVKKIGAAAGVMITASHNRKEDNGYKVYWQNGAQISSPHDKEILRCIEENTEPWPESWNEDLVEDSPLRSDPLEDVCRWYMEELRTVCFQRELN--TRCPLKFVHSSFHGVGHSYVQRAFQAFGFPPPIPVPEQMNPDPNFSTVSCPNPEEGESVLELSLRLAEREEAKIVLATDPDADRLAVAEQCDKCGWKVFTGNELAALLGWWMLYNWKEAHPDPEDTERVYMLATTVSSKILQALAQKEGFHFQETLPGFKWIGNKIHELTKTGKEVIFSFEESIGFLCGSMVLDKDGVSAAAVVAEMAAHLHTKNITLKQQLQYIYEIYGFHISRTSYVICNDPPTVKRIFTRLRNFEDEG-VYPRKCGG--YSIAHVRDVTTGYDSSQPDKRSVLPVTKSSQMVTFTFHNGIVATLRTSGTEPKIKYYTEFCAPPG--KRDLFSLEDELKKLASALLEEFLEPE 549          
BLAST of Phosphoglucomutase vs. Ensembl Cavefish
Match: pgm2l1 (phosphoglucomutase 2 like 1 [Source:NCBI gene;Acc:103027253])

HSP 1 Score: 404.445 bits (1038), Expect = 3.731e-133
Identity = 241/590 (40.85%), Postives = 337/590 (57.12%), Query Frame = 2
Query:  122 KWMKLDKNEKTRFEMQQL--QFNPEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGL---LATCKKYDFKKGIIVGYDARY------NSEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWDDIR--KYVKDPLEELEKAYYER-QFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERF-KGSWKIISGNEFGALLGWWI---WSTNKIKSENNDQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQKD 1828
            +W+  DKN  TR +++ L  +   EEL+  L  R+ FGTAGLRA MGAGF+ +NDL +IQ+TQG+   LA C      +G++VGYD R        SE+ A++ A +     IPVYLFS  VPTPF+                            +YW+NG QI +P DKEI   I  N  P   SW  D +       DPLE++ + Y E  +  C  R +N   +   + V++  HGVG  Y +R    FGF   + VP+Q+ PDP F TV  PNPEE +  L L++  A      ++ A DPDADRLAVAE+  K  WK+ +GNE  ALLGWW+   W       E+ ++  M+++TVSSKIL+++A+KE F F ETL GFKWIGNK  E+   GK V+F+FEE+IG++C   +LDKDG+SA A+ AEM+A+L+    TL +QL  IYE YG H++   Y+        KR+F +LRN+      YP  CG   + I  +RD+TTGY S + + +  LP   +++M+TFTF N    T+R SGTEPKIKYY+E         R +  L+ EL +L + + + F + +
Sbjct:   30 QWISWDKNGATREQIKILVQEGRVEELRRILGSRMTFGTAGLRAAMGAGFSRVNDLTVIQSTQGMYVYLAKCFPDLSSRGLVVGYDTRAQECSGCTSERLARLTAAVMLCKDIPVYLFSTYVPTPFV----------------------------VYWQNGAQISSPHDKEILRCIEENTEPWPESWNEDLVEDSPLRSDPLEDVCRWYMEELRTVCFQRELN--TRCPLKFVHSSFHGVGHSYVQRAFQAFGFPPPIPVPEQMNPDPNFSTVSCPNPEEGESVLELSLRLAEREEAKIVLATDPDADRLAVAEQCDKCGWKVFTGNELAALLGWWMLYNWKEAHPDPEDTERVYMLATTVSSKILQALAQKEGFHFQETLPGFKWIGNKIHELTKTGKEVIFSFEESIGFLCGSMVLDKDGVSAAAVVAEMAAHLHTKNITLKQQLQYIYEIYGFHISRTSYVICNDPPTVKRIFTRLRNFEDEG-VYPRKCGG--YSIAHVRDVTTGYDSSQPDKRSVLPVTKSSQMVTFTFHNGIVATLRTSGTEPKIKYYTEFCAPPG--KRDLFSLEDELKKLASALLEEFLEPE 584          
BLAST of Phosphoglucomutase vs. Ensembl Cavefish
Match: pgm1 (phosphoglucomutase 1 [Source:NCBI gene;Acc:103038467])

HSP 1 Score: 57.3806 bits (137), Expect = 3.048e-8
Identity = 116/523 (22.18%), Postives = 223/523 (42.64%), Query Frame = 2
Query:  221 KFGTAGLRARMGAGFAFMNDLIIIQT-TQGLLATCKKYDFKKG-IIVGYDARYNSEKWAKIVANIFHNAGIPVYLFS--NIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNG---YKLYWENGCQIIAPLDKEIAD--------DIMLNLVPD-----ENSWKWDDIRKYVKDPLEELEKAYYERQ---FNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRM----LNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEEKGALGLAIETANAHNISLIAANDPDADRLAVAERFKGSWKIISGNEFGALLGWWIWSTNKIKSENNDQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRN--WNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDKLPSDLA-NEMITFTFSNNCTLTIRASGT 1699
            K GT+GLR R+     F  +    +   Q +++T +    ++G ++VG D R+  +   +++  I    GI   +     I+ TP ++  +   + + G+++TASHNP   NG    K    NG      +  +I D         I   L  D     + +++ D  + +  + ++ +E +Y E     F+  +    L   N+  +    MHGV   Y K++    L     + + CVP +     +F     P+P    A  L + T         AA D D DR  V  +       ++ ++  A++G  I      +        +  S  +S  L ++A+  K + YET TG+K+ GN  D     GK  L   EE+ G   + +I +KDG+   A+ A +S  L A   ++ + + + ++++G +       +   S+   +M  +L+N  ++ +        GD+ +++ K  +       +E  D + + ++  + +   FS+   +  R SGT
Sbjct:   16 KPGTSGLRKRV---TVFQQNQHYAENFIQSIISTVEPSQRQEGTLVVGGDGRFFMKDAIQLIVQIAAANGIGRLVIGQNGIMSTPAVSCVIRKTKAIGGIILTASHNPGGPNGDFGIKYNISNGGPAPEGITNKIFDISKGLQEYHICPELKADLSTIGKQTFEVDTFKPFTVEIVDSVE-SYAEMLRDIFDFAALKELLSGPNHINVRLDAMHGVVGPYVKKIVCEELGSPANSAVNCVPSE-----DFGG-HHPDPNLTYAADL-VNTMKGGEYDFGAAFDGDGDRNMVLGK---HGFFVNPSDSVAVIGANITCIPYFQKTGVKG--LARSMPTSGALDNVAKALKMELYETPTGWKFFGNLMD----AGKLSLCG-EESFGTGSD-HIREKDGL--WAVLAWLSI-LAARKQSVEDIMKEHWQKFGRNFFTRYDYEEVDSDAANKMITELQNTMFDKAFVGQKFSSGDKTYQVEKADN-------FEYTDPVDASVSKGQGLRIIFSDGSRIIFRLSGT 506          
BLAST of Phosphoglucomutase vs. Ensembl Sea Lamprey
Match: pgm2 (phosphoglucomutase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2218])

HSP 1 Score: 436.802 bits (1122), Expect = 1.127e-147
Identity = 240/509 (47.15%), Postives = 314/509 (61.69%), Query Frame = 2
Query:  377 SEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSW--KWDDIRKYVKDPLEELEKAYYE--RQFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERF-KGSWKIISGNEFGALLGWWIWSTNKIKSENN-----DQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNW------------NGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQKD 1828
            S +++ + A +F + G+PVYLFS I PTPF+ + V       G+M+TASHNPK DNGYK+YW NG QII+P D  IA  I  NL P E SW     D     KDP  ++ + Y+   R+  C  R  N   ++  + V+T +HGVG ++ +     FG    + V +Q  PDPEFPTV +PNPEE KG L LAI+ A      +I ANDPDADRLAVAER   G WK+ +GNE GALLGWW++   K +S        D+  M+SSTVSSKIL++IA KE F F ETLTGFKW+GN+A E+  +GKTVLFAFEEAIG+MC   +LDKDG+SA A+ AEM+ +L     TLT+QL  IYEEYG H++   Y          RMFE+LR W                 +YP  CG   ++I  +RDLTTGY S + + +  LPS  +++MITFTF+N C  T+R SGTEPKIKYY+E+        R   GL  ELD+LI  + ++F+Q +
Sbjct:    1 SGRFSLLAAVVFLSQGVPVYLFSQISPTPFVPYTVVHLGLSAGIMVTASHNPKQDNGYKVYWSNGAQIISPHDTGIARAIQENLEPWEGSWLEALADTSPLCKDPFADINRDYFSDLRKL-CFHREQN--ERSPLKFVHTSVHGVGHDFVQSSFAAFGLAPPIAVAEQKDPDPEFPTVKYPNPEEGKGVLNLAIKLAEREGARVILANDPDADRLAVAERQDAGDWKVFTGNEVGALLGWWLFYCWKERSPPGTRAPLDRISMLSSTVSSKILRAIAHKEGFHFEETLTGFKWMGNRAKELMDQGKTVLFAFEEAIGFMCGTTVLDKDGVSAAAVAAEMAIHLATKKLTLTKQLTLIYEEYGYHISCTSYFICHDPPTIVRMFERLRKWAGAEEEGGVSGGGSGRAAYPTCCG--PYEIAHVRDLTTGYDSGQADKRALLPSSSSSQMITFTFANGCVATMRTSGTEPKIKYYAEMCATPG--KRDTVGLAKELDDLIEAMVENFFQPE 502          
BLAST of Phosphoglucomutase vs. Ensembl Yeast
Match: PRM15 (Phosphoribomutase; catalyzes interconversion of ribose-1-phosphate and ribose-5-phosphate; has some phosphoglucomutase activity but primary activity in vivo is phosphoribomutase; contributes to ribose recycling in the pentose phosphate pathway; transcription induced in response to stress; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and nucleus; non-essential [Source:SGD;Acc:S000004891])

HSP 1 Score: 376.326 bits (965), Expect = 6.871e-123
Identity = 242/594 (40.74%), Postives = 331/594 (55.72%), Query Frame = 2
Query:  125 WMKLDKNEKTRFEMQQL--QFNPEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKKYDFKKGII--VGYDARYNSEKWAKIVANIFHNAGIPVYLFS---NIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWDDI-RKYVKD-----PLEELEKAYYER-QFNCLSRN-INLEMKNNFRLVYTPMHGVGWE----YAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEEKGALGLAIETANAHNISLIAANDPDADRLAVA--ERFKGSWKIISGNEFGALLGWWIWSTNKIKS---ENNDQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEM-----------SANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRN-WNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTF-------SNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGL 1771
            W K D+N KT  E+  L  + +  EL  R   RI+FGTAGLR++M AGF+ MN L++IQ +QGL AT  +  F   ++  VG+D R++S+++A+  A  F   G  V+  +     V TP + F V   +   GVMITASHNPK DNGYK+Y+ NGCQII P D  I+D I  NL P  N W +DD+  K +K        EE+ K Y E    N +  N + LE+K     VYTPMHGVG++      K+ L        +CVP+Q  PDP FPTV FPNPEEKGAL + I  A  H+I L+ ANDPDADR +VA  +   G W+ ++GNE G L  ++ +   K      ++     M++STVSS+++K +AE E F + +TLTGFKWIGN+A  ++ KG  V F FEEAIGYM      DKDGISA  +F +              N+  NG          +++YG     NGY    +  +TK +F+ +RN +     SYP   G+E  +++  RDLTTGY S   N K  LP D  ++MIT +        + +   TIR SGTEPK+K Y E   N   ++  +  L
Sbjct:   20 WFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLRSQMQAGFSRMNTLVVIQASQGL-ATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPLKLEVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEYQKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKGYYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENG----------FKKYGVFKEYNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEE-IEVLYYRDLTTGYQSDTINHKPTLPVDPTSQMITVSARPSNGSENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAKL 601          
BLAST of Phosphoglucomutase vs. Ensembl Yeast
Match: PGM2 (Phosphoglucomutase; catalyzes the conversion from glucose-1-phosphate to glucose-6-phosphate, which is a key step in hexose metabolism; functions as the acceptor for a Glc-phosphotransferase; protein abundance increases in response to DNA replication stress; PGM2 has a paralog, PGM1, that arose from the whole genome duplication [Source:SGD;Acc:S000004711])

HSP 1 Score: 58.5362 bits (140), Expect = 1.781e-9
Identity = 128/593 (21.59%), Postives = 240/593 (40.47%), Query Frame = 2
Query:  173 LQFNPEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQT-TQGLLATCKKYDFKKGIIVGYDARYNSEKWAKIVANIFHNAGIPVYLFS--NIVPTPFLAFGVTFCQTLC--GVMITASHN---PKDDNGYKLYWENG-------CQIIAPLDKEIADDIMLNLVPDENSWKWDDIRKY----------VKDPLEELEKAYYERQFNCLSRNI-NLEMKNNFRLVYTPMHGVGWEYAKRM-LNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEEKGALGLAIETANAHNISLIAANDPDADRLAVAERFKGSWKIISGNEFGALLGWWIWSTNKIKSENNDQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISA----LAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNW-NGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDKLPSDLANEMITFTFSNNCTLTIRASGTEPK---IKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQKDIFGFTE 1846
            + F  E +  +  +  K GT+GLR +      F ++    +   Q ++    +      ++VG D RY ++     +A I    GI   +     ++ TP  +  +   +  C  G+++TASHN   P++D G K    NG          I  + K++    ++   P+ +       +KY           KD +  L++ +    F+ + + I N     N++L++  M+GV   Y K + +++FG      + Q   P P+F  +  P+P    A  L ++  +   I   AA+D D DR  +   +      +S  +  A++  +         +    + +  S  +S  +  +A+      YE  TG+K+     D      K +    EE+ G   N ++ +KDG+ A    L I A  + +   N  ++     + + +YG         +   +E   ++ ++LR +   S      F  DE  K+    D     +SY + D   SD  ++ +    SN     +R SGT      I+ Y E  +  +DKS+  +  +  L  +I +V K    K + G  E
Sbjct:    1 MSFQIETVPTKPYEDQKPGTSGLRKKTKV---FKDEPNYTENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILHKIAAIGAANGIKKLVIGQHGLLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKDFPELDLGTIGKNKKYGPLLVDIIDITKDYVNFLKEIF---DFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLPADEVL-QNWHPSPDFGGM-HPDPNLTYASSL-VKRVDREKIEFGAASDGDGDRNMI---YGYGPSFVSPGDSVAIIAEYAAEIPYFAKQG--IYGLARSFPTSGAIDRVAKAHGLNCYEVPTGWKFFCALFD-----AKKLSICGEESFGTGSN-HVREKDGVWAIMAWLNILAIYNKHHPENEASIKTIQNEFWAKYGRTFFTRYDFEKVETEKANKIVDQLRAYVTKSGVVNSAFPADESLKVTDCGD-----FSYTDLDGSVSD--HQGLYVKLSNGARFVLRLSGTGSSGATIRLYIE--KYCDDKSQYQKTAEEYLKPIINSVIKFLNFKQVLGTEE 564          
BLAST of Phosphoglucomutase vs. Ensembl Yeast
Match: PGM1 (Phosphoglucomutase, minor isoform; catalyzes the conversion from glucose-1-phosphate to glucose-6-phosphate, which is a key step in hexose metabolism; PGM1 has a paralog, PGM2, that arose from the whole genome duplication [Source:SGD;Acc:S000001610])

HSP 1 Score: 55.0694 bits (131), Expect = 2.057e-8
Identity = 122/576 (21.18%), Postives = 228/576 (39.58%), Query Frame = 2
Query:  221 KFGTAGLRARMGAGFAFMNDLIIIQT-TQGLLATCKKYDFKKGIIVGYDARYNSEKWAKIVANIFHNAGIPVYLFS--NIVPTPFLAFGVTFCQTLC---GVMITASHN---PKDDNGYKLYWENG-------CQIIAPLDKEIADDIMLNLVPDENSWKWDDIRKYVKDPLEELEKAYYERQFNCLSRNINLEMKNNF----------RLVYTPMHGVGWEYAKRM-LNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEEKGALGLAIETANAHNISLIAANDPDADRLAVAERFKGSWKIISGNEFGALLGWWIWSTNKIKSENNDQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCG-----DEKFKIIKIRDLTTGYYSYEENDKLPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSE--LDELIANVKKHFYQKDIFGFTE 1846
            K GT+GLR +      FM++    +   Q  + +         ++VG D R+ ++     +A +    G+   +     ++ TP  +  +   +  C   G+++TASHN   P++D G K    NG          I    K++    ++   P  N  K    +KY    ++ ++ A    QF  L    + ++  +F          +L++  ++G+   Y K + +++FG      V Q   P P+F  +  P+P    A  L ++  +   I+  AA+D D DR  +   +      +S  +  A++  +         +    + +  S  +S  +  +A K+  + YE  TG+K+     D      K +    EE+ G   N +I +KDG+ A+  +  + A  +         +  I +E+        + +     +     EK+        S P  CG     DE   +I   D     +SY + D   S+  N+ +   FSN     +R SGT          V+ + DK  +  G  ++  L  +I ++ K    K+I G  E
Sbjct:   17 KPGTSGLRKKTKV---FMDEPHYTENFIQATMQSIPNGSEGTTLVVGGDGRFYNDVIMNKIAAVGAANGVRKLVIGQGGLLSTPAASHIIRTYEEKCTGGGIILTASHNPGGPENDLGIKYNLPNGGPAPESVTNAIWEASKKLTHYKIIKNFPKLNLNKLGKNQKYGPLLVDIIDPAKAYVQF--LKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNGITGPYGKAIFVDEFGL-PAEEVLQNWHPLPDFGGL-HPDPNLTYARTL-VDRVDREKIAFGAASDGDGDRNMI---YGYGPAFVSPGDSVAIIAEYAPEIPYFAKQG--IYGLARSFPTSSAIDRVAAKKGLRCYEVPTGWKFFCALFD-----AKKLSICGEESFGTGSN-HIREKDGLWAIIAWLNILAIYHRRNPEKEASIKTIQDEFWNEYGRTFFTRYDYEHIECEQAEKVVALLSEFVSRPNVCGSHFPADESLTVIDCGD-----FSYRDLDGSISE--NQGLFVKFSNGTKFVLRLSGTGSSGATIRLYVEKYTDKKENY-GQTADVFLKPVINSIVKFLRFKEILGTDE 565          
BLAST of Phosphoglucomutase vs. Ensembl Nematostella
Match: EDO44486 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVP4])

HSP 1 Score: 507.679 bits (1306), Expect = 1.487e-173
Identity = 273/592 (46.11%), Postives = 382/592 (64.53%), Query Frame = 2
Query:   89 EIDNRVQIEYEKWMKLDKNEKTRFEMQQL--QFNPEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKKY--DFK-KGIIVGYDARYNSEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWDDIRKYVK--DPLEELEKAYYERQFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAER-FKGSWKIISGNEFGALLGWWIWSTNKIKSEN---NDQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQ 1822
            E+D ++     +W+ LDK + T  E++QL    N EEL+ RL+  + FGTAGLR+ MGAGF+ MNDL +IQ +QGL    ++   D K KG+++G+DAR+NS + A+  A +F +  I VYLFS + PTP++ F V F +  CGVM+TASHNPKDDNGYK+Y++NG QI +P DK I+  I  N  P E SW     + + K  DPL+E   AY     N  S   ++  +   +  +TPMHGVG  +A      F     + V +Q+ PDPEFPTV +PNPEE K AL L+++ A+A   ++I ANDPD+DR AVAE+   G W++++GNE GAL GWW +  +K    +    D   M++STVSSK LKS+A++E F+F ETLTGFKW+GN+A     +GKTVLFAFEEAIG+M   N+LDKDGISA A+ AEM+  L   G TLT+QLAK+YE YG H++NN Y    S     ++FE++R  +G    YP  CG   ++I  IRDLTTG+ + + ++K  LP+  +++MITF F+N C  T+R SGTEPKIKYY+EI     +K   ++  KS L +++  + + F +
Sbjct:   16 ELDEKIL----EWLALDKYQPTIDEIKQLVRSRNHEELEKRLLSSLSFGTAGLRSSMGAGFSKMNDLTVIQASQGLAVYLEQTFEDIKEKGVVIGFDARHNSFRLAQRAAAVFLSRDIKVYLFSEMTPTPYVPFAVRFYRAACGVMVTASHNPKDDNGYKVYFDNGAQIRSPHDKGISKCIKENSAPWETSWDLTLPQTHPKRQDPLQETCVAYCSALKN-YSHFSDMNRETRIKFTFTPMHGVGQRFAVMAFEAFNLPPFISVKEQMNPDPEFPTVRYPNPEEGKSALDLSMKAADAGGSTVIIANDPDSDRTAVAEKQHDGRWRVLTGNETGALFGWWSFFCHKKDHPHLYPGDHVYMVASTVSSKFLKSMAKEEGFKFDETLTGFKWMGNQAYTRLQEGKTVLFAFEEAIGFMYGTNVLDKDGISAAAVMAEMATYLDRQGLTLTDQLAKLYERYGVHISNNSYYLCHSPPTIVKIFERIRALHGG--QYPSHCG--PYRISGIRDLTTGFDNTQPDNKAVLPTSKSSQMITFYFTNGCEATLRTSGTEPKIKYYTEIAGRPGEKV-DMKAAKSTLQDVVDCIIREFLE 597          
BLAST of Phosphoglucomutase vs. Ensembl Nematostella
Match: EDO27503 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T929])

HSP 1 Score: 185.267 bits (469), Expect = 1.610e-53
Identity = 101/305 (33.11%), Postives = 174/305 (57.05%), Query Frame = 2
Query:  182 NPEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKKYDFKKG--IIVGYDARYNSEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWDDIRKYVKDPL-----EELEKAYYERQFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEEKGALGLAIETANAHNISLIAANDPDADRLAVAER-FKGSWKIISGNEFGALL 1072
            N ++L  R    ++FGT G+R  +GAG   +N   + + TQGL    K+    K   + +GYD R++S+  +K+VA++     I V+LF ++ PTP L+F V       G+++TASHNP + NGYK+YW +G QI+ P DK+I D +        NS ++++I    K+ L      E+++A+++      +   N++ + N ++V+T +HG        +L + G+  +  V +Q  PD +FPTV  PNPEE  AL +A++ AN     ++   DPD+DR+ +A R   G+ K+++GN+  +++
Sbjct:    1 NSDDLADRFYKNMEFGTGGMRGIVGAGTNRINRYTLGKATQGLCNYLKEIYPNKALKVAIGYDCRHDSKWLSKVVADVLSANNIHVFLFKDLRPTPELSFAVNHLGCDVGIVLTASHNPPEYNGYKVYWNDGGQIVPPHDKKIIDKV--------NSLEFNEINFNAKENLISYIGSEIDEAFWKASL--ANGTFNVKGRENLKIVFTSLHGTSITLIPEVLKRAGYTNVHIVEEQATPDGDFPTVTSPNPEEPEALQMAVDLANKLEADIVIGTDPDSDRVGIAVRDVDGNIKLLNGNQTMSVM 295          
BLAST of Phosphoglucomutase vs. Ensembl Nematostella
Match: EDO38261 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDH5])

HSP 1 Score: 52.7582 bits (125), Expect = 3.222e-7
Identity = 103/419 (24.58%), Postives = 169/419 (40.33%), Query Frame = 2
Query:  221 KFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKKYDFKKG--IIVGYDARYNSEKWAKIVANIF--HNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDN---GYKLYWENG-------CQIIAPLDK-----EIADDIMLNLVP-DENSWKWD------DIRKYVKDPLEELEKAYYERQFNCLSRNI-NLEMKNNFRLVYTPMHGVGWEYAKRML-NKFGFNK---IVCVPQQ----VKPDPEFP-TVPFPNPEEKGALGLAIETANAHNISLIAANDPDADRLAVAERFKGSWKIISGNEFGALLGWWIWSTNKIKSENNDQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSAN 1369
            K GT+GLR  +     F          Q +L      D +KG  ++VG D R+      + +  +   +  G  V   + IV TP ++  +   +   G+++TASHNP   N   G K    NG          I  L K     +I  DI  +L      SW  D      +IR  V D +  +++ +    F+ L + +   + K    ++   MHGV   Y KR++  + G ++   + CVP +      PDP         N  +KG  GL             AA D D DR  +      +   ++ ++  A++G    S           F    S  +S  L  +A+K   +++ET TG+K+ GN  D  +     +    EE+ G   + +I +KDG+ A   +  + AN
Sbjct:   16 KPGTSGLRKPVSV---FQQTNYTENFIQAILDAIPAKD-RKGCTLVVGGDGRFFMRDAVQTIVRMAAANEIGELVIGQNGIVSTPAVSCVIRKIKAQGGIILTASHNPGGPNGDFGVKYNTSNGGPAPEGVTNHIFELTKTMSQYKICTDITADLTALGTQSWDIDGRNFTVNIRDSVDDYVALMKEIF---DFDLLKQFLGGQDGKPGMNILIDSMHGVTGPYVKRIVCGELGASESSVVNCVPLEDFGGHHPDPNLTYAADLVNIMKKGEHGLG------------AAFDGDGDRNMILGH---NGFFVTPSDSVAVIGENYKSIPYFVKTGIKGFA--RSMPTSAALDRVAQKLGIEYFETPTGWKFFGNLMDAGR-----LCLCGEESFGTGSD-HIREKDGVWAFLAWLSILAN 404          
BLAST of Phosphoglucomutase vs. Ensembl Medaka
Match: pgm2 (phosphoglucomutase 2 [Source:NCBI gene;Acc:101164775])

HSP 1 Score: 511.916 bits (1317), Expect = 7.828e-175
Identity = 280/601 (46.59%), Postives = 388/601 (64.56%), Query Frame = 2
Query:   89 EIDNRVQIEYEKWMKLDKNEKTRFEMQQLQFNP--EELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKKY--DFK-KGIIVGYDARYN------SEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWDDIRK--YVKDPLEELEKAYYER-QFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERFK-GSWKIISGNEFGALLGWWIWSTNKIKSENNDQFV-----MISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDK--LPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQ 1822
            ++D  VQ+    W++ DKN KT   ++ L  +   E LK     R++FGTAGLRA MG G + MNDL IIQTTQG     ++   D K +G+++GYDAR +      S+++A + A +F + G+PV+LFS+I PTPF+ F V+      G+MITASHNPK DNGYK+YWENG QI++P DK I+  I  NL P   SW  ++  K   +KDP +++   Y++  Q  C  R+IN   K   ++V+T +HGVG  + +     F       V +Q  PDPEFPTV +PNPEE +G L L+   A     S++ ANDPDADRLAVAE+ + G W++ SGNE GALLGWW++S    K +N D  V     M+SSTVSSKIL++IA KE F F ETLTGFKW+GN+A ++  +G TVLFAFEEAIGYMC  ++LDKDG+SA AI  EM + L     +L+++L+ IYEEYG H++ N Y      ++   +FE+LRN++G   SYP  CG  +F I  +RDLTTGY S + ++K  LP+  +++MITFTFSN C  T+R SGTEPKIKYY+E+     +    +  LK ELD+L+  + ++F++
Sbjct:   12 KLDQAVQL----WLQYDKNPKTVKMVKDLLQDGAVEALKKCFSSRMEFGTAGLRAAMGPGTSCMNDLTIIQTTQGFCCYLEQTFGDLKERGVVIGYDARAHPPSGGSSKRFASLAAAVFTSRGVPVHLFSDITPTPFVPFTVSHLSLCAGIMITASHNPKQDNGYKVYWENGAQIVSPHDKGISKAIEGNLEPWPESWNAEEALKSPLLKDPYQDVHTQYFKAIQKLCHYRDINKSSK--VKIVHTSVHGVGHSFVQSAFKAFDLPPPYAVEEQKDPDPEFPTVKYPNPEEGEGVLTLSFALAEKEGASVVLANDPDADRLAVAEKQESGLWRVFSGNELGALLGWWLFSC--WKQQNPDAAVLKKIYMLSSTVSSKILRAIALKEGFHFEETLTGFKWMGNRAKDLIDQGNTVLFAFEEAIGYMCCKSVLDKDGVSAAAIAGEMVSFLATKNKSLSQKLSAIYEEYGYHISKNSYFICHDQKVIHSLFERLRNFSGKPDSYPTECG--RFCISAVRDLTTGYDSNQPDNKAVLPTSRSSQMITFTFSNGCVATMRTSGTEPKIKYYTELCAAPGNS--DVTHLKKELDDLVEAIIENFFE 600          
BLAST of Phosphoglucomutase vs. Ensembl Medaka
Match: pgm2l1 (phosphoglucomutase 2 like 1 [Source:NCBI gene;Acc:101160636])

HSP 1 Score: 439.113 bits (1128), Expect = 3.044e-146
Identity = 235/602 (39.04%), Postives = 347/602 (57.64%), Query Frame = 2
Query:   95 DNRVQIEYEKWMKLDKNEKTRFEMQQL--QFNPEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGL---LATCKKYDFKKGIIVGYDARYNSE------KWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWK---WDD----IRKYVKDPLEELEKAYYERQFN-CLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEE-KGALGLAIETANAHNISLIAANDPDADRLAVAERF-KGSWKIISGNEFGALLGWWI---WSTNKIKSENNDQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEEN--DKLPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQ 1822
            D ++    ++W   D+N +TR +M  L      ++ + RL  R+ FGTAGLRA MGAGF  +NDL +IQ+TQGL   L  C      +G++VG+D R   E      + AK+ A +  +  +PV+LFS +VPTP++ F V       GVMITASHNPK+DNGYK+YW +G Q+ +P DKEI    +  +  ++  W    WD+          DPL  +   Y +R  + C  R  N +  +  R+V++  HGVG  + ++    FG    + VP+Q  PDP F TV  PNPEE +  L L+   A   +  ++ A DPDADRLAVAER  + SWK+ SGNE  ALLGWW+   W  N           M+++ VSSKIL+++A  E F+F ETL GFKWIGN+  E+   G  VLF+FEE+IG++C   + +KDG+S  A+ AEM+A L+  G +L +QL  IY+ YG H++   Y+  +     +R+F ++RN++G ++ YP+ CG     ++ +RD+TTGY S + +    LP   +++M+TF   N    T+R SGTEPKIK+Y+E           +  L+ EL ++ A +   F +
Sbjct:   20 DPQLDAAVQRWFCWDRNPRTRAQMDSLLDAGRLDDARSRLCGRLSFGTAGLRAPMGAGFNRINDLTVIQSTQGLHSYLRRCFPDLCSRGVVVGFDTRGQQESGCSSLRLAKLTAAVMVSRDVPVHLFSGVVPTPYVPFAVKKLGAAAGVMITASHNPKEDNGYKVYWCSGAQVASPQDKEI----LRCIEEEQEPWSASCWDEEAGQRSPLCTDPLTRVNSCYMDRLSSLCFHRAANGD--SPLRVVHSSFHGVGHAFVQQAFQVFGLAPPIPVPEQKDPDPNFSTVRCPNPEEGEPVLELSFRLAEKEDAGIVLATDPDADRLAVAERCDRCSWKVFSGNELAALLGWWMFFNWKQNGADPAEGRSIYMLATAVSSKILQALARAEGFRFEETLPGFKWIGNRIHELSRTGNRVLFSFEESIGFLCGDMVPEKDGVSTAAVVAEMAAYLHRGGLSLAQQLHIIYQTYGYHLSTTSYVICRDPPTIQRIFSRIRNFDG-AELYPKTCGG--VPVVHVRDVTTGYDSSQPDLRSTLPVTRSSQMVTFHLQNGVVATLRTSGTEPKIKFYTEFCAAPGQS--DVVALEEELQKVTAALLDEFLE 610          
BLAST of Phosphoglucomutase vs. Ensembl Medaka
Match: pgm1 (phosphoglucomutase 1 [Source:NCBI gene;Acc:101175638])

HSP 1 Score: 49.6766 bits (117), Expect = 7.739e-6
Identity = 117/533 (21.95%), Postives = 222/533 (41.65%), Query Frame = 2
Query:  221 KFGTAGLRARMGAGFAFMNDLIIIQT-TQGLLATCKKYDFKKG-IIVGYDARYNSEKWAKIVANIFHNAGIPVYLFS--NIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNG---YKLYWENGCQIIAPLDKEIADDIM--------LNLVPD---------ENSWKWDDIRKYVKDPLEELEKAYYER-----QFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRM----LNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEEKGALGLAIETANAHNISLIAANDPDADRLAVAERFKGSWKIISGNEFGALLGWWIWSTNKIKSENNDQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSY-PEFCG-----DEKFKIIKIRDLTTGYYSYEENDKLPSDLA-NEMITFTFSNNCTLTIRASGT 1699
            K GT+GLR R+     F  +    +   Q +++     + +   ++VG D R+  +   +++  I    GI   +     I+ TP ++  +   + + G+++TASHNP   NG    K    +G     P  + I + I          ++ PD         + +++ +  + ++ + ++ +E AY E       F  L +N+ L   N+  +    MHGV   Y +++    L     + + CVPQ+     +F     P+P    A  L + T  +      AA D D DR  V  +       ++ ++  A +   I S    K        +  S  +S  L ++A+  + + YET TG+K+ GN  D     GK  L   EE+ G   + +I +KDG+   A+ A +S  L     ++ E +   ++ +G +       +   S+   +M + L      +Q + P F G      +K  ++ + D      ++   D +   ++ N+ +   FS+   +  R SGT
Sbjct:   16 KPGTSGLRKRV---TVFQQNQHYAENFIQSIISVVDPAERQAATLVVGGDGRFFMKDAIQLIVQIAAANGINHLVIGQNGIMSTPAVSCVIRKIKAVGGIILTASHNPGGPNGDFGIKYNISSG----GPAPEGITNKIFEISKALQEYHICPDLKVDLSKIGKQTFEVETFKPFIVEIVDSVE-AYAEMLRDIFDFPAL-KNL-LSGPNHINVRLDAMHGVVGPYIRKIVCEELGSPANSAVNCVPQE-----DFGG-HHPDPNLTYAADL-VNTMKSGEYDFGAAFDGDGDRNMVLGK---HGFFVNPSDSVAAIAANITSIPYFKKTGVKG--LARSMPTSGALDNVAKALQMELYETPTGWKFFGNLMD----AGKLSLCG-EESFGTGSD-HIREKDGL--WAVLAWLSI-LATRKQSVEEIMKNHWQTFGRNFFTRYDYEEVDSDAANKMIKDLE-----AQMFEPSFVGKTFSSGDKSYVVAVAD------NFAYTDPVDGSVSKNQGLRIIFSDGSRIIFRLSGT 506          
BLAST of Phosphoglucomutase vs. Planmine SMEST
Match: SMESG000069481.1 (SMESG000069481.1)

HSP 1 Score: 1215.68 bits (3144), Expect = 0.000e+0
Identity = 586/587 (99.83%), Postives = 586/587 (99.83%), Query Frame = 2
Query:   86 MEIDNRVQIEYEKWMKLDKNEKTRFEMQQLQFNPEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKKYDFKKGIIVGYDARYNSEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWDDIRKYVKDPLEELEKAYYERQFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEEKGALGLAIETANAHNISLIAANDPDADRLAVAERFKGSWKIISGNEFGALLGWWIWSTNKIKSENNDQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDKLPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQKDIFGFTE 1846
            MEIDNRVQIEYEKWMKLDKNEKTRFEMQQLQFNPEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKKYDFKKGIIVGYDARYNSEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWDDIRKYVKDPLEELEKAYYERQFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEEKGALGLAIETANAHNISLIAANDPDADRLAVAERFKGSWKIISGNEFGALLGWWIWSTNKIKSENNDQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYG HVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDKLPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQKDIFGFTE
Sbjct:    1 MEIDNRVQIEYEKWMKLDKNEKTRFEMQQLQFNPEELKLRLIDRIKFGTAGLRARMGAGFAFMNDLIIIQTTQGLLATCKKYDFKKGIIVGYDARYNSEKWAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPKDDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWDDIRKYVKDPLEELEKAYYERQFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKFGFNKIVCVPQQVKPDPEFPTVPFPNPEEKGALGLAIETANAHNISLIAANDPDADRLAVAERFKGSWKIISGNEFGALLGWWIWSTNKIKSENNDQFVMISSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEEAIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGYHVNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLTTGYYSYEENDKLPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQNHNDKSRSIEGLKSELDELIANVKKHFYQKDIFGFTE 587          
The following BLAST results are available for this feature:
BLAST of Phosphoglucomutase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PGM23.728e-17547.07phosphoglucomutase 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
PGM2L13.838e-16344.05phosphoglucomutase 2 like 1 [Source:HGNC Symbol;Ac... [more]
PGM24.520e-2645.59phosphoglucomutase 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
PGM24.520e-2645.59phosphoglucomutase 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
PGM24.520e-2645.59phosphoglucomutase 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Phosphoglucomutase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Y43F4B.54.321e-14340.88pep chromosome:WBcel235:III:13299378:13302760:1 ge... [more]
Y43F4B.51.519e-7342.09pep chromosome:WBcel235:III:13299378:13302750:1 ge... [more]
back to top
BLAST of Phosphoglucomutase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Pgm2a6.029e-16444.15gene:FBgn0033377 transcript:FBtr0088630[more]
Pgm2b3.157e-13337.50gene:FBgn0033969 transcript:FBtr0087464[more]
back to top
BLAST of Phosphoglucomutase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pgm23.846e-17445.79phosphoglucomutase 2 [Source:ZFIN;Acc:ZDB-GENE-040... [more]
pgm2l11.980e-15944.14phosphoglucomutase 2-like 1 [Source:ZFIN;Acc:ZDB-G... [more]
pgm2l11.452e-13043.18phosphoglucomutase 2-like 1 [Source:ZFIN;Acc:ZDB-G... [more]
pgm12.671e-723.70phosphoglucomutase 1 [Source:ZFIN;Acc:ZDB-GENE-040... [more]
back to top
BLAST of Phosphoglucomutase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actn37.234e-17146.08actinin alpha 3 (gene/pseudogene) [Source:Xenbase;... [more]
actn32.514e-16846.58actinin alpha 3 (gene/pseudogene) [Source:Xenbase;... [more]
actn36.313e-16846.58actinin alpha 3 (gene/pseudogene) [Source:Xenbase;... [more]
actn37.569e-16846.58actinin alpha 3 (gene/pseudogene) [Source:Xenbase;... [more]
actn39.836e-16847.17actinin alpha 3 (gene/pseudogene) [Source:Xenbase;... [more]
back to top
BLAST of Phosphoglucomutase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pgm21.413e-17346.17phosphoglucomutase 2 [Source:MGI Symbol;Acc:MGI:97... [more]
Pgm2l19.534e-16445.44phosphoglucomutase 2-like 1 [Source:MGI Symbol;Acc... [more]
Pgm2l19.534e-16445.44phosphoglucomutase 2-like 1 [Source:MGI Symbol;Acc... [more]
Pgm2l18.554e-5044.55phosphoglucomutase 2-like 1 [Source:MGI Symbol;Acc... [more]
Pgm21.668e-1460.38phosphoglucomutase 2 [Source:MGI Symbol;Acc:MGI:97... [more]
back to top
BLAST of Phosphoglucomutase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96G03|PGM2_HUMAN1.790e-17447.07Phosphoglucomutase-2 OS=Homo sapiens OX=9606 GN=PG... [more]
sp|Q7TSV4|PGM2_MOUSE9.884e-17346.17Phosphoglucomutase-2 OS=Mus musculus OX=10090 GN=P... [more]
sp|Q5RFI8|PGM2_PONAB1.956e-17246.73Phosphoglucomutase-2 OS=Pongo abelii OX=9601 GN=PG... [more]
sp|Q8CAA7|PGM2L_MOUSE6.669e-16345.44Glucose 1,6-bisphosphate synthase OS=Mus musculus ... [more]
sp|Q6PCE3|PGM2L_HUMAN1.843e-16244.05Glucose 1,6-bisphosphate synthase OS=Homo sapiens ... [more]
back to top
BLAST of Phosphoglucomutase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3WI020.000e+050.84Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A564YSH40.000e+049.83Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A068YF100.000e+051.00Phosphoglucomutase 2 OS=Echinococcus multiloculari... [more]
A0A068WZL70.000e+050.84Phosphoglucomutase 2 OS=Echinococcus granulosus OX... [more]
A0A3Q0KIP80.000e+050.83Putative phosphoglucomutase OS=Schistosoma mansoni... [more]
back to top
BLAST of Phosphoglucomutase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pgm24.083e-15141.64phosphoglucomutase 2 [Source:ZFIN;Acc:ZDB-GENE-040... [more]
pgm2l13.234e-15043.56phosphoglucomutase 2 like 1 [Source:NCBI gene;Acc:... [more]
pgm2l18.574e-14644.06phosphoglucomutase 2 like 1 [Source:NCBI gene;Acc:... [more]
pgm2l13.731e-13340.85phosphoglucomutase 2 like 1 [Source:NCBI gene;Acc:... [more]
pgm13.048e-822.18phosphoglucomutase 1 [Source:NCBI gene;Acc:1030384... [more]
back to top
BLAST of Phosphoglucomutase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pgm21.127e-14747.15phosphoglucomutase 2 [Source:ZFIN;Acc:ZDB-GENE-040... [more]
back to top
BLAST of Phosphoglucomutase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PRM156.871e-12340.74Phosphoribomutase; catalyzes interconversion of ri... [more]
PGM21.781e-921.59Phosphoglucomutase; catalyzes the conversion from ... [more]
PGM12.057e-821.18Phosphoglucomutase, minor isoform; catalyzes the c... [more]
back to top
BLAST of Phosphoglucomutase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO444861.487e-17346.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO275031.610e-5333.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382613.222e-724.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphoglucomutase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pgm27.828e-17546.59phosphoglucomutase 2 [Source:NCBI gene;Acc:1011647... [more]
pgm2l13.044e-14639.04phosphoglucomutase 2 like 1 [Source:NCBI gene;Acc:... [more]
pgm17.739e-621.95phosphoglucomutase 1 [Source:NCBI gene;Acc:1011756... [more]
back to top
BLAST of Phosphoglucomutase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000069481.10.000e+099.83SMESG000069481.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001788 ID=SMED30001788|Name=Phosphoglucomutase|organism=Schmidtea mediterranea sexual|type=transcript|length=1948bp
AAATATGTTTTAAACTTAATTATTGCTTTTGTTTATATAAATTACATAAC
TTTAATAAATATTCTTATTTTTTAAATATATTGTTATGGAAATTGATAAT
CGAGTACAAATTGAATATGAAAAGTGGATGAAATTAGATAAAAATGAAAA
AACAAGGTTTGAAATGCAACAGCTTCAATTCAATCCAGAAGAATTGAAAC
TTAGGTTAATAGATCGTATTAAATTTGGCACTGCAGGACTACGTGCCAGA
ATGGGAGCAGGATTCGCTTTTATGAACGATTTGATTATAATACAAACCAC
GCAAGGGTTGTTAGCGACTTGCAAAAAGTATGATTTTAAAAAAGGAATTA
TTGTTGGATATGACGCTAGGTACAATAGCGAAAAGTGGGCCAAGATTGTC
GCTAATATTTTTCATAATGCTGGAATTCCTGTGTATTTATTTTCAAATAT
TGTTCCAACTCCTTTTTTGGCTTTTGGAGTAACGTTTTGTCAAACTCTAT
GTGGCGTTATGATTACAGCGTCACATAATCCTAAAGACGACAATGGATAT
AAGTTATATTGGGAAAACGGCTGCCAAATCATCGCACCTCTTGATAAAGA
AATTGCTGATGATATTATGTTAAATCTCGTTCCTGATGAAAATTCATGGA
AATGGGATGATATTAGGAAATATGTTAAAGATCCTTTAGAAGAATTAGAA
AAGGCCTATTATGAAAGACAATTTAACTGTTTAAGTCGAAATATAAATTT
AGAAATGAAGAATAATTTCCGATTGGTATACACTCCAATGCACGGAGTCG
GTTGGGAATATGCCAAAAGAATGCTGAATAAATTTGGATTTAATAAAATA
GTCTGCGTTCCACAGCAAGTGAAACCTGATCCGGAATTTCCAACTGTTCC
TTTTCCAAATCCTGAAGAAAAAGGCGCTCTTGGCTTGGCAATCGAAACCG
CTAATGCTCATAATATTTCGTTAATTGCTGCAAATGATCCGGATGCTGAC
CGGCTCGCGGTTGCTGAGCGTTTCAAAGGTTCTTGGAAAATTATAAGTGG
TAATGAATTTGGAGCACTTTTAGGCTGGTGGATATGGTCAACAAATAAAA
TTAAATCGGAAAATAACGATCAATTTGTGATGATTAGTAGCACTGTTAGT
TCGAAAATTTTAAAATCCATTGCAGAGAAAGAAAAATTTCAATTTTATGA
AACTTTAACTGGATTTAAATGGATTGGGAACAAAGCCGATGAAATGAAGC
ACAAAGGAAAGACTGTTTTATTTGCGTTTGAAGAGGCAATAGGGTACATG
TGTAATTGTAACATTTTGGATAAAGACGGAATAAGCGCATTGGCAATATT
TGCTGAAATGAGTGCAAATCTCTACGCAAACGGATGCACTTTAACAGAGC
AATTAGCCAAAATTTATGAAGAATATGGTTGTCATGTTAATAATAATGGA
TATTTAAAGTCAAAGTCTAGTGAATTGACAAAGCGGATGTTTGAAAAGTT
GAGAAACTGGAACGGTAGCAGTCAAAGTTACCCCGAGTTTTGTGGAGATG
AAAAATTTAAAATAATCAAGATTCGTGATTTAACAACTGGATATTATTCT
TATGAAGAAAATGACAAGCTACCGTCCGACTTAGCCAATGAAATGATAAC
ATTCACATTTAGTAATAATTGTACATTGACTATTCGTGCCAGCGGAACTG
AACCAAAAATTAAATATTATTCTGAAATAGTTCAAAATCACAACGACAAA
AGTCGTTCAATTGAAGGCCTGAAATCAGAGCTGGATGAATTAATAGCAAA
TGTTAAGAAGCATTTCTATCAAAAAGACATATTTGGTTTTACTGAATAAA
AAACAAAAGTTATTTGAGTTTTTTCTAGGATTTTGTCTATGATTTTTTTG
TACTGATATTAAATACATTGGGTTTAGTTTCTTTTAGATTTAAAAAAA
back to top

protein sequence of SMED30001788-orf-1

>SMED30001788-orf-1 ID=SMED30001788-orf-1|Name=SMED30001788-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=588bp
MEIDNRVQIEYEKWMKLDKNEKTRFEMQQLQFNPEELKLRLIDRIKFGTA
GLRARMGAGFAFMNDLIIIQTTQGLLATCKKYDFKKGIIVGYDARYNSEK
WAKIVANIFHNAGIPVYLFSNIVPTPFLAFGVTFCQTLCGVMITASHNPK
DDNGYKLYWENGCQIIAPLDKEIADDIMLNLVPDENSWKWDDIRKYVKDP
LEELEKAYYERQFNCLSRNINLEMKNNFRLVYTPMHGVGWEYAKRMLNKF
GFNKIVCVPQQVKPDPEFPTVPFPNPEEKGALGLAIETANAHNISLIAAN
DPDADRLAVAERFKGSWKIISGNEFGALLGWWIWSTNKIKSENNDQFVMI
SSTVSSKILKSIAEKEKFQFYETLTGFKWIGNKADEMKHKGKTVLFAFEE
AIGYMCNCNILDKDGISALAIFAEMSANLYANGCTLTEQLAKIYEEYGCH
VNNNGYLKSKSSELTKRMFEKLRNWNGSSQSYPEFCGDEKFKIIKIRDLT
TGYYSYEENDKLPSDLANEMITFTFSNNCTLTIRASGTEPKIKYYSEIVQ
NHNDKSRSIEGLKSELDELIANVKKHFYQKDIFGFTE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036900A-D-PHexomutase_C_sf
IPR005841Alpha-D-phosphohexomutase_SF
IPR016055A-D-PHexomutase_a/b/a-I/II/III
IPR005845A-D-PHexomutase_a/b/a-II
IPR005846A-D-PHexomutase_a/b/a-III
IPR005843A-D-PHexomutase_C
IPR005844A-D-PHexomutase_a/b/a-I
IPR016066A-D-PHexomutase_CS
IPR008470Uncharacterised_Ycf33
Vocabulary: molecular function
TermDefinition
GO:0016868intramolecular transferase activity, phosphotransferases
GO:0000287magnesium ion binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
GO:0071704organic substance metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 552..572
NoneNo IPR availableGENE3DG3DSA:3.40.120.10coord: 322..448
e-value: 1.3E-34
score: 120.7
NoneNo IPR availableGENE3DG3DSA:3.40.120.10coord: 37..191
e-value: 1.4E-45
score: 156.6
NoneNo IPR availableGENE3DG3DSA:3.40.120.10coord: 206..321
e-value: 2.0E-21
score: 78.1
NoneNo IPR availablePANTHERPTHR45745FAMILY NOT NAMEDcoord: 4..579
NoneNo IPR availableCDDcd05799PGM2coord: 44..571
e-value: 0.0
score: 644.175
IPR005841Alpha-D-phosphohexomutase superfamilyPRINTSPR00509PGMPMMcoord: 139..153
score: 54.44
coord: 227..246
score: 21.56
coord: 294..309
score: 37.76
IPR005844Alpha-D-phosphohexomutase, alpha/beta/alpha domain IPFAMPF02878PGM_PMM_Icoord: 45..177
e-value: 3.4E-35
score: 120.8
IPR005845Alpha-D-phosphohexomutase, alpha/beta/alpha domain IIPFAMPF02879PGM_PMM_IIcoord: 220..311
e-value: 5.3E-24
score: 84.8
IPR005846Alpha-D-phosphohexomutase, alpha/beta/alpha domain IIIPFAMPF02880PGM_PMM_IIIcoord: 323..447
e-value: 3.2E-15
score: 56.3
IPR016066Alpha-D-phosphohexomutase, conserved sitePROSITEPS00710PGM_PMMcoord: 140..149
IPR016055Alpha-D-phosphohexomutase, alpha/beta/alpha I/II/IIISUPERFAMILYSSF53738Phosphoglucomutase, first 3 domainscoord: 302..450
IPR016055Alpha-D-phosphohexomutase, alpha/beta/alpha I/II/IIISUPERFAMILYSSF53738Phosphoglucomutase, first 3 domainscoord: 32..234
IPR016055Alpha-D-phosphohexomutase, alpha/beta/alpha I/II/IIISUPERFAMILYSSF53738Phosphoglucomutase, first 3 domainscoord: 207..310
IPR036900Alpha-D-phosphohexomutase, C-terminal domain superfamilySUPERFAMILYSSF55957Phosphoglucomutase, C-terminal domaincoord: 457..555