Nuclear receptor 2DBD gamma

Overview
NameNuclear receptor 2DBD gamma
Smed IDSMED30001785
Length (bp)2370
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nuclear receptor 2DBD gamma (SMED30001785) t-SNE clustered cells

Violin plots show distribution of expression levels for Nuclear receptor 2DBD gamma (SMED30001785) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nuclear receptor 2DBD gamma (SMED30001785) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nuclear receptor 2DBD gamma (SMED30001785) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Human
Match: RORA (RAR related orphan receptor A [Source:HGNC Symbol;Acc:HGNC:10258])

HSP 1 Score: 94.3597 bits (233), Expect = 1.449e-19
Identity = 43/95 (45.26%), Postives = 63/95 (66.32%), Query Frame = 1
Query:  355 MKFFGLRSNKSKIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGR 639
            M +F + + K++I+I  IPC++CG KSSG H+G +TCEGCKGFFRR++       C   K NC+ID + +  C+ CR  +C+ VGMS+   + GR
Sbjct:    1 MMYFVIAAMKAQIEI--IPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQK-NCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGR 92          

HSP 2 Score: 63.929 bits (154), Expect = 6.037e-10
Identity = 33/83 (39.76%), Postives = 47/83 (56.63%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVC--KKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            C++C   ++G H+G   CE CK FF+R  + Q N+   C  +KNC +++  R +C  CR QKCL VGM      FG  S K +
Sbjct:   18 CKICGDKSSGIHYGVITCEGCKGFFRR--SQQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQR 98          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Human
Match: PPARG (peroxisome proliferator activated receptor gamma [Source:HGNC Symbol;Acc:HGNC:9236])

HSP 1 Score: 92.8189 bits (229), Expect = 1.491e-19
Identity = 72/256 (28.12%), Postives = 115/256 (44.92%), Query Frame = 1
Query:  406 IPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSSPSTLDIPYHEISSRISESNSD-GNQRSISYS-----IPSTPVPXXXXXXXXXXPDGHSQAFCSKLIEAIKILQKPLLEAEKLFHMTRFPVHRNQSLLEVWNS-MMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEED 1152
            I CRVCG K+SGFH+G   CEGCKGFFRR   ++ KL      LNC I    +  C++CR+ +C+ VGMS    R GR P A K                         EISS I + N +  + R+++       I S P+    + +  +        F    + ++ + +  +    K  H+T       +  + ++     R  +    I  Y AK +PGF +L L+D+ T+++  ++ I+   LA    +D
Sbjct:    3 IECRVCGDKASGFHYGVHACEGCKGFFRRT--IRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKL--------------------LAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKI----KFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEY-AKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKD 231          

HSP 2 Score: 69.3218 bits (168), Expect = 7.595e-12
Identity = 33/75 (44.00%), Postives = 45/75 (60.00%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVV---CKKNCDLEKIGRRKCSFCRYQKCLNVGMKFFGLR 375
            C+VC   A+GFH+G + CE CK FF+R     +  K++   C  NC + K  R KC +CR+QKCL VGM    +R
Sbjct:    5 CRVCGDKASGFHYGVHACEGCKGFFRR----TIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIR 75          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Human
Match: PPARG (peroxisome proliferator activated receptor gamma [Source:HGNC Symbol;Acc:HGNC:9236])

HSP 1 Score: 92.0485 bits (227), Expect = 3.545e-19
Identity = 71/250 (28.40%), Postives = 115/250 (46.00%), Query Frame = 1
Query:  406 IPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSSPSTLDIPYHEISSRISESNSDGNQRSISYSIPSTPVPXXXXXXXXXXPDGHSQAFCSKLIEAIKILQKPLLEAEKLFHMTRFPVHRNQSLLEVWNS-MMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEED 1152
            I CRVCG K+SGFH+G   CEGCKGFFRR   ++ KL      LNC I    +  C++CR+ +C+ VGMS    R GR P A K     EI          S +D    +++   ++  +       SY I S P+    + +  +        F    + ++ + +  +    K  H+T       +  + ++     R  +    I  Y AK +PGF +L L+D+ T+++  ++ I+   LA    +D
Sbjct:  107 IECRVCGDKASGFHYGVHACEGCKGFFRRT--IRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEI---------SSDID----QLNPESADLRALAKHLYDSY-IKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKI----KFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEY-AKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKD 335          

HSP 2 Score: 70.0922 bits (170), Expect = 5.059e-12
Identity = 33/75 (44.00%), Postives = 45/75 (60.00%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVV---CKKNCDLEKIGRRKCSFCRYQKCLNVGMKFFGLR 375
            C+VC   A+GFH+G + CE CK FF+R     +  K++   C  NC + K  R KC +CR+QKCL VGM    +R
Sbjct:  109 CRVCGDKASGFHYGVHACEGCKGFFRR----TIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIR 179          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Human
Match: PPARG (peroxisome proliferator activated receptor gamma [Source:HGNC Symbol;Acc:HGNC:9236])

HSP 1 Score: 88.5817 bits (218), Expect = 7.034e-19
Identity = 44/91 (48.35%), Postives = 54/91 (59.34%), Query Frame = 1
Query:  406 IPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEI 678
            I CRVCG K+SGFH+G   CEGCKGFFRR   ++ KL      LNC I    +  C++CR+ +C+ VGMS    R GR P A K     EI
Sbjct:  109 IECRVCGDKASGFHYGVHACEGCKGFFRRT--IRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEI 197          

HSP 2 Score: 70.0922 bits (170), Expect = 1.424e-12
Identity = 33/75 (44.00%), Postives = 45/75 (60.00%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVV---CKKNCDLEKIGRRKCSFCRYQKCLNVGMKFFGLR 375
            C+VC   A+GFH+G + CE CK FF+R     +  K++   C  NC + K  R KC +CR+QKCL VGM    +R
Sbjct:  111 CRVCGDKASGFHYGVHACEGCKGFFRR----TIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIR 181          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Human
Match: PPARG (peroxisome proliferator activated receptor gamma [Source:HGNC Symbol;Acc:HGNC:9236])

HSP 1 Score: 88.5817 bits (218), Expect = 7.295e-19
Identity = 44/91 (48.35%), Postives = 54/91 (59.34%), Query Frame = 1
Query:  406 IPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEI 678
            I CRVCG K+SGFH+G   CEGCKGFFRR   ++ KL      LNC I    +  C++CR+ +C+ VGMS    R GR P A K     EI
Sbjct:  107 IECRVCGDKASGFHYGVHACEGCKGFFRRT--IRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEI 195          

HSP 2 Score: 69.707 bits (169), Expect = 1.475e-12
Identity = 33/75 (44.00%), Postives = 45/75 (60.00%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVV---CKKNCDLEKIGRRKCSFCRYQKCLNVGMKFFGLR 375
            C+VC   A+GFH+G + CE CK FF+R     +  K++   C  NC + K  R KC +CR+QKCL VGM    +R
Sbjct:  109 CRVCGDKASGFHYGVHACEGCKGFFRR----TIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIR 179          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Celegans
Match: nhr-23 (Nuclear hormone receptor family member nhr-23 [Source:UniProtKB/Swiss-Prot;Acc:P41828])

HSP 1 Score: 97.0561 bits (240), Expect = 1.082e-20
Identity = 47/98 (47.96%), Postives = 64/98 (65.31%), Query Frame = 1
Query:  355 MKFFGLRSNKSKI---DISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGR 639
            M F GL  NKS +    I  IPC+VCG KSSG H+G +TCEGCKGFFRR++      +C   K NCV+D  ++  C++CR  +CI++GMS+   + GR
Sbjct:  106 MSFRGLPENKSLLVSAQIEVIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSIVNYQCPRQK-NCVVDRVNRNRCQYCRLKKCIELGMSRDAVKFGR 202          

HSP 2 Score: 69.3218 bits (168), Expect = 6.014e-12
Identity = 37/122 (30.33%), Postives = 65/122 (53.28%), Query Frame = 1
Query:   40 LDKNKVQSVILKTNTMLNNATFSS-PESAFYEYQIKMENQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            +D N+V         + +N +F   PE+       ++E   C+VC   ++G H+G   CE CK FF+R  ++ +N +   +KNC ++++ R +C +CR +KC+ +GM      FG  S K +
Sbjct:   91 IDTNRVD----MAGILPDNMSFRGLPENKSLLVSAQIEVIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSIVNYQCPRQKNCVVDRVNRNRCQYCRLKKCIELGMSRDAVKFGRMSKKQR 208          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Celegans
Match: nhr-23 (Nuclear hormone receptor family member nhr-23 [Source:UniProtKB/Swiss-Prot;Acc:P41828])

HSP 1 Score: 97.0561 bits (240), Expect = 1.102e-20
Identity = 47/98 (47.96%), Postives = 64/98 (65.31%), Query Frame = 1
Query:  355 MKFFGLRSNKSKI---DISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGR 639
            M F GL  NKS +    I  IPC+VCG KSSG H+G +TCEGCKGFFRR++      +C   K NCV+D  ++  C++CR  +CI++GMS+   + GR
Sbjct:  106 MSFRGLPENKSLLVSAQIEVIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSIVNYQCPRQK-NCVVDRVNRNRCQYCRLKKCIELGMSRDAVKFGR 202          

HSP 2 Score: 69.3218 bits (168), Expect = 6.257e-12
Identity = 37/122 (30.33%), Postives = 65/122 (53.28%), Query Frame = 1
Query:   40 LDKNKVQSVILKTNTMLNNATFSS-PESAFYEYQIKMENQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            +D N+V         + +N +F   PE+       ++E   C+VC   ++G H+G   CE CK FF+R  ++ +N +   +KNC ++++ R +C +CR +KC+ +GM      FG  S K +
Sbjct:   91 IDTNRVD----MAGILPDNMSFRGLPENKSLLVSAQIEVIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSIVNYQCPRQKNCVVDRVNRNRCQYCRLKKCIELGMSRDAVKFGRMSKKQR 208          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Celegans
Match: nhr-23 (Nuclear hormone receptor family member nhr-23 [Source:UniProtKB/Swiss-Prot;Acc:P41828])

HSP 1 Score: 97.0561 bits (240), Expect = 1.358e-20
Identity = 47/98 (47.96%), Postives = 64/98 (65.31%), Query Frame = 1
Query:  355 MKFFGLRSNKSKI---DISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGR 639
            M F GL  NKS +    I  IPC+VCG KSSG H+G +TCEGCKGFFRR++      +C   K NCV+D  ++  C++CR  +CI++GMS+   + GR
Sbjct:  141 MSFRGLPENKSLLVSAQIEVIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSIVNYQCPRQK-NCVVDRVNRNRCQYCRLKKCIELGMSRDAVKFGR 237          

HSP 2 Score: 69.3218 bits (168), Expect = 5.780e-12
Identity = 37/122 (30.33%), Postives = 65/122 (53.28%), Query Frame = 1
Query:   40 LDKNKVQSVILKTNTMLNNATFSS-PESAFYEYQIKMENQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            +D N+V         + +N +F   PE+       ++E   C+VC   ++G H+G   CE CK FF+R  ++ +N +   +KNC ++++ R +C +CR +KC+ +GM      FG  S K +
Sbjct:  126 IDTNRVD----MAGILPDNMSFRGLPENKSLLVSAQIEVIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSIVNYQCPRQKNCVVDRVNRNRCQYCRLKKCIELGMSRDAVKFGRMSKKQR 243          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Celegans
Match: nhr-23 (Nuclear hormone receptor family member nhr-23 [Source:UniProtKB/Swiss-Prot;Acc:P41828])

HSP 1 Score: 90.5077 bits (223), Expect = 7.216e-19
Identity = 40/81 (49.38%), Postives = 56/81 (69.14%), Query Frame = 1
Query:  397 ISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGR 639
            I  IPC+VCG KSSG H+G +TCEGCKGFFRR++      +C   K NCV+D  ++  C++CR  +CI++GMS+   + GR
Sbjct:    7 IEVIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSIVNYQCPRQK-NCVVDRVNRNRCQYCRLKKCIELGMSRDAVKFGR 86          

HSP 2 Score: 67.3958 bits (163), Expect = 2.020e-11
Identity = 29/81 (35.80%), Postives = 49/81 (60.49%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            C+VC   ++G H+G   CE CK FF+R  ++ +N +   +KNC ++++ R +C +CR +KC+ +GM      FG  S K +
Sbjct:   12 CKVCGDKSSGVHYGVITCEGCKGFFRRSQSSIVNYQCPRQKNCVVDRVNRNRCQYCRLKKCIELGMSRDAVKFGRMSKKQR 92          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Celegans
Match: nhr-23 (Nuclear hormone receptor family member nhr-23 [Source:UniProtKB/Swiss-Prot;Acc:P41828])

HSP 1 Score: 90.5077 bits (223), Expect = 7.637e-19
Identity = 40/81 (49.38%), Postives = 56/81 (69.14%), Query Frame = 1
Query:  397 ISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGR 639
            I  IPC+VCG KSSG H+G +TCEGCKGFFRR++      +C   K NCV+D  ++  C++CR  +CI++GMS+   + GR
Sbjct:    7 IEVIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSIVNYQCPRQK-NCVVDRVNRNRCQYCRLKKCIELGMSRDAVKFGR 86          

HSP 2 Score: 67.0106 bits (162), Expect = 2.060e-11
Identity = 29/81 (35.80%), Postives = 49/81 (60.49%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            C+VC   ++G H+G   CE CK FF+R  ++ +N +   +KNC ++++ R +C +CR +KC+ +GM      FG  S K +
Sbjct:   12 CKVCGDKSSGVHYGVITCEGCKGFFRRSQSSIVNYQCPRQKNCVVDRVNRNRCQYCRLKKCIELGMSRDAVKFGRMSKKQR 92          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Fly
Match: Hr3 (gene:FBgn0000448 transcript:FBtr0112799)

HSP 1 Score: 98.5969 bits (244), Expect = 2.251e-21
Identity = 75/293 (25.60%), Postives = 130/293 (44.37%), Query Frame = 1
Query:  382 KSKIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNR---------------NSSPSTLDIPYHEISSRISESNSD-GNQRSISYSIPSTPVPXXXXXXXXXXPDGHSQAFCSKLIEAI----------KILQKPLLEA---------------EKLFHMTRFPVHRNQSLLEVWNSMMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLAR 1137
            +++I+I  IPC+VCG KSSG H+G +TCEGCKGFFRR++      +C   K  CV+D  ++  C++CR  +C+K+GMS+   + GR     +     E+  ++ +                 +PS+ D  +H   +    SN++ G      YS   TP  +      +   D  +    S +I+             +L K L EA                K   ++R   ++N    E+W             ++ FAK +PGF  LS  D+  +++   + + ++ ++R
Sbjct:   14 RAQIEI--IPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSVVNYQCPRNK-QCVVDRVNRNRCQYCRLQKCLKLGMSRDAVKFGRMSKKQREKVEDEVRFHRAQMRAQSDAAPDSSVYDTQTPSSSDQLHHNNYNSGGYSNNEVGYGSPYGYSASVTPQQTMQYDISADYVDSTTYEPRSTIIDPEFISHADGDINDVLIKTLAEAHANTNTKLEAVHDMFRKQPDVSRILYYKNLGQEELWLDCAEKLTQMIQNIIEFAKLIPGFMRLSQDDQILLLKTGSFELAIVRMSR 303          

HSP 2 Score: 67.3958 bits (163), Expect = 2.666e-11
Identity = 30/81 (37.04%), Postives = 47/81 (58.02%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            C+VC   ++G H+G   CE CK FF+R  ++ +N +    K C ++++ R +C +CR QKCL +GM      FG  S K +
Sbjct:   22 CKVCGDKSSGVHYGVITCEGCKGFFRRSQSSVVNYQCPRNKQCVVDRVNRNRCQYCRLQKCLKLGMSRDAVKFGRMSKKQR 102          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Fly
Match: Hr3 (gene:FBgn0000448 transcript:FBtr0088368)

HSP 1 Score: 98.5969 bits (244), Expect = 2.658e-21
Identity = 76/295 (25.76%), Postives = 129/295 (43.73%), Query Frame = 1
Query:  382 KSKIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNR---------------NSSPSTLDIPYHEISSRIS---ESNSDGNQRSISYSIPSTPVPXXXXXXXXXXPDGHSQAFCSKLIEAI----------KILQKPLLEA---------------EKLFHMTRFPVHRNQSLLEVWNSMMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLAR 1137
            K++I+I  IPC+VCG KSSG H+G +TCEGCKGFFRR++      +C   K  CV+D  ++  C++CR  +C+K+GMS+   + GR     +     E+  ++ +                 +PS+ D  +H   +  S    +N  G      YS   TP  +      +   D  +    S +I+             +L K L EA                K   ++R   ++N    E+W             ++ FAK +PGF  LS  D+  +++   + + ++ ++R
Sbjct:   43 KAQIEI--IPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSVVNYQCPRNK-QCVVDRVNRNRCQYCRLQKCLKLGMSRDAVKFGRMSKKQREKVEDEVRFHRAQMRAQSDAAPDSSVYDTQTPSSSDQLHHNNYNSYSGGYSNNEVGYGSPYGYSASVTPQQTMQYDISADYVDSTTYEPRSTIIDPEFISHADGDINDVLIKTLAEAHANTNTKLEAVHDMFRKQPDVSRILYYKNLGQEELWLDCAEKLTQMIQNIIEFAKLIPGFMRLSQDDQILLLKTGSFELAIVRMSR 334          

HSP 2 Score: 67.0106 bits (162), Expect = 3.121e-11
Identity = 30/81 (37.04%), Postives = 47/81 (58.02%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            C+VC   ++G H+G   CE CK FF+R  ++ +N +    K C ++++ R +C +CR QKCL +GM      FG  S K +
Sbjct:   51 CKVCGDKSSGVHYGVITCEGCKGFFRRSQSSVVNYQCPRNKQCVVDRVNRNRCQYCRLQKCLKLGMSRDAVKFGRMSKKQR 131          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Fly
Match: Hr3 (gene:FBgn0000448 transcript:FBtr0306345)

HSP 1 Score: 98.5969 bits (244), Expect = 2.658e-21
Identity = 76/295 (25.76%), Postives = 129/295 (43.73%), Query Frame = 1
Query:  382 KSKIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNR---------------NSSPSTLDIPYHEISSRIS---ESNSDGNQRSISYSIPSTPVPXXXXXXXXXXPDGHSQAFCSKLIEAI----------KILQKPLLEA---------------EKLFHMTRFPVHRNQSLLEVWNSMMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLAR 1137
            K++I+I  IPC+VCG KSSG H+G +TCEGCKGFFRR++      +C   K  CV+D  ++  C++CR  +C+K+GMS+   + GR     +     E+  ++ +                 +PS+ D  +H   +  S    +N  G      YS   TP  +      +   D  +    S +I+             +L K L EA                K   ++R   ++N    E+W             ++ FAK +PGF  LS  D+  +++   + + ++ ++R
Sbjct:   43 KAQIEI--IPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSVVNYQCPRNK-QCVVDRVNRNRCQYCRLQKCLKLGMSRDAVKFGRMSKKQREKVEDEVRFHRAQMRAQSDAAPDSSVYDTQTPSSSDQLHHNNYNSYSGGYSNNEVGYGSPYGYSASVTPQQTMQYDISADYVDSTTYEPRSTIIDPEFISHADGDINDVLIKTLAEAHANTNTKLEAVHDMFRKQPDVSRILYYKNLGQEELWLDCAEKLTQMIQNIIEFAKLIPGFMRLSQDDQILLLKTGSFELAIVRMSR 334          

HSP 2 Score: 67.0106 bits (162), Expect = 3.121e-11
Identity = 30/81 (37.04%), Postives = 47/81 (58.02%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            C+VC   ++G H+G   CE CK FF+R  ++ +N +    K C ++++ R +C +CR QKCL +GM      FG  S K +
Sbjct:   51 CKVCGDKSSGVHYGVITCEGCKGFFRRSQSSVVNYQCPRNKQCVVDRVNRNRCQYCRLQKCLKLGMSRDAVKFGRMSKKQR 131          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Fly
Match: Hr3 (gene:FBgn0000448 transcript:FBtr0330609)

HSP 1 Score: 98.2117 bits (243), Expect = 5.712e-21
Identity = 77/297 (25.93%), Postives = 130/297 (43.77%), Query Frame = 1
Query:  376 SNKSKIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNR---------------NSSPSTLDIPYHEISSRIS---ESNSDGNQRSISYSIPSTPVPXXXXXXXXXXPDGHSQAFCSKLIEAI----------KILQKPLLEA---------------EKLFHMTRFPVHRNQSLLEVWNSMMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLAR 1137
            S K++I+I  IPC+VCG KSSG H+G +TCEGCKGFFRR++      +C   K  CV+D  ++  C++CR  +C+K+GMS+   + GR     +     E+  ++ +                 +PS+ D  +H   +  S    +N  G      YS   TP  +      +   D  +    S +I+             +L K L EA                K   ++R   ++N    E+W             ++ FAK +PGF  LS  D+  +++   + + ++ ++R
Sbjct:   41 SIKAQIEI--IPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSVVNYQCPRNK-QCVVDRVNRNRCQYCRLQKCLKLGMSRDAVKFGRMSKKQREKVEDEVRFHRAQMRAQSDAAPDSSVYDTQTPSSSDQLHHNNYNSYSGGYSNNEVGYGSPYGYSASVTPQQTMQYDISADYVDSTTYEPRSTIIDPEFISHADGDINDVLIKTLAEAHANTNTKLEAVHDMFRKQPDVSRILYYKNLGQEELWLDCAEKLTQMIQNIIEFAKLIPGFMRLSQDDQILLLKTGSFELAIVRMSR 334          

HSP 2 Score: 67.3958 bits (163), Expect = 2.833e-11
Identity = 30/81 (37.04%), Postives = 47/81 (58.02%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            C+VC   ++G H+G   CE CK FF+R  ++ +N +    K C ++++ R +C +CR QKCL +GM      FG  S K +
Sbjct:   51 CKVCGDKSSGVHYGVITCEGCKGFFRRSQSSVVNYQCPRNKQCVVDRVNRNRCQYCRLQKCLKLGMSRDAVKFGRMSKKQR 131          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Fly
Match: Hr3 (gene:FBgn0000448 transcript:FBtr0088366)

HSP 1 Score: 97.0561 bits (240), Expect = 2.113e-20
Identity = 74/288 (25.69%), Postives = 125/288 (43.40%), Query Frame = 1
Query:  397 ISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNR---------------NSSPSTLDIPYHEISSRISESNSD-GNQRSISYSIPSTPVPXXXXXXXXXXPDGHSQAFCSKLIEAI----------KILQKPLLEA---------------EKLFHMTRFPVHRNQSLLEVWNSMMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLAR 1137
            I  IPC+VCG KSSG H+G +TCEGCKGFFRR++      +C   K  CV+D  ++  C++CR  +C+K+GMS+   + GR     +     E+  ++ +                 +PS+ D  +H   +    SN++ G      YS   TP  +      +   D  +    S +I+             +L K L EA                K   ++R   ++N    E+W             ++ FAK +PGF  LS  D+  +++   + + ++ ++R
Sbjct:  255 IEIIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSVVNYQCPRNK-QCVVDRVNRNRCQYCRLQKCLKLGMSRDAVKFGRMSKKQREKVEDEVRFHRAQMRAQSDAAPDSSVYDTQTPSSSDQLHHNNYNSGGYSNNEVGYGSPYGYSASVTPQQTMQYDISADYVDSTTYEPRSTIIDPEFISHADGDINDVLIKTLAEAHANTNTKLEAVHDMFRKQPDVSRILYYKNLGQEELWLDCAEKLTQMIQNIIEFAKLIPGFMRLSQDDQILLLKTGSFELAIVRMSR 541          

HSP 2 Score: 67.781 bits (164), Expect = 2.905e-11
Identity = 30/81 (37.04%), Postives = 47/81 (58.02%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            C+VC   ++G H+G   CE CK FF+R  ++ +N +    K C ++++ R +C +CR QKCL +GM      FG  S K +
Sbjct:  260 CKVCGDKSSGVHYGVITCEGCKGFFRRSQSSVVNYQCPRNKQCVVDRVNRNRCQYCRLQKCLKLGMSRDAVKFGRMSKKQR 340          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Zebrafish
Match: rorca (RAR-related orphan receptor C a [Source:ZFIN;Acc:ZDB-GENE-990415-250])

HSP 1 Score: 95.1301 bits (235), Expect = 4.521e-20
Identity = 51/141 (36.17%), Postives = 77/141 (54.61%), Query Frame = 1
Query:  388 KIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSSPSTLDIPYHEISSRIS-ESNSDGNQRSISYSIPST 807
            +  I  IPC++CG KSSG H+G +TCEGCKGFFRR++       C S + NC+ID +++  C+ CR  +C+ +GMS+   + GR     +     E+  +Q        L    + ISS    E+  +GN  S +YS  S+
Sbjct:    2 RAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNAMYSC-SRQRNCIIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQSQERAGGLG---NGISSHTGDEAGENGNGHSRAYSRGSS 138          

HSP 2 Score: 63.5438 bits (153), Expect = 4.905e-10
Identity = 38/122 (31.15%), Postives = 55/122 (45.08%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNK------SKIDISQIPCRVCGGKSSGF--HFGSLTCEGCKGFFR 489
            C++C   ++G H+G   CE CK FF+R   N        ++NC +++  R +C  CR QKCL +GM      FG  S K      +++   Q      GG  +G   H G    E   G  R
Sbjct:   10 CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNAMYSCSRQRNCIIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQSQERAGGLGNGISSHTGDEAGENGNGHSR 131          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Zebrafish
Match: rorca (RAR-related orphan receptor C a [Source:ZFIN;Acc:ZDB-GENE-990415-250])

HSP 1 Score: 95.1301 bits (235), Expect = 5.541e-20
Identity = 51/141 (36.17%), Postives = 77/141 (54.61%), Query Frame = 1
Query:  388 KIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSSPSTLDIPYHEISSRIS-ESNSDGNQRSISYSIPST 807
            +  I  IPC++CG KSSG H+G +TCEGCKGFFRR++       C S + NC+ID +++  C+ CR  +C+ +GMS+   + GR     +     E+  +Q        L    + ISS    E+  +GN  S +YS  S+
Sbjct:    3 ETQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNAMYSC-SRQRNCIIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQSQERAGGLG---NGISSHTGDEAGENGNGHSRAYSRGSS 139          

HSP 2 Score: 63.929 bits (154), Expect = 4.748e-10
Identity = 38/122 (31.15%), Postives = 55/122 (45.08%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNK------SKIDISQIPCRVCGGKSSGF--HFGSLTCEGCKGFFR 489
            C++C   ++G H+G   CE CK FF+R   N        ++NC +++  R +C  CR QKCL +GM      FG  S K      +++   Q      GG  +G   H G    E   G  R
Sbjct:   11 CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNAMYSCSRQRNCIIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQSQERAGGLGNGISSHTGDEAGENGNGHSR 132          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Zebrafish
Match: roraa (RAR-related orphan receptor A, paralog a [Source:NCBI gene;Acc:564951])

HSP 1 Score: 93.2041 bits (230), Expect = 1.773e-19
Identity = 43/95 (45.26%), Postives = 63/95 (66.32%), Query Frame = 1
Query:  355 MKFFGLRSNKSKIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGR 639
            M +F + + K++I+I  IPC++CG KSSG H+G +TCEGCKGFFRR++       C   K NC+ID + +  C+ CR  +C+ VGMS+   + GR
Sbjct:    1 MMYFVISAMKAQIEI--IPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNAAYSCPRQK-NCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGR 92          

HSP 2 Score: 63.929 bits (154), Expect = 4.047e-10
Identity = 33/83 (39.76%), Postives = 47/83 (56.63%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVC--KKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            C++C   ++G H+G   CE CK FF+R  + Q N+   C  +KNC +++  R +C  CR QKCL VGM      FG  S K +
Sbjct:   18 CKICGDKSSGIHYGVITCEGCKGFFRR--SQQSNAAYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQR 98          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Zebrafish
Match: rorab (RAR-related orphan receptor A, paralog b [Source:NCBI gene;Acc:554722])

HSP 1 Score: 92.4337 bits (228), Expect = 3.607e-19
Identity = 50/144 (34.72%), Postives = 76/144 (52.78%), Query Frame = 1
Query:  388 KIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSSPSTLDIPYHEISSRISESNSDGNQRSI--SYSIPSTPV 813
            K  I  IPC++CG KSSG H+G +TCEGCKGFFRR++       C   K +C+ID + +  C+ CR  +C+ VGMS+   + GR     +     E+  ++ +     T D      S +  ES + G    +  SY++ S+ V
Sbjct:    9 KAQIESIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQGTVSYSCPRQK-SCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLFAEVQKHRQQQQDDKTGD-----ESEKNQESQAPGEAEPLTPSYALSSSGV 146          

HSP 2 Score: 62.7734 bits (151), Expect = 9.642e-10
Identity = 30/87 (34.48%), Postives = 48/87 (55.17%), Query Frame = 1
Query:  142 KMENQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            ++E+  C++C   ++G H+G   CE CK FF+R     ++     +K+C +++  R +C  CR QKCL VGM      FG  S K +
Sbjct:   11 QIESIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQGTVSYSCPRQKSCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQR 97          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Zebrafish
Match: rorab (RAR-related orphan receptor A, paralog b [Source:NCBI gene;Acc:554722])

HSP 1 Score: 90.8929 bits (224), Expect = 1.301e-18
Identity = 49/141 (34.75%), Postives = 75/141 (53.19%), Query Frame = 1
Query:  397 ISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSSPSTLDIPYHEISSRISESNSDGNQRSI--SYSIPSTPV 813
            I  IPC++CG KSSG H+G +TCEGCKGFFRR++       C   K +C+ID + +  C+ CR  +C+ VGMS+   + GR     +     E+  ++ +     T D      S +  ES + G    +  SY++ S+ V
Sbjct:   11 IESIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQGTVSYSCPRQK-SCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLFAEVQKHRQQQQDDKTGD-----ESEKNQESQAPGEAEPLTPSYALSSSGV 145          

HSP 2 Score: 64.6994 bits (156), Expect = 2.520e-10
Identity = 32/93 (34.41%), Postives = 50/93 (53.76%), Query Frame = 1
Query:  124 FYEYQIKMENQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            F   Q ++E+  C++C   ++G H+G   CE CK FF+R     ++     +K+C +++  R +C  CR QKCL VGM      FG  S K +
Sbjct:    4 FITKQSQIESIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQGTVSYSCPRQKSCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQR 96          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Xenopus
Match: ctr9 (CTR9 homolog, Paf1/RNA polymerase II complex component [Source:Xenbase;Acc:XB-GENE-5946075])

HSP 1 Score: 98.2117 bits (243), Expect = 4.768e-21
Identity = 93/439 (21.18%), Postives = 179/439 (40.77%), Query Frame = 1
Query:  397 ISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEII-HYQNRNSSPSTLDIPYHEISSRISESNSDGNQRSISYSIPSTPVPXXXXXXXXXXPDGHSQAFCSKLIEAIKILQKPLLEAEKLFHMTRFPVH------RNQSLLE-------------------------------VWNS----------------MMRHFDVHTC----ILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEEDKDEFFNYFDFSKDEYEVILFHFPEMKKILAHVMEISRIIYKLNITKDQIGLLCIIELSKNYINLESFDAVRTIHKEVVRLFWISILKELDNEALLTEPGNPPSLPQMSVLLQVLNCPDDLISQIVFKIP 1539
            I  IPC++CG KSSG H+G +TCEGCKGFFRR++       C S + NC+ID +++  C+ CR  +C+++GMS+   + GR     +     E+  H QN+        +   +    +S S S G    +S     + +       F  +PDG S  +  +L     +  +P  +      +   PVH       +Q+LL+                               VWN+                M +   +H       +V FAK++ GF +L  +D+  +++     ++L+ + R++    +       F      + +F       +L  + ++ + + +L+++ ++I L               F A   +  +  RL     +++L +   L           +   +Q  +C +DL+++++ K+P
Sbjct:    5 IEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNANYSC-SRQRNCMIDRTNRNRCQHCRLQKCLELGMSRDAVKFGRMSKKQRDSLYAEVQKHQQNQEQ------VLARDTKDTVSRSYSTGTSSCLSDLEELSGLSDGLLFDFPLTPDGCSSYYSLEL----PLSTEPSPDPSHGTTLDELPVHYSLGLIEDQTLLDLNGTEIEYVSQNIIRSHLGTCQFTSDELSKMVWNAHSQEEVCSLQSKPCEMMWQLCAIHVSNAIQYVVEFAKRLDGFMELCQNDQIVLLKAGCLEVLLIRMTRAFNPSNNTVLFEGKFGG----IQMFRSLGCDDLLFAIFDLGQALCRLSLSDEEIAL---------------FTAAVLMSPDRPRLTESKKVQKLQDRIFLA----------LQKEIQKRHCSEDLLTKMISKLP 403          

HSP 2 Score: 67.0106 bits (162), Expect = 6.072e-11
Identity = 30/81 (37.04%), Postives = 44/81 (54.32%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            C++C   ++G H+G   CE CK FF+R   N  N     ++NC +++  R +C  CR QKCL +GM      FG  S K +
Sbjct:   10 CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNANYSCSRQRNCMIDRTNRNRCQHCRLQKCLELGMSRDAVKFGRMSKKQR 90          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Xenopus
Match: ctr9 (CTR9 homolog, Paf1/RNA polymerase II complex component [Source:Xenbase;Acc:XB-GENE-5946075])

HSP 1 Score: 98.2117 bits (243), Expect = 5.026e-21
Identity = 93/442 (21.04%), Postives = 180/442 (40.72%), Query Frame = 1
Query:  388 KIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEII-HYQNRNSSPSTLDIPYHEISSRISESNSDGNQRSISYSIPSTPVPXXXXXXXXXXPDGHSQAFCSKLIEAIKILQKPLLEAEKLFHMTRFPVH------RNQSLLE-------------------------------VWNS----------------MMRHFDVHTC----ILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEEDKDEFFNYFDFSKDEYEVILFHFPEMKKILAHVMEISRIIYKLNITKDQIGLLCIIELSKNYINLESFDAVRTIHKEVVRLFWISILKELDNEALLTEPGNPPSLPQMSVLLQVLNCPDDLISQIVFKIP 1539
            +  I  IPC++CG KSSG H+G +TCEGCKGFFRR++       C S + NC+ID +++  C+ CR  +C+++GMS+   + GR     +     E+  H QN+        +   +    +S S S G    +S     + +       F  +PDG S  +  +L     +  +P  +      +   PVH       +Q+LL+                               VWN+                M +   +H       +V FAK++ GF +L  +D+  +++     ++L+ + R++    +       F      + +F       +L  + ++ + + +L+++ ++I L               F A   +  +  RL     +++L +   L           +   +Q  +C +DL+++++ K+P
Sbjct:    2 RAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNANYSC-SRQRNCMIDRTNRNRCQHCRLQKCLELGMSRDAVKFGRMSKKQRDSLYAEVQKHQQNQEQ------VLARDTKDTVSRSYSTGTSSCLSDLEELSGLSDGLLFDFPLTPDGCSSYYSLEL----PLSTEPSPDPSHGTTLDELPVHYSLGLIEDQTLLDLNGTEIEYVSQNIIRSHLGTCQFTSDELSKMVWNAHSQEEVCSLQSKPCEMMWQLCAIHVSNAIQYVVEFAKRLDGFMELCQNDQIVLLKAGCLEVLLIRMTRAFNPSNNTVLFEGKFGG----IQMFRSLGCDDLLFAIFDLGQALCRLSLSDEEIAL---------------FTAAVLMSPDRPRLTESKKVQKLQDRIFLA----------LQKEIQKRHCSEDLLTKMISKLP 403          

HSP 2 Score: 67.0106 bits (162), Expect = 6.270e-11
Identity = 30/81 (37.04%), Postives = 44/81 (54.32%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            C++C   ++G H+G   CE CK FF+R   N  N     ++NC +++  R +C  CR QKCL +GM      FG  S K +
Sbjct:   10 CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNANYSCSRQRNCMIDRTNRNRCQHCRLQKCLELGMSRDAVKFGRMSKKQR 90          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Xenopus
Match: ctr9 (CTR9 homolog, Paf1/RNA polymerase II complex component [Source:Xenbase;Acc:XB-GENE-5946075])

HSP 1 Score: 98.2117 bits (243), Expect = 5.848e-21
Identity = 93/442 (21.04%), Postives = 180/442 (40.72%), Query Frame = 1
Query:  388 KIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEII-HYQNRNSSPSTLDIPYHEISSRISESNSDGNQRSISYSIPSTPVPXXXXXXXXXXPDGHSQAFCSKLIEAIKILQKPLLEAEKLFHMTRFPVH------RNQSLLE-------------------------------VWNS----------------MMRHFDVHTC----ILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEEDKDEFFNYFDFSKDEYEVILFHFPEMKKILAHVMEISRIIYKLNITKDQIGLLCIIELSKNYINLESFDAVRTIHKEVVRLFWISILKELDNEALLTEPGNPPSLPQMSVLLQVLNCPDDLISQIVFKIP 1539
            +  I  IPC++CG KSSG H+G +TCEGCKGFFRR++       C S + NC+ID +++  C+ CR  +C+++GMS+   + GR     +     E+  H QN+        +   +    +S S S G    +S     + +       F  +PDG S  +  +L     +  +P  +      +   PVH       +Q+LL+                               VWN+                M +   +H       +V FAK++ GF +L  +D+  +++     ++L+ + R++    +       F      + +F       +L  + ++ + + +L+++ ++I L               F A   +  +  RL     +++L +   L           +   +Q  +C +DL+++++ K+P
Sbjct:    6 RAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNANYSC-SRQRNCMIDRTNRNRCQHCRLQKCLELGMSRDAVKFGRMSKKQRDSLYAEVQKHQQNQEQ------VLARDTKDTVSRSYSTGTSSCLSDLEELSGLSDGLLFDFPLTPDGCSSYYSLEL----PLSTEPSPDPSHGTTLDELPVHYSLGLIEDQTLLDLNGTEIEYVSQNIIRSHLGTCQFTSDELSKMVWNAHSQEEVCSLQSKPCEMMWQLCAIHVSNAIQYVVEFAKRLDGFMELCQNDQIVLLKAGCLEVLLIRMTRAFNPSNNTVLFEGKFGG----IQMFRSLGCDDLLFAIFDLGQALCRLSLSDEEIAL---------------FTAAVLMSPDRPRLTESKKVQKLQDRIFLA----------LQKEIQKRHCSEDLLTKMISKLP 407          

HSP 2 Score: 67.0106 bits (162), Expect = 6.295e-11
Identity = 30/81 (37.04%), Postives = 44/81 (54.32%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            C++C   ++G H+G   CE CK FF+R   N  N     ++NC +++  R +C  CR QKCL +GM      FG  S K +
Sbjct:   14 CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNANYSCSRQRNCMIDRTNRNRCQHCRLQKCLELGMSRDAVKFGRMSKKQR 94          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Xenopus
Match: ctr9 (CTR9 homolog, Paf1/RNA polymerase II complex component [Source:Xenbase;Acc:XB-GENE-5946075])

HSP 1 Score: 98.2117 bits (243), Expect = 6.396e-21
Identity = 93/439 (21.18%), Postives = 179/439 (40.77%), Query Frame = 1
Query:  397 ISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEII-HYQNRNSSPSTLDIPYHEISSRISESNSDGNQRSISYSIPSTPVPXXXXXXXXXXPDGHSQAFCSKLIEAIKILQKPLLEAEKLFHMTRFPVH------RNQSLLE-------------------------------VWNS----------------MMRHFDVHTC----ILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEEDKDEFFNYFDFSKDEYEVILFHFPEMKKILAHVMEISRIIYKLNITKDQIGLLCIIELSKNYINLESFDAVRTIHKEVVRLFWISILKELDNEALLTEPGNPPSLPQMSVLLQVLNCPDDLISQIVFKIP 1539
            I  IPC++CG KSSG H+G +TCEGCKGFFRR++       C S + NC+ID +++  C+ CR  +C+++GMS+   + GR     +     E+  H QN+        +   +    +S S S G    +S     + +       F  +PDG S  +  +L     +  +P  +      +   PVH       +Q+LL+                               VWN+                M +   +H       +V FAK++ GF +L  +D+  +++     ++L+ + R++    +       F      + +F       +L  + ++ + + +L+++ ++I L               F A   +  +  RL     +++L +   L           +   +Q  +C +DL+++++ K+P
Sbjct:   17 IEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNANYSC-SRQRNCMIDRTNRNRCQHCRLQKCLELGMSRDAVKFGRMSKKQRDSLYAEVQKHQQNQEQ------VLARDTKDTVSRSYSTGTSSCLSDLEELSGLSDGLLFDFPLTPDGCSSYYSLEL----PLSTEPSPDPSHGTTLDELPVHYSLGLIEDQTLLDLNGTEIEYVSQNIIRSHLGTCQFTSDELSKMVWNAHSQEEVCSLQSKPCEMMWQLCAIHVSNAIQYVVEFAKRLDGFMELCQNDQIVLLKAGCLEVLLIRMTRAFNPSNNTVLFEGKFGG----IQMFRSLGCDDLLFAIFDLGQALCRLSLSDEEIAL---------------FTAAVLMSPDRPRLTESKKVQKLQDRIFLA----------LQKEIQKRHCSEDLLTKMISKLP 415          

HSP 2 Score: 66.6254 bits (161), Expect = 7.723e-11
Identity = 30/81 (37.04%), Postives = 44/81 (54.32%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            C++C   ++G H+G   CE CK FF+R   N  N     ++NC +++  R +C  CR QKCL +GM      FG  S K +
Sbjct:   22 CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNANYSCSRQRNCMIDRTNRNRCQHCRLQKCLELGMSRDAVKFGRMSKKQR 102          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Xenopus
Match: ctr9 (CTR9 homolog, Paf1/RNA polymerase II complex component [Source:Xenbase;Acc:XB-GENE-5946075])

HSP 1 Score: 97.8265 bits (242), Expect = 7.868e-21
Identity = 93/439 (21.18%), Postives = 179/439 (40.77%), Query Frame = 1
Query:  397 ISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEII-HYQNRNSSPSTLDIPYHEISSRISESNSDGNQRSISYSIPSTPVPXXXXXXXXXXPDGHSQAFCSKLIEAIKILQKPLLEAEKLFHMTRFPVH------RNQSLLE-------------------------------VWNS----------------MMRHFDVHTC----ILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEEDKDEFFNYFDFSKDEYEVILFHFPEMKKILAHVMEISRIIYKLNITKDQIGLLCIIELSKNYINLESFDAVRTIHKEVVRLFWISILKELDNEALLTEPGNPPSLPQMSVLLQVLNCPDDLISQIVFKIP 1539
            I  IPC++CG KSSG H+G +TCEGCKGFFRR++       C S + NC+ID +++  C+ CR  +C+++GMS+   + GR     +     E+  H QN+        +   +    +S S S G    +S     + +       F  +PDG S  +  +L     +  +P  +      +   PVH       +Q+LL+                               VWN+                M +   +H       +V FAK++ GF +L  +D+  +++     ++L+ + R++    +       F      + +F       +L  + ++ + + +L+++ ++I L               F A   +  +  RL     +++L +   L           +   +Q  +C +DL+++++ K+P
Sbjct:   20 IEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNANYSC-SRQRNCMIDRTNRNRCQHCRLQKCLELGMSRDAVKFGRMSKKQRDSLYAEVQKHQQNQEQ------VLARDTKDTVSRSYSTGTSSCLSDLEELSGLSDGLLFDFPLTPDGCSSYYSLEL----PLSTEPSPDPSHGTTLDELPVHYSLGLIEDQTLLDLNGTEIEYVSQNIIRSHLGTCQFTSDELSKMVWNAHSQEEVCSLQSKPCEMMWQLCAIHVSNAIQYVVEFAKRLDGFMELCQNDQIVLLKAGCLEVLLIRMTRAFNPSNNTVLFEGKFGG----IQMFRSLGCDDLLFAIFDLGQALCRLSLSDEEIAL---------------FTAAVLMSPDRPRLTESKKVQKLQDRIFLA----------LQKEIQKRHCSEDLLTKMISKLP 418          

HSP 2 Score: 67.0106 bits (162), Expect = 6.623e-11
Identity = 30/81 (37.04%), Postives = 44/81 (54.32%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            C++C   ++G H+G   CE CK FF+R   N  N     ++NC +++  R +C  CR QKCL +GM      FG  S K +
Sbjct:   25 CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNANYSCSRQRNCMIDRTNRNRCQHCRLQKCLELGMSRDAVKFGRMSKKQR 105          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Mouse
Match: Pparg (peroxisome proliferator activated receptor gamma [Source:MGI Symbol;Acc:MGI:97747])

HSP 1 Score: 88.5817 bits (218), Expect = 2.865e-19
Identity = 44/91 (48.35%), Postives = 54/91 (59.34%), Query Frame = 1
Query:  406 IPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEI 678
            I CRVCG K+SGFH+G   CEGCKGFFRR   ++ KL      LNC I    +  C++CR+ +C+ VGMS    R GR P A K     EI
Sbjct:  107 IECRVCGDKASGFHYGVHACEGCKGFFRRT--IRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEI 195          

HSP 2 Score: 69.707 bits (169), Expect = 6.855e-13
Identity = 33/75 (44.00%), Postives = 45/75 (60.00%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVV---CKKNCDLEKIGRRKCSFCRYQKCLNVGMKFFGLR 375
            C+VC   A+GFH+G + CE CK FF+R     +  K++   C  NC + K  R KC +CR+QKCL VGM    +R
Sbjct:  109 CRVCGDKASGFHYGVHACEGCKGFFRR----TIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIR 179          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Mouse
Match: Rora (RAR-related orphan receptor alpha [Source:MGI Symbol;Acc:MGI:104661])

HSP 1 Score: 92.4337 bits (228), Expect = 3.309e-19
Identity = 42/93 (45.16%), Postives = 62/93 (66.67%), Query Frame = 1
Query:  361 FFGLRSNKSKIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGR 639
            +F + + K++I+I  IPC++CG KSSG H+G +TCEGCKGFFRR++       C   K NC+ID + +  C+ CR  +C+ VGMS+   + GR
Sbjct:    2 YFVIAAMKAQIEI--IPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQK-NCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGR 91          

HSP 2 Score: 63.929 bits (154), Expect = 4.098e-10
Identity = 33/83 (39.76%), Postives = 47/83 (56.63%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVC--KKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            C++C   ++G H+G   CE CK FF+R  + Q N+   C  +KNC +++  R +C  CR QKCL VGM      FG  S K +
Sbjct:   17 CKICGDKSSGIHYGVITCEGCKGFFRR--SQQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQR 97          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Mouse
Match: Pparg (peroxisome proliferator activated receptor gamma [Source:MGI Symbol;Acc:MGI:97747])

HSP 1 Score: 91.6633 bits (226), Expect = 6.122e-19
Identity = 74/257 (28.79%), Postives = 116/257 (45.14%), Query Frame = 1
Query:  406 IPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSSPSTLDIPYHEISSRISESNSD-GNQRSI------SYSIPSTPVPXXXXXXXXXXPDGHSQAFCSKLIEAIKILQKPLLEAEKLFHMTRFPVHRNQSLLEVWNS-MMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEED 1152
            I CRVCG K+SGFH+G   CEGCKGFFRR   ++ KL      LNC I    +  C++CR+ +C+ VGMS    R GR P A K                         EISS I + N +  + R++      SY I S P+    + +  +        F    + ++ + +  +    K  H+T       +  + ++     R  +    I  Y AK +PGF +L L+D+ T+++  ++ I+   LA    +D
Sbjct:  107 IECRVCGDKASGFHYGVHACEGCKGFFRRT--IRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKL--------------------LAEISSDIDQLNPESADLRALAKHLYDSY-IKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKI----KFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEY-AKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKD 335          

HSP 2 Score: 70.8626 bits (172), Expect = 3.318e-12
Identity = 33/75 (44.00%), Postives = 45/75 (60.00%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVV---CKKNCDLEKIGRRKCSFCRYQKCLNVGMKFFGLR 375
            C+VC   A+GFH+G + CE CK FF+R     +  K++   C  NC + K  R KC +CR+QKCL VGM    +R
Sbjct:  109 CRVCGDKASGFHYGVHACEGCKGFFRR----TIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIR 179          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Mouse
Match: Pparg (peroxisome proliferator activated receptor gamma [Source:MGI Symbol;Acc:MGI:97747])

HSP 1 Score: 91.6633 bits (226), Expect = 6.122e-19
Identity = 74/257 (28.79%), Postives = 116/257 (45.14%), Query Frame = 1
Query:  406 IPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSSPSTLDIPYHEISSRISESNSD-GNQRSI------SYSIPSTPVPXXXXXXXXXXPDGHSQAFCSKLIEAIKILQKPLLEAEKLFHMTRFPVHRNQSLLEVWNS-MMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEED 1152
            I CRVCG K+SGFH+G   CEGCKGFFRR   ++ KL      LNC I    +  C++CR+ +C+ VGMS    R GR P A K                         EISS I + N +  + R++      SY I S P+    + +  +        F    + ++ + +  +    K  H+T       +  + ++     R  +    I  Y AK +PGF +L L+D+ T+++  ++ I+   LA    +D
Sbjct:  107 IECRVCGDKASGFHYGVHACEGCKGFFRRT--IRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKL--------------------LAEISSDIDQLNPESADLRALAKHLYDSY-IKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKI----KFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEY-AKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKD 335          

HSP 2 Score: 70.8626 bits (172), Expect = 3.318e-12
Identity = 33/75 (44.00%), Postives = 45/75 (60.00%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVV---CKKNCDLEKIGRRKCSFCRYQKCLNVGMKFFGLR 375
            C+VC   A+GFH+G + CE CK FF+R     +  K++   C  NC + K  R KC +CR+QKCL VGM    +R
Sbjct:  109 CRVCGDKASGFHYGVHACEGCKGFFRR----TIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIR 179          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Mouse
Match: Pparg (peroxisome proliferator activated receptor gamma [Source:MGI Symbol;Acc:MGI:97747])

HSP 1 Score: 91.2781 bits (225), Expect = 1.083e-18
Identity = 74/257 (28.79%), Postives = 116/257 (45.14%), Query Frame = 1
Query:  406 IPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSSPSTLDIPYHEISSRISESNSD-GNQRSI------SYSIPSTPVPXXXXXXXXXXPDGHSQAFCSKLIEAIKILQKPLLEAEKLFHMTRFPVHRNQSLLEVWNS-MMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEED 1152
            I CRVCG K+SGFH+G   CEGCKGFFRR   ++ KL      LNC I    +  C++CR+ +C+ VGMS    R GR P A K                         EISS I + N +  + R++      SY I S P+    + +  +        F    + ++ + +  +    K  H+T       +  + ++     R  +    I  Y AK +PGF +L L+D+ T+++  ++ I+   LA    +D
Sbjct:  137 IECRVCGDKASGFHYGVHACEGCKGFFRRT--IRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKL--------------------LAEISSDIDQLNPESADLRALAKHLYDSY-IKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKI----KFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEY-AKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKD 365          

HSP 2 Score: 70.8626 bits (172), Expect = 3.009e-12
Identity = 33/75 (44.00%), Postives = 45/75 (60.00%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVV---CKKNCDLEKIGRRKCSFCRYQKCLNVGMKFFGLR 375
            C+VC   A+GFH+G + CE CK FF+R     +  K++   C  NC + K  R KC +CR+QKCL VGM    +R
Sbjct:  139 CRVCGDKASGFHYGVHACEGCKGFFRR----TIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIR 209          
BLAST of Nuclear receptor 2DBD gamma vs. UniProt/SwissProt
Match: sp|P31396|HR3_DROME (Probable nuclear hormone receptor HR3 OS=Drosophila melanogaster OX=7227 GN=Hr3 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 2.664e-20
Identity = 76/295 (25.76%), Postives = 129/295 (43.73%), Query Frame = 1
Query:  382 KSKIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNR---------------NSSPSTLDIPYHEISSRIS---ESNSDGNQRSISYSIPSTPVPXXXXXXXXXXPDGHSQAFCSKLIEAI----------KILQKPLLEA---------------EKLFHMTRFPVHRNQSLLEVWNSMMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLAR 1137
            K++I+I  IPC+VCG KSSG H+G +TCEGCKGFFRR++      +C   K  CV+D  ++  C++CR  +C+K+GMS+   + GR     +     E+  ++ +                 +PS+ D  +H   +  S    +N  G      YS   TP  +      +   D  +    S +I+             +L K L EA                K   ++R   ++N    E+W             ++ FAK +PGF  LS  D+  +++   + + ++ ++R
Sbjct:   43 KAQIEI--IPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSVVNYQCPRNK-QCVVDRVNRNRCQYCRLQKCLKLGMSRDAVKFGRMSKKQREKVEDEVRFHRAQMRAQSDAAPDSSVYDTQTPSSSDQLHHNNYNSYSGGYSNNEVGYGSPYGYSASVTPQQTMQYDISADYVDSTTYEPRSTIIDPEFISHADGDINDVLIKTLAEAHANTNTKLEAVHDMFRKQPDVSRILYYKNLGQEELWLDCAEKLTQMIQNIIEFAKLIPGFMRLSQDDQILLLKTGSFELAIVRMSR 334          

HSP 2 Score: 67.0106 bits (162), Expect = 3.129e-10
Identity = 30/81 (37.04%), Postives = 47/81 (58.02%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            C+VC   ++G H+G   CE CK FF+R  ++ +N +    K C ++++ R +C +CR QKCL +GM      FG  S K +
Sbjct:   51 CKVCGDKSSGVHYGVITCEGCKGFFRRSQSSVVNYQCPRNKQCVVDRVNRNRCQYCRLQKCLKLGMSRDAVKFGRMSKKQR 131          
BLAST of Nuclear receptor 2DBD gamma vs. UniProt/SwissProt
Match: sp|P41828|NHR23_CAEEL (Nuclear hormone receptor family member nhr-23 OS=Caenorhabditis elegans OX=6239 GN=nhr-23 PE=2 SV=2)

HSP 1 Score: 97.0561 bits (240), Expect = 1.727e-19
Identity = 47/98 (47.96%), Postives = 64/98 (65.31%), Query Frame = 1
Query:  355 MKFFGLRSNKSKI---DISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGR 639
            M F GL  NKS +    I  IPC+VCG KSSG H+G +TCEGCKGFFRR++      +C   K NCV+D  ++  C++CR  +CI++GMS+   + GR
Sbjct:  141 MSFRGLPENKSLLVSAQIEVIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSIVNYQCPRQK-NCVVDRVNRNRCQYCRLKKCIELGMSRDAVKFGR 237          

HSP 2 Score: 69.3218 bits (168), Expect = 7.352e-11
Identity = 37/122 (30.33%), Postives = 65/122 (53.28%), Query Frame = 1
Query:   40 LDKNKVQSVILKTNTMLNNATFSS-PESAFYEYQIKMENQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            +D N+V         + +N +F   PE+       ++E   C+VC   ++G H+G   CE CK FF+R  ++ +N +   +KNC ++++ R +C +CR +KC+ +GM      FG  S K +
Sbjct:  126 IDTNRVD----MAGILPDNMSFRGLPENKSLLVSAQIEVIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSIVNYQCPRQKNCVVDRVNRNRCQYCRLKKCIELGMSRDAVKFGRMSKKQR 243          
BLAST of Nuclear receptor 2DBD gamma vs. UniProt/SwissProt
Match: sp|P49868|HR3_GALME (Probable nuclear hormone receptor HR3 OS=Galleria mellonella OX=7137 GN=HR3 PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.959e-19
Identity = 88/364 (24.18%), Postives = 148/364 (40.66%), Query Frame = 1
Query:  376 SNKSKIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIH----------------YQNRNSSPSTLDI------PYHEISSRISESNSDGNQRSISYS--------------------IPSTPVPXXXXXXXXXXPD--GHSQAFCSKLIEAIKILQKPLLEA--------EKLFHMTRFPVHRNQSLL-------EVWNSMMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEEDKDEFFNYFDFSKDEYEVILFHFPEMKKILAHVMEISRIIYKLNITK 1290
            +N  +  I  IPC+VCG KSSG H+G +TCEGCKGFFRR++      +C   K  CV+D  ++  C++CR  +C+K+GMS+   + GR     +     E+ +                Y  +  +PS+ D        Y    S +S     GN      S                    + ST              D  GH++   S      K+L K L EA        E +  M R P   ++ L        E+W             ++ FAK +PGF  LS  D+  +++   + + ++ L+R  + ++++   Y D      E +    P    ++  + + ++ I +L +T+
Sbjct:   96 ANSIRAQIEIIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSTVVNYQCPRNKA-CVVDRVNRNRCQYCRLQKCLKLGMSRDAVKFGRMSKKQREKVEDEVRYHRAQMRAQTDAAPDSVYDAQQQTPSSSDQFHGHYNGYPGYRSPLSSYGYGGNAGPALTSNMNIQPQAPQQQPYDVSADYVDSTTAYEPKQTGGFLDADFIGHAEGDIS------KVLVKSLAEAHANTNPKLEYVHEMFRKPPDVSKLLFYNSMTYEEMWLDCADKLTGMIQNIIEFAKLIPGFMKLSQDDQILLLKSGSFELAIVRLSRLIDVNREQVL-YGDVVLPIRECVHARDPRDVTLVVGIFDAAKTIERLKLTE 451          

HSP 2 Score: 67.0106 bits (162), Expect = 4.299e-10
Identity = 30/81 (37.04%), Postives = 46/81 (56.79%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            C+VC   ++G H+G   CE CK FF+R  +  +N +    K C ++++ R +C +CR QKCL +GM      FG  S K +
Sbjct:  108 CKVCGDKSSGVHYGVITCEGCKGFFRRSQSTVVNYQCPRNKACVVDRVNRNRCQYCRLQKCLKLGMSRDAVKFGRMSKKQR 188          
BLAST of Nuclear receptor 2DBD gamma vs. UniProt/SwissProt
Match: sp|O35507|PPARA_CAVPO (Peroxisome proliferator-activated receptor alpha OS=Cavia porcellus OX=10141 GN=PPARA PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 5.004e-19
Identity = 71/271 (26.20%), Postives = 114/271 (42.07%), Query Frame = 1
Query:  406 IPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSSPSTLDIPYHEISSRISESNSDGNQRSISYSIPSTPVPXXXXXXXXXXPDGHSQAFCSKLIEAIKILQKPLLEAEKLFHMTRFPVHRNQSLLEVWNSMM---------------RHFDVHTCI-------LVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEED 1152
            I CR+CG K+SG+H+G   CEGCKGFFRR   ++ KL       +C I   ++  C++CR+H+C+ VGMS    R GR P + K     E++     +    T D+    ++ RI E+                              + H     +++I A K    PL           F +H  ++L     ++M               R F    C+       L  FAK +PGF  L L+D+ T+++  +Y  +   L+ +  +D
Sbjct:  100 IECRICGDKASGYHYGVHACEGCKGFFRRT--IRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEVLTCDRDSEGAETADL--KSLAKRIYEA---------------------------YLKNFHMNKVKARIILAGKTSSHPL-----------FVIHDMETLCTAEKTLMAKVVSDGIRDKEAEVRIFHCCQCVSVETVTNLTEFAKAIPGFASLDLNDQVTLLKYGVYEAIFTMLSSTMNKD 328          

HSP 2 Score: 68.9366 bits (167), Expect = 7.508e-11
Identity = 37/97 (38.14%), Postives = 56/97 (57.73%), Query Frame = 1
Query:  151 NQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVV---CKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGL--RSNKSKIDISQIPC 414
            N  C++C   A+G+H+G + CE CK FF+R     +  K+V   C ++C ++K  R KC +CR+ KCL+VGM      FG   RS K+K+    + C
Sbjct:   99 NIECRICGDKASGYHYGVHACEGCKGFFRR----TIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEVLTC 191          
BLAST of Nuclear receptor 2DBD gamma vs. UniProt/SwissProt
Match: sp|F1QLY4|RORAA_DANRE (Nuclear receptor ROR-alpha A OS=Danio rerio OX=7955 GN=roraa PE=2 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 1.338e-18
Identity = 43/95 (45.26%), Postives = 63/95 (66.32%), Query Frame = 1
Query:  355 MKFFGLRSNKSKIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGR 639
            M +F + + K++I+I  IPC++CG KSSG H+G +TCEGCKGFFRR++       C   K NC+ID + +  C+ CR  +C+ VGMS+   + GR
Sbjct:    1 MMYFVISAMKAQIEI--IPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNAAYSCPRQK-NCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGR 92          

HSP 2 Score: 63.929 bits (154), Expect = 3.055e-9
Identity = 33/83 (39.76%), Postives = 47/83 (56.63%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVC--KKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            C++C   ++G H+G   CE CK FF+R  + Q N+   C  +KNC +++  R +C  CR QKCL VGM      FG  S K +
Sbjct:   18 CKICGDKSSGIHYGVITCEGCKGFFRR--SQQSNAAYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQR 98          
BLAST of Nuclear receptor 2DBD gamma vs. TrEMBL
Match: A0A564Y0P1 (Uncharacterized protein (Fragment) OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS1241 PE=3 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 2.376e-72
Identity = 128/234 (54.70%), Postives = 155/234 (66.24%), Query Frame = 1
Query:   28 SFQKLDKNKVQSVILKTNTMLNNATFSSPESAFYEYQIKMENQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKK--NCDLEKIGRRKCSFCRYQKCLNVGMKFFGLRSNKSKIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSSPSTLDI 723
            S Q  D +   S   ++   ++   F+SPESAFY+YQ +ME QLCQ+C  LAAGFHHGAYVCEACKKFF R+S     S   C    NC + K  R +C  CRY+KCL VGM    + + + ++DIS IPCRVCGG+SSGFHFG+LTCEGCKGFFRR E    +L CV GK NC I    +  CK CR+ RC++ GMSK GSRIGRQPNAVK HCA+EI   Q+ N  P   D 
Sbjct:  134 SRQMTDLDGSMSTPSRSTGGVSLPGFTSPESAFYQYQNRMEGQLCQICGELAAGFHHGAYVCEACKKFFMRHSLANGRSTTTCPSGGNCVIVKNSRGRCQQCRYKKCLEVGMSLKDMDA-QGELDISNIPCRVCGGRSSGFHFGALTCEGCKGFFRRTEETASRLVCVGGKDNCTITPRSRNVCKSCRFRRCLRAGMSKRGSRIGRQPNAVKFHCAIEIRQMQD-NGQPLASDF 365          

HSP 2 Score: 98.2117 bits (243), Expect = 2.353e-17
Identity = 49/149 (32.89%), Postives = 85/149 (57.05%), Query Frame = 1
Query:  889 AIKILQKPLLEAEKLFHMTRFPVHRNQSLLEVWNSMMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEEDKDEFFNYFDFSKDEYEVILFHFPEMKKILAHVMEISRIIYKLNITKDQIGLLCIIELSKNY 1335
            AI+ ++ P    +  F M+     +     +VW+ +M HF +H+  +V FAK +PGFN +SLS +  +V+ ++YS +LL L+R Y+  +D  +N+ DFS  E ++IL HFP   +++ H+    R   +LN+T  +    C I + + Y
Sbjct:  514 AIEFMRLPATYFKSRFDMSTVEPSQADDEHQVWDHVMNHFHLHSQQVVQFAKLIPGFNQMSLSARGHLVRASLYSEVLLMLSRDYDVTEDR-YNFLDFSPAERDIILRHFPIYNRVVEHLKISGRFFQQLNLTHTEFVYACAIGILRQY 661          
BLAST of Nuclear receptor 2DBD gamma vs. TrEMBL
Match: A0A0R3TT29 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS10839 PE=4 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 4.178e-72
Identity = 124/209 (59.33%), Postives = 146/209 (69.86%), Query Frame = 1
Query:  103 FSSPESAFYEYQIKMENQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKK--NCDLEKIGRRKCSFCRYQKCLNVGMKFFGLRSNKSKIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSSPSTLDI 723
            F+SPESAFY+YQ +ME QLCQ+C  LAAGFHHGAYVCEACKKFF R+S     S   C    NC + K  R +C  CRY+KCL VGM    + + + ++DIS IPCRVCGG+SSGFHFG+LTCEGCKGFFRR E    +L CV GK NC I    +  CK CR+ RC++ GMSK GSRIGRQPNAVK HCA+EI   Q+ N  P   D 
Sbjct:  153 FTSPESAFYQYQNRMEGQLCQICGELAAGFHHGAYVCEACKKFFMRHSLANGRSTTTCPSGGNCVIAKNSRGRCQQCRYKKCLEVGMSLKDMDA-QGELDISNIPCRVCGGRSSGFHFGALTCEGCKGFFRRTEETASRLVCVGGKDNCTITPRSRNVCKSCRFRRCLRAGMSKRGSRIGRQPNAVKFHCAIEIRQMQD-NGQPLATDF 359          
BLAST of Nuclear receptor 2DBD gamma vs. TrEMBL
Match: A0A158QEI5 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7453 PE=3 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 1.420e-71
Identity = 128/234 (54.70%), Postives = 155/234 (66.24%), Query Frame = 1
Query:   28 SFQKLDKNKVQSVILKTNTMLNNATFSSPESAFYEYQIKMENQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKK--NCDLEKIGRRKCSFCRYQKCLNVGMKFFGLRSNKSKIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSSPSTLDI 723
            S Q  D +   S   ++   ++   F+SPESAFY+YQ +ME QLCQ+C  LAAGFHHGAYVCEACKKFF R+S     S   C    NC + K  R +C  CRY+KCL VGM    + + + ++DIS IPCRVCGG+SSGFHFG+LTCEGCKGFFRR E    +L CV GK NC I    +  CK CR+ RC++ GMSK GSRIGRQPNAVK HCA+EI   Q+ N  P   D 
Sbjct:  134 SRQMTDLDGSMSTPSRSTGGVSLPGFTSPESAFYQYQNRMEGQLCQICGELAAGFHHGAYVCEACKKFFMRHSLANGRSTTTCPSGGNCVIVKNSRGRCQQCRYKKCLEVGMSLKDMDA-QGELDISNIPCRVCGGRSSGFHFGALTCEGCKGFFRRTEETASRLVCVGGKDNCTITPRSRNVCKSCRFRRCLRAGMSKRGSRIGRQPNAVKFHCAIEIRQMQD-NGQPLASDF 365          

HSP 2 Score: 112.079 bits (279), Expect = 1.602e-21
Identity = 69/274 (25.18%), Postives = 131/274 (47.81%), Query Frame = 1
Query:  889 AIKILQKPLLEAEKLFHMTRFPVHRNQSLLEVWNSMMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEEDKDEFFNYFDFSKDEYEVILFHFPEMKKILAHVMEISRIIYKLNITKDQIGLLCIIELSKNYINLE--SFDAVRTIHKEVVRLFWISILKELDNEALLTEPGNPPSLPQMSVLLQVLNCPDDLISQIVFKIPKCTENKWCQKLHIIFKVLGEKLQEFNIEHQMIIDELKRNKPELPYPELYTEMFQL 1704
            AI+ ++ P    +  F M+     +     +VW+ +M HF +H+  +V FAK +PGFN +SLS +  +V+ ++YS +LL L+R Y+  +D  +N+ DFS  E ++IL HFP   +++ H+    R   +LN+T  +    C I + + Y  L   ++   R +          ++  + +++ L+                                     ++KW +      + L E L   + E++ I  +L+R++P+L YP+LY EM+++
Sbjct:  514 AIEFMRLPATYFKSRFDMSTVEPSQADDEHQVWDHVMNHFHLHSQQVVQFAKLIPGFNQMSLSARGHLVRASLYSEVLLMLSRDYDVTEDR-YNFLDFSPAERDIILRHFPIYNRVVEHLKISGRFFQQLNLTHTEFVYACAIGILRQYYILANPAYTDARKLLLLARHSLLATMRSQTESQELV-------------------------------------DHKWNR-----LEALSEMLSSMSKEYRDIAQQLQRSRPDLRYPDLYAEMYEI 744          
BLAST of Nuclear receptor 2DBD gamma vs. TrEMBL
Match: A0A3Q8VLE6 (2DBD nuclear receptor alpha OS=Echinococcus granulosus OX=6210 PE=2 SV=2)

HSP 1 Score: 260.381 bits (664), Expect = 2.367e-71
Identity = 120/194 (61.86%), Postives = 141/194 (72.68%), Query Frame = 1
Query:  103 FSSPESAFYEYQIKMENQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKK--NCDLEKIGRRKCSFCRYQKCLNVGMKFFGLRSNKSKIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEI 678
            F+SPESAFY+YQ +ME QLCQ+C  LAAGFHHGAYVCEACKKFF R+S     S   C    NC + K  R +C  CRY+KCL VGM    + + + ++DIS IPCRVCGG+SSGFHFG+LTCEGCKGFFRR E    +L CV GK NC I    +  CK CR+ RC++ GMSK GSRIGRQPNAVK HCA+EI
Sbjct:  154 FTSPESAFYQYQNRMEGQLCQICGELAAGFHHGAYVCEACKKFFMRHSLANGRSTTTCPSGGNCVIAKSSRGRCQQCRYKKCLEVGMSLKDMDA-QGELDISNIPCRVCGGRSSGFHFGALTCEGCKGFFRRTEESASRLVCVGGKDNCTITPRSRNVCKTCRFRRCLRAGMSKRGSRIGRQPNAVKFHCAIEI 346          

HSP 2 Score: 109.383 bits (272), Expect = 1.137e-20
Identity = 66/274 (24.09%), Postives = 132/274 (48.18%), Query Frame = 1
Query:  889 AIKILQKPLLEAEKLFHMTRFPVHRNQSLLEVWNSMMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEEDKDEFFNYFDFSKDEYEVILFHFPEMKKILAHVMEISRIIYKLNITKDQIGLLCIIELSKNYINLE--SFDAVRTIHKEVVRLFWISILKELDNEALLTEPGNPPSLPQMSVLLQVLNCPDDLISQIVFKIPKCTENKWCQKLHIIFKVLGEKLQEFNIEHQMIIDELKRNKPELPYPELYTEMFQL 1704
            A++ ++ P    +  F M+     +     +VW+ +M HF +H+  +V FAK +PGFN +SLS +  +V+ ++YS +LL L+R Y+  +D  +N+ DFS  E +++L HFP   +++ H+    R   +LN+T  +   +C I + + Y  L   ++   R +          ++  + +++ L+                                     ++KW +      + + E L   + E++ I  +L+R++P+L YP+LY EM+++
Sbjct:  493 AMEFMRLPATYFKSRFDMSTIEPSQADDEHQVWDHVMNHFHLHSQQVVQFAKLIPGFNQMSLSARGHLVRASLYSEVLLMLSRDYDAAEDR-YNFLDFSPTERDIVLRHFPIYNRVVEHLKISGRFFQQLNLTHTEFVYVCAIGILRYYYILANPAYMDARKLLLLARHSLLATMRSQNESQELV-------------------------------------DHKWSR-----LEAMSEMLSSMSREYREIAQQLQRSRPDLRYPDLYVEMYEI 723          
BLAST of Nuclear receptor 2DBD gamma vs. TrEMBL
Match: A0A068WW59 (Nuclear receptor 2DBD gamma OS=Echinococcus granulosus OX=6210 GN=EgrG_000379600 PE=3 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 3.934e-71
Identity = 120/194 (61.86%), Postives = 141/194 (72.68%), Query Frame = 1
Query:  103 FSSPESAFYEYQIKMENQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKK--NCDLEKIGRRKCSFCRYQKCLNVGMKFFGLRSNKSKIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEI 678
            F+SPESAFY+YQ +ME QLCQ+C  LAAGFHHGAYVCEACKKFF R+S     S   C    NC + K  R +C  CRY+KCL VGM    + + + ++DIS IPCRVCGG+SSGFHFG+LTCEGCKGFFRR E    +L CV GK NC I    +  CK CR+ RC++ GMSK GSRIGRQPNAVK HCA+EI
Sbjct:  154 FTSPESAFYQYQNRMEGQLCQICGELAAGFHHGAYVCEACKKFFMRHSLANGRSTTTCPSGGNCVIAKSSRGRCQQCRYKKCLEVGMSLKDMDA-QGELDISNIPCRVCGGRSSGFHFGALTCEGCKGFFRRTEESASRLVCVGGKDNCTITPRSRNVCKACRFRRCLRAGMSKRGSRIGRQPNAVKFHCAIEI 346          

HSP 2 Score: 108.612 bits (270), Expect = 1.888e-20
Identity = 62/244 (25.41%), Postives = 121/244 (49.59%), Query Frame = 1
Query:  979 EVWNSMMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEEDKDEFFNYFDFSKDEYEVILFHFPEMKKILAHVMEISRIIYKLNITKDQIGLLCIIELSKNYINLE--SFDAVRTIHKEVVRLFWISILKELDNEALLTEPGNPPSLPQMSVLLQVLNCPDDLISQIVFKIPKCTENKWCQKLHIIFKVLGEKLQEFNIEHQMIIDELKRNKPELPYPELYTEMFQL 1704
            +VW+ +M HF +H+  +V FAK +PGFN +SLS +  +V+ ++YS +LL L+R Y+  +D  +N+ DFS  E +++L HFP   +++ H+    R   +LN+T  +   +C I + + Y  L   ++   R +          ++  + +++ L+                                     ++KW +      + + E L   + E++ I  +L+R++P+L YP+LY EM+++
Sbjct:  545 QVWDHVMNHFHLHSQQVVQFAKLIPGFNQMSLSARGHLVRASLYSEVLLMLSRDYDAAEDR-YNFLDFSPTERDIVLRHFPIYNRVVEHLKISGRFFQQLNLTHTEFVYVCAIGILRYYYILANPAYTDARKLLLLARHSLLATMRSQNESQELV-------------------------------------DHKWSR-----LEAMSEMLSSMSREYREIAQQLQRSRPDLRYPDLYVEMYEI 745          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Cavefish
Match: rorca (nuclear receptor ROR-beta-like [Source:NCBI gene;Acc:103032914])

HSP 1 Score: 99.3673 bits (246), Expect = 1.818e-21
Identity = 49/136 (36.03%), Postives = 78/136 (57.35%), Query Frame = 1
Query:  385 SKIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQN---RNSSPSTLDIPYHEISSRISESNSDGNQRS 783
            +K  I  IPC++CG KSSG H+G +TCEGCKGFFRR++       C S + NC+ID +++  C+ CR  +C+ +GMS+   + GR     +     E+  +Q    R S P  + +P   ++  I E+ + G+ R+
Sbjct:   16 AKTQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNAMYSC-SRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQSQERTSGPGGITLP-SRVNDDIGENGNGGHGRA 149          

HSP 2 Score: 63.1586 bits (152), Expect = 6.693e-10
Identity = 29/81 (35.80%), Postives = 43/81 (53.09%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            C++C   ++G H+G   CE CK FF+R   N        ++NC +++  R +C  CR QKCL +GM      FG  S K +
Sbjct:   25 CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNAMYSCSRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQR 105          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Cavefish
Match: rorca (nuclear receptor ROR-beta-like [Source:NCBI gene;Acc:103032914])

HSP 1 Score: 97.8265 bits (242), Expect = 6.009e-21
Identity = 48/135 (35.56%), Postives = 77/135 (57.04%), Query Frame = 1
Query:  388 KIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQN---RNSSPSTLDIPYHEISSRISESNSDGNQRS 783
            +  I  IPC++CG KSSG H+G +TCEGCKGFFRR++       C S + NC+ID +++  C+ CR  +C+ +GMS+   + GR     +     E+  +Q    R S P  + +P   ++  I E+ + G+ R+
Sbjct:    2 RAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNAMYSC-SRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQSQERTSGPGGITLP-SRVNDDIGENGNGGHGRA 134          

HSP 2 Score: 63.1586 bits (152), Expect = 6.370e-10
Identity = 29/81 (35.80%), Postives = 43/81 (53.09%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            C++C   ++G H+G   CE CK FF+R   N        ++NC +++  R +C  CR QKCL +GM      FG  S K +
Sbjct:   10 CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNAMYSCSRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQR 90          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Cavefish
Match: rorca (nuclear receptor ROR-beta-like [Source:NCBI gene;Acc:103032914])

HSP 1 Score: 96.6709 bits (239), Expect = 1.437e-20
Identity = 47/129 (36.43%), Postives = 75/129 (58.14%), Query Frame = 1
Query:  406 IPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQN---RNSSPSTLDIPYHEISSRISESNSDGNQRS 783
            IPC++CG KSSG H+G +TCEGCKGFFRR++       C S + NC+ID +++  C+ CR  +C+ +GMS+   + GR     +     E+  +Q    R S P  + +P   ++  I E+ + G+ R+
Sbjct:    5 IPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNAMYSC-SRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQSQERTSGPGGITLP-SRVNDDIGENGNGGHGRA 131          

HSP 2 Score: 62.7734 bits (151), Expect = 8.228e-10
Identity = 29/81 (35.80%), Postives = 43/81 (53.09%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            C++C   ++G H+G   CE CK FF+R   N        ++NC +++  R +C  CR QKCL +GM      FG  S K +
Sbjct:    7 CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNAMYSCSRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQR 87          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Cavefish
Match: roraa (nuclear receptor ROR-alpha [Source:NCBI gene;Acc:103045127])

HSP 1 Score: 92.8189 bits (229), Expect = 2.820e-19
Identity = 43/95 (45.26%), Postives = 63/95 (66.32%), Query Frame = 1
Query:  355 MKFFGLRSNKSKIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGR 639
            M +F + + K++I+I  IPC++CG KSSG H+G +TCEGCKGFFRR++       C   K NC+ID + +  C+ CR  +C+ VGMS+   + GR
Sbjct:   44 MMYFVISAMKAQIEI--IPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNAAYSCPRQK-NCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGR 135          

HSP 2 Score: 63.929 bits (154), Expect = 3.807e-10
Identity = 33/83 (39.76%), Postives = 47/83 (56.63%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVC--KKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            C++C   ++G H+G   CE CK FF+R  + Q N+   C  +KNC +++  R +C  CR QKCL VGM      FG  S K +
Sbjct:   61 CKICGDKSSGIHYGVITCEGCKGFFRR--SQQSNAAYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQR 141          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Cavefish
Match: pparab (peroxisome proliferator-activated receptor alpha b [Source:ZFIN;Acc:ZDB-GENE-990415-211])

HSP 1 Score: 90.5077 bits (223), Expect = 1.165e-18
Identity = 72/262 (27.48%), Postives = 116/262 (44.27%), Query Frame = 1
Query:  406 IPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSSPSTLDIPYHEISSRISE------SNSDGNQRSISYSIPSTPVPXXXXXXXXXXPDGHSQAFCSKLIEAIKILQKPLLEAEKLFHMTRFPVHRNQSLLEVWNSMMRHFDVHTCI-------LVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEED 1152
            + CRVC  ++SG+H+G   CEGCKGFFRR   ++ KLE    + +C I   ++  C++CR+ +C+ VGMS    R GR P + K     EI+  +     P   D     ++ +I E      S +    R+I     +TP                   F    +E +++ ++ L+            V  +  LL   ++ +R F    C        L  FAK VPGF  L L+D+ T+++  +Y  +   LA    +D
Sbjct:  103 LECRVCSDRASGYHYGVHACEGCKGFFRRT--IRLKLEYDKCERHCKIQKKNRNKCQYCRFQKCLSVGMSHNAIRFGRMPQSEKLKLKAEILTGEKEVEDPRLAD--QKTLAKQIYEAYLKNFSMNKSKARTILTGKTNTP------------------PFVVHDMETLQLAEQTLVAKM---------VGTSGGLLN-KDAEVRIFHCCQCTSVETVTELTEFAKSVPGFCTLDLNDQVTLLKYGVYEALFAMLASCMNKD 332          

HSP 2 Score: 71.633 bits (174), Expect = 1.254e-12
Identity = 32/75 (42.67%), Postives = 49/75 (65.33%), Query Frame = 1
Query:  151 NQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKFFGLR 375
            N  C+VC+  A+G+H+G + CE CK FF+R    +L     C+++C ++K  R KC +CR+QKCL+VGM    +R
Sbjct:  102 NLECRVCSDRASGYHYGVHACEGCKGFFRRTIRLKLEYDK-CERHCKIQKKNRNKCQYCRFQKCLSVGMSHNAIR 175          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006486.1 (pep scaffold:Pmarinus_7.0:GL477261:3134:78930:1 gene:ENSPMAG00000005858.1 transcript:ENSPMAT00000006486.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.2705 bits (212), Expect = 4.350e-18
Identity = 90/395 (22.78%), Postives = 165/395 (41.77%), Query Frame = 1
Query:  352 GMKFFGLRSNKSKIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSSPSTLDIPYHEISSRISESNSDGNQRSISYSIPSTPVPXXXXXXXXXXPDGHSQAFCSKLIEAIKILQKPLLEAEKLFHMTRFPVHRNQSLLEVWNSMMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLA-RSYEEDKDEFFNYF--DFSKDEYEVILFHFPEMKKILAHVMEISRIIYKLNITKDQIGLLCIIELSKNYINLESFDAVRTIHKEVVRLFWISILKELDNEALLTEPGNPPSLPQMSVLLQVLNCPDDLISQIV 1527
            G  + G  S        Q  C +C  ++SG H+G LTC  CK FF+RA   +    C +G+ +C+ID   +  C  CR  +CI+ GM+ +G+R  ++   VK             N             ++    SNS       ++S P T  P                 F   LI  ++ ++  ++       M+ +   R+Q+   + +S+ R  D     +V +AK +PGF +L + D+  ++Q +   +M   ++ RS++    +   YF  D   DE  +       M ++   + ++S    KL +T ++   LC+    K  + L +        +       IS ++EL+     TE        +   L ++L+C  DL+S+++
Sbjct:   48 GFPYPGFTSPAQSSVPPQKACLICSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLC-AGRNDCIIDKIRRKNCPACRLRKCIQAGMT-LGARKLKKQGRVK-----------GENQRSPASSTATTSSATPQPSSNSTA---VTTFSPPPTGEPI----------------FSPTLIAILQAIEPEVV-------MSGYDNTRSQTTAYMLSSLNRLCDKQLVSIVKWAKSLPGFRNLHIDDQMVLIQYSWMGLMSFAMSWRSFQHTNSKLL-YFAPDLVFDETRM---QQSAMYQLCVEMRQVSEDFMKLQVTSEE--FLCM----KAILLLSTVPQEGLKSQGCFEEMRISYIRELNRTIARTEKNAVQCWQRFYQLTKLLDCMQDLVSKLL 393          

HSP 2 Score: 59.3066 bits (142), Expect = 1.755e-9
Identity = 30/87 (34.48%), Postives = 45/87 (51.72%), Query Frame = 1
Query:  103 FSSPESAFYEYQIKMENQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF 363
            F+SP  +    Q     + C +C+  A+G H+G   C +CK FFKR    Q N     + +C ++KI R+ C  CR +KC+  GM  
Sbjct:   54 FTSPAQSSVPPQ-----KACLICSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRLRKCIQAGMTL 135          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Sea Lamprey
Match: rorb (RAR-related orphan receptor B [Source:ZFIN;Acc:ZDB-GENE-061204-2])

HSP 1 Score: 86.2705 bits (212), Expect = 6.083e-18
Identity = 37/81 (45.68%), Postives = 54/81 (66.67%), Query Frame = 1
Query:  397 ISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGR 639
            I  IPC++CG KSSG H+G +TCEGCKGFFRR++       C   + NC+ID +++  C+ CR  +C+ +GMS+   + GR
Sbjct:   16 IEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQR-NCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGR 95          

HSP 2 Score: 62.3882 bits (150), Expect = 2.327e-10
Identity = 34/101 (33.66%), Postives = 52/101 (51.49%), Query Frame = 1
Query:  100 TFSSPESAFYEYQIKMENQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            T +S E A      ++E   C++C   ++G H+G   CE CK FF+R   N  +     ++NC +++  R +C  CR QKCL +GM      FG  S K +
Sbjct:    1 TCTSCEYAGLCVSAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQR 101          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Sea Lamprey
Match: ESR2 (estrogen receptor 2 [Source:HGNC Symbol;Acc:HGNC:3468])

HSP 1 Score: 76.2554 bits (186), Expect = 4.017e-15
Identity = 77/293 (26.28%), Postives = 127/293 (43.34%), Query Frame = 1
Query:  412 CRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSSPSTLDIPYHEISSRISESNSD---GNQRSISYSIPSTPVPXXXXXXXXXXPDGHSQAFCSKLIEAIKILQKPLLEAE--KLFHMTRFPVH--RNQSLLEVWNSMMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLA-RSYEED------KDEFFNYFDFSK--------DEYEVILFHFPE 1224
            C VCG  SSG+H+G  TCEGCK FF+R+   K+   C +   +C ID + +  C+ CR  +C + GM + G       + +     ++ +    +N+S    +    +  +      SD   G  RS   ++P                  H+       +E + I+   LLEAE  KL  M R P       S++ ++  +     VH   +V +AKK+PGF +L L  K  +++++   +++  L  RS E+        D  F   D S+        D+   I+ HF E
Sbjct:    5 CSVCGDFSSGYHYGVWTCEGCKAFFKRSVQGKNNFVCPATN-HCTIDKTRRRRCQACRLRKCYEAGMIRDGC---HSRDRILLCMVIKSLKQLEKNASHGIRNTTSAQTPTGYRGFKSDARRGGIRSFGGAVP------------------HAH------VEGMGIIH-ILLEAEPPKLLCM-RSPGEPLTEASMMTLFTDLATKEMVH---IVSWAKKIPGFMELDLPVKIQLLENSWVEVLITGLIWRSMEQQDTLVFASDLVFTRADGSRMEGTMEIFDQVLAIVTHFRE 264          

HSP 2 Score: 66.2402 bits (160), Expect = 7.848e-12
Identity = 28/69 (40.58%), Postives = 39/69 (56.52%), Query Frame = 1
Query:  151 NQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGM 357
             QLC VC   ++G+H+G + CE CK FFKR    + N       +C ++K  RR+C  CR +KC   GM
Sbjct:    2 TQLCSVCGDFSSGYHYGVWTCEGCKAFFKRSVQGKNNFVCPATNHCTIDKTRRRRCQACRLRKCYEAGM 70          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Sea Lamprey
Match: nr1d2a (nuclear receptor subfamily 1, group D, member 2a [Source:ZFIN;Acc:ZDB-GENE-040504-1])

HSP 1 Score: 73.9442 bits (180), Expect = 7.692e-14
Identity = 40/98 (40.82%), Postives = 54/98 (55.10%), Query Frame = 1
Query:  412 CRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSS 705
            C+VCG  +SGFH+G   CEGCKGFFRR+     K +       C I  +++  C+ CR+ +C+ VGMSK   R GR P   K     E+ +  N  SS
Sbjct:  122 CKVCGDAASGFHYGVHACEGCKGFFRRSIQQNIKYKPCLKNETCPIVRANRNRCQHCRFKKCLSVGMSKDAVRFGRIPKREKLRLMEEVQNALNSASS 219          

HSP 2 Score: 68.9366 bits (167), Expect = 2.521e-12
Identity = 42/124 (33.87%), Postives = 63/124 (50.81%), Query Frame = 1
Query:   55 VQSVILKTNTMLNNATFSSPESAF-YEYQIKMENQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKN--CDLEKIGRRKCSFCRYQKCLNVGMKFFGLRSNKSKIDISQIPCR 417
            V S+  + +T+L +  +  P  A      I     LC+VC   A+GFH+G + CE CK FF+R     +  K  C KN  C + +  R +C  CR++KCL+VGM       +K  +   +IP R
Sbjct:   86 VTSLPARQDTVLQDHLYCPPAGASPGSVAINGVVLLCKVCGDAASGFHYGVHACEGCKGFFRRSIQQNIKYK-PCLKNETCPIVRANRNRCQHCRFKKCLSVGM-------SKDAVRFGRIPKR 201          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Sea Lamprey
Match: ESR2 (estrogen receptor 2 [Source:HGNC Symbol;Acc:HGNC:3468])

HSP 1 Score: 72.0182 bits (175), Expect = 9.967e-14
Identity = 76/280 (27.14%), Postives = 117/280 (41.79%), Query Frame = 1
Query:  412 CRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSSP--STLDIPYHEISSRISESNSDGNQRSISYSIPSTPVPXXXXXXXXXXPDGHSQAFCSKLIEAIKILQKPLLEAE--KLFHMTRFPVH--RNQSLLEVWNSMMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLA-RSYEED------KDEFFNYFDFSKDEYEVILF 1212
            C VCG  SSG+H+G  TCEGCK FF+R+   K+   C +   +C ID + +  C+ CR  +C + GM        R    +   C+  +     R+S     +L  PY       S  +     +S+   I   P                            K LQ  LLEAE  KL  M R P       S++ ++  +     VH   +V +AKK+PGF +L L  K  +++++   +++  L  RS E+        D  F   D S+ E  + +F
Sbjct:   12 CSVCGDFSSGYHYGVWTCEGCKAFFKRSVQGKNNFVCPATN-HCTIDKTRRRRCQACRLRKCYEAGMI-------RDVPLLATACSSRLTRLARRHSPACHGSLAAPY-------STHSPSLPLQSLLLRIQLLP----------------------------KHLQAILLEAEPPKLLCM-RSPGEPLTEASMMTLFTDLATKEMVH---IVSWAKKIPGFMELDLPVKIQLLENSWVEVLITGLIWRSMEQQDTLVFASDLVFTRADGSRMEGTMEIF 244          

HSP 2 Score: 66.2402 bits (160), Expect = 6.918e-12
Identity = 28/69 (40.58%), Postives = 39/69 (56.52%), Query Frame = 1
Query:  151 NQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGM 357
             QLC VC   ++G+H+G + CE CK FFKR    + N       +C ++K  RR+C  CR +KC   GM
Sbjct:    9 TQLCSVCGDFSSGYHYGVWTCEGCKAFFKRSVQGKNNFVCPATNHCTIDKTRRRRCQACRLRKCYEAGM 77          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Nematostella
Match: EDO39982 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8G8])

HSP 1 Score: 80.1073 bits (196), Expect = 4.588e-16
Identity = 67/263 (25.48%), Postives = 102/263 (38.78%), Query Frame = 1
Query:  412 CRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHY--------------QNRNSSPSTLDIPYHEISSRISESNSDGNQ--------RSISYSIPSTPVPXXXXXXXXXXPDGHSQAFCSKLIEAIKILQKPLLEAEKLFHMTRFPVHRNQSLLEVWNSMMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLA 1134
            C VC  K++G+H+G  TCEGCKGFF+R    + +  C  G  +C I+   +  C++CR+ +C+K GM K   R  R P     H +L+                  QN  SSP   D P   +      S  D N+        R     IP +PV           P+G   A                      F + +   +  Q L +V               + + K VPGF +L L D+ T+++ +   + +  LA
Sbjct:    4 CVVCNDKATGYHYGVFTCEGCKGFFKRTVQKQLEYTC-RGNQDCDINQHTRNRCQYCRFEKCVKSGMLKQAVRDDRTPGGRHRHASLQDHRQKKQKLQGKAPKELPQNGLSSPEGPDTPEGVV------SKEDENEFLIYIQQLRHDVDVIPDSPV---------KPPEGSPAAG---------------------FSVDKLMQYGYQELYQV---------------IQWGKNVPGFRELKLEDQITLLKTSFMDLNVFRLA 214          

HSP 2 Score: 72.0182 bits (175), Expect = 1.976e-13
Identity = 30/77 (38.96%), Postives = 46/77 (59.74%), Query Frame = 1
Query:  157 LCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKFFGLRSNKS 387
            LC VCN  A G+H+G + CE CK FFKR    QL       ++CD+ +  R +C +CR++KC+  GM    +R +++
Sbjct:    3 LCVVCNDKATGYHYGVFTCEGCKGFFKRTVQKQLEYTCRGNQDCDINQHTRNRCQYCRFEKCVKSGMLKQAVRDDRT 79          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Nematostella
Match: EDO27017 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAF5])

HSP 1 Score: 77.7962 bits (190), Expect = 8.686e-16
Identity = 35/87 (40.23%), Postives = 54/87 (62.07%), Query Frame = 1
Query:  391 IDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNA 651
            +  SQ  C +CG +SSGFH+G  +CEGCK FF+R    + +  CV  K +C ID ++++ C++CR+ +C+ +GM K   R  R P  
Sbjct:    7 VTSSQRVCAICGDRSSGFHYGVQSCEGCKSFFKRTVQKQLQYACVESK-SCQIDKNNRIRCQYCRFQKCLALGMLKEAVREDRAPGG 92          

HSP 2 Score: 72.7886 bits (177), Expect = 3.348e-14
Identity = 31/85 (36.47%), Postives = 50/85 (58.82%), Query Frame = 1
Query:  133 YQIKMENQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKFFGLRSNKS 387
            + +    ++C +C   ++GFH+G   CE CK FFKR    QL    V  K+C ++K  R +C +CR+QKCL +GM    +R +++
Sbjct:    5 FLVTSSQRVCAICGDRSSGFHYGVQSCEGCKSFFKRTVQKQLQYACVESKSCQIDKNNRIRCQYCRFQKCLALGMLKEAVREDRA 89          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Nematostella
Match: EDO42195 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S286])

HSP 1 Score: 78.9518 bits (193), Expect = 9.059e-16
Identity = 35/84 (41.67%), Postives = 53/84 (63.10%), Query Frame = 1
Query:  400 SQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNA 651
            SQ  C +CG +SSGFH+G  +CEGCK FF+R    + +  CV  K +C ID ++++ C++CR+ +C+ +GM K   R  R P  
Sbjct:   10 SQRVCAICGDRSSGFHYGVQSCEGCKSFFKRTVQKQLQYACVESK-SCQIDKNNRIRCQYCRFQKCLALGMLKEAVREDRAPGG 92          

HSP 2 Score: 72.4034 bits (176), Expect = 1.224e-13
Identity = 31/85 (36.47%), Postives = 50/85 (58.82%), Query Frame = 1
Query:  133 YQIKMENQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKFFGLRSNKS 387
            + +    ++C +C   ++GFH+G   CE CK FFKR    QL    V  K+C ++K  R +C +CR+QKCL +GM    +R +++
Sbjct:    5 FLVTSSQRVCAICGDRSSGFHYGVQSCEGCKSFFKRTVQKQLQYACVESKSCQIDKNNRIRCQYCRFQKCLALGMLKEAVREDRA 89          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Nematostella
Match: EDO37645 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF49])

HSP 1 Score: 78.5666 bits (192), Expect = 1.357e-15
Identity = 37/83 (44.58%), Postives = 51/83 (61.45%), Query Frame = 1
Query:  403 QIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNA 651
            Q+ C VCG KSSG H+G  TCEGCK FF+R+        C + + +C ID  H+  C++CR  +C+KVGM +   + GR P A
Sbjct:   25 QVECAVCGDKSSGKHYGVFTCEGCKSFFKRSVRRNLTYTCRASR-DCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRIPAA 106          

HSP 2 Score: 68.9366 bits (167), Expect = 1.997e-12
Identity = 41/143 (28.67%), Postives = 66/143 (46.15%), Query Frame = 1
Query:   82 TMLNNATFSSPESAFYEYQIKMENQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKFFGLRSNKSKIDISQIPCR---VCGGKSSGFHFGSLTCEGCKGFFRRAEP 501
            T     +  +PE +    Q++     C VC   ++G H+G + CE CK FFKR     L       ++C +++  R +C +CR +KCL VGM+   ++  + +I  +Q P +   + G    G   G     G      RAEP
Sbjct:    7 TTWTRDSTETPEDSEKNVQVE-----CAVCGDKSSGKHYGVFTCEGCKSFFKRSVRRNLTYTCRASRDCPIDQHHRNQCQYCRLKKCLKVGMRREAVQ--RGRIPAAQTPTQNAALPGINGDGSTNGHSYLSGFIALLLRAEP 142          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Nematostella
Match: EDO42277 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1X4])

HSP 1 Score: 74.3294 bits (181), Expect = 4.788e-14
Identity = 37/82 (45.12%), Postives = 49/82 (59.76%), Query Frame = 1
Query:  406 IPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNA 651
            I C VCG KSSG H+G  TCEGCK FF+R+        C  G  NC +D  ++  C++CR  +C+KVGM K   + GR P+ 
Sbjct:   30 IDCAVCGDKSSGKHYGVYTCEGCKSFFKRSIRRSLSYSC-RGVRNCPVDIQNRNQCQYCRLKKCLKVGMRKEAVQKGRIPST 110          

HSP 2 Score: 63.1586 bits (152), Expect = 1.553e-10
Identity = 28/67 (41.79%), Postives = 39/67 (58.21%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMK 360
            C VC   ++G H+G Y CE CK FFKR     L+      +NC ++   R +C +CR +KCL VGM+
Sbjct:   32 CAVCGDKSSGKHYGVYTCEGCKSFFKRSIRRSLSYSCRGVRNCPVDIQNRNQCQYCRLKKCLKVGMR 98          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Medaka
Match: roraa (RAR related orphan receptor A [Source:NCBI gene;Acc:101167704])

HSP 1 Score: 93.5893 bits (231), Expect = 1.353e-19
Identity = 43/95 (45.26%), Postives = 63/95 (66.32%), Query Frame = 1
Query:  355 MKFFGLRSNKSKIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGR 639
            M +F + + K++I+I  IPC++CG KSSG H+G +TCEGCKGFFRR++       C   K NC+ID + +  C+ CR  +C+ VGMS+   + GR
Sbjct:    1 MMYFVISAMKAQIEI--IPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNAAYSCPRQK-NCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGR 92          

HSP 2 Score: 63.929 bits (154), Expect = 3.017e-10
Identity = 33/83 (39.76%), Postives = 47/83 (56.63%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVC--KKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            C++C   ++G H+G   CE CK FF+R  + Q N+   C  +KNC +++  R +C  CR QKCL VGM      FG  S K +
Sbjct:   18 CKICGDKSSGIHYGVITCEGCKGFFRR--SQQSNAAYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQR 98          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Medaka
Match: PPARA (peroxisome proliferator-activated receptor alpha [Source:NCBI gene;Acc:100304467])

HSP 1 Score: 92.4337 bits (228), Expect = 2.737e-19
Identity = 72/257 (28.02%), Postives = 116/257 (45.14%), Query Frame = 1
Query:  406 IPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSSPSTLDIPYHEISSRISES------NSDGNQRSISYSIPSTPVPXXXXXXXXXXPDGHSQAFCSKLIEAIKILQKPLLEAE-KLFHMTRFPVHRNQSLLEVWNSMMRHFDVHTCI-LVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEED 1152
            + CRVC  ++SG+H+G   CEGCKGFFRR   ++ KLE    +  C I   ++  C++CR+ +C+ VGMS    R GR P + K     E++  +     P   D     ++ +I ++       +    R++     STP      M      +   Q   +K++ +   L+    EAE ++FH  +                     V T   L  FAK VPGF  L L+D+ T+++  +Y  +   LA S  +D
Sbjct:  101 LECRVCADRASGYHYGVHACEGCKGFFRRT--IRLKLEYDKCERRCKIQKKNRNKCQYCRFQKCLAVGMSHNAIRFGRMPQSEKLKLKAEMVVGEREVEDPQLAD--QKSLAKQIYDAYLKNFNMTKAKARTVLTGKTSTPPFVIHDMETLQRAE---QTLVAKMVGSTGALKDR--EAEVRIFHCCQCT------------------SVETVTELTEFAKSVPGFAALDLNDQVTLLKYGVYEALFALLASSMNKD 330          

HSP 2 Score: 70.4774 bits (171), Expect = 3.218e-12
Identity = 32/75 (42.67%), Postives = 46/75 (61.33%), Query Frame = 1
Query:  151 NQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKFFGLR 375
            N  C+VC   A+G+H+G + CE CK FF+R    +L     C++ C ++K  R KC +CR+QKCL VGM    +R
Sbjct:  100 NLECRVCADRASGYHYGVHACEGCKGFFRRTIRLKLEYDK-CERRCKIQKKNRNKCQYCRFQKCLAVGMSHNAIR 173          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Medaka
Match: PPARA (peroxisome proliferator-activated receptor alpha [Source:NCBI gene;Acc:100304467])

HSP 1 Score: 92.4337 bits (228), Expect = 2.737e-19
Identity = 72/257 (28.02%), Postives = 116/257 (45.14%), Query Frame = 1
Query:  406 IPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSSPSTLDIPYHEISSRISES------NSDGNQRSISYSIPSTPVPXXXXXXXXXXPDGHSQAFCSKLIEAIKILQKPLLEAE-KLFHMTRFPVHRNQSLLEVWNSMMRHFDVHTCI-LVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEED 1152
            + CRVC  ++SG+H+G   CEGCKGFFRR   ++ KLE    +  C I   ++  C++CR+ +C+ VGMS    R GR P + K     E++  +     P   D     ++ +I ++       +    R++     STP      M      +   Q   +K++ +   L+    EAE ++FH  +                     V T   L  FAK VPGF  L L+D+ T+++  +Y  +   LA S  +D
Sbjct:  101 LECRVCADRASGYHYGVHACEGCKGFFRRT--IRLKLEYDKCERRCKIQKKNRNKCQYCRFQKCLAVGMSHNAIRFGRMPQSEKLKLKAEMVVGEREVEDPQLAD--QKSLAKQIYDAYLKNFNMTKAKARTVLTGKTSTPPFVIHDMETLQRAE---QTLVAKMVGSTGALKDR--EAEVRIFHCCQCT------------------SVETVTELTEFAKSVPGFAALDLNDQVTLLKYGVYEALFALLASSMNKD 330          

HSP 2 Score: 70.4774 bits (171), Expect = 3.218e-12
Identity = 32/75 (42.67%), Postives = 46/75 (61.33%), Query Frame = 1
Query:  151 NQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKFFGLR 375
            N  C+VC   A+G+H+G + CE CK FF+R    +L     C++ C ++K  R KC +CR+QKCL VGM    +R
Sbjct:  100 NLECRVCADRASGYHYGVHACEGCKGFFRRTIRLKLEYDK-CERRCKIQKKNRNKCQYCRFQKCLAVGMSHNAIR 173          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Medaka
Match: rorb (RAR related orphan receptor B [Source:NCBI gene;Acc:101155775])

HSP 1 Score: 90.8929 bits (224), Expect = 9.834e-19
Identity = 44/140 (31.43%), Postives = 73/140 (52.14%), Query Frame = 1
Query:  388 KIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSSPSTLDIPYHEISSRISESNSDGNQRSISYSIPST 807
            +  I  IPC++CG KSSG H+G +TCEGCKGFFRR++       C   + NC+ID +++  C+ CR  +C+ +GMS+   + GR     +     E+  +Q R            E  +R+  ++      ++++ I  T
Sbjct:    2 RAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQR-NCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQARLQEQRQQQTGEAEALARVYSTSLTNGLSTLNHEIGGT 140          

HSP 2 Score: 63.929 bits (154), Expect = 3.155e-10
Identity = 29/81 (35.80%), Postives = 44/81 (54.32%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            C++C   ++G H+G   CE CK FF+R   N  +     ++NC +++  R +C  CR QKCL +GM      FG  S K +
Sbjct:   10 CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQR 90          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Medaka
Match: rorb (RAR related orphan receptor B [Source:NCBI gene;Acc:101155775])

HSP 1 Score: 90.5077 bits (223), Expect = 1.125e-18
Identity = 45/143 (31.47%), Postives = 76/143 (53.15%), Query Frame = 1
Query:  379 NKSKIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSSPSTLDIPYHEISSRISESNSDGNQRSISYSIPST 807
            N  +I++  IPC++CG KSSG H+G +TCEGCKGFFRR++       C   + NC+ID +++  C+ CR  +C+ +GMS+   + GR     +     E+  +Q R            E  +R+  ++      ++++ I  T
Sbjct:    7 NTPQIEV--IPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQR-NCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQARLQEQRQQQTGEAEALARVYSTSLTNGLSTLNHEIGGT 146          

HSP 2 Score: 63.929 bits (154), Expect = 3.174e-10
Identity = 29/81 (35.80%), Postives = 44/81 (54.32%), Query Frame = 1
Query:  160 CQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKF----FGLRSNKSK 390
            C++C   ++G H+G   CE CK FF+R   N  +     ++NC +++  R +C  CR QKCL +GM      FG  S K +
Sbjct:   16 CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQR 96          
BLAST of Nuclear receptor 2DBD gamma vs. Planmine SMEST
Match: SMESG000007787.1 (SMESG000007787.1)

HSP 1 Score: 1137.87 bits (2942), Expect = 0.000e+0
Identity = 560/563 (99.47%), Postives = 560/563 (99.47%), Query Frame = 1
Query:   25 MSFQKLDKNKVQSVILKTNTMLNNATFSSPESAFYEYQIKMENQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKFFGLRSNKSKIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSSPSTLDIPYHEISSRISESNSDGNQRSISYSIPSTPVPXXXXXXXXXXPDGHSQAFCSKLIEAIKILQKPLLEAEKLFHMTRFPVHRNQSLLEVWNSMMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEEDKDEFFNYFDFSKDEYEVILFHFPEMKKILAHVMEISRIIYKLNITKDQIGLLCIIELSKNYINLESFDAVRTIHKEVVRLFWISILKELDNEALLTEPGNPPSLPQMSVLLQVLNCPDDLISQIVFKIPKCTENKWCQKLHIIFKVLGEKLQEFNIEHQMIIDELKRNKPELPYPELYTEMFQLTAF 1713
            MSFQKLDKNKVQSVILKTNTMLNNATFSSPESAFYEYQIKMENQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKFFGLRSNKS IDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSSPSTLDIPYHEI S ISESNSDGNQRSISYSIPSTPVPSEWSMSFSSSPDGHSQAFCSKLIEAIKILQKPLLEAEKLFHMTRFPVHRNQSLLEVWNSMMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEEDKDEFFNYFDFSKDEYEVILFHFPEMKKILAHVMEISRIIYKLNITKDQIGLLCIIELSKNYINLESFDAVRTIHKEVVRLFWISILKELDNEALLTEPGNPPSLPQMSVLLQVLNCPDDLISQIVFKIPKCTENKWCQKLHIIFKVLGEKLQEFNIEHQMIIDELKRNKPELPYPELYTEMFQLTAF
Sbjct:    1 MSFQKLDKNKVQSVILKTNTMLNNATFSSPESAFYEYQIKMENQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSFCRYQKCLNVGMKFFGLRSNKSNIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSSPSTLDIPYHEICSSISESNSDGNQRSISYSIPSTPVPSEWSMSFSSSPDGHSQAFCSKLIEAIKILQKPLLEAEKLFHMTRFPVHRNQSLLEVWNSMMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEEDKDEFFNYFDFSKDEYEVILFHFPEMKKILAHVMEISRIIYKLNITKDQIGLLCIIELSKNYINLESFDAVRTIHKEVVRLFWISILKELDNEALLTEPGNPPSLPQMSVLLQVLNCPDDLISQIVFKIPKCTENKWCQKLHIIFKVLGEKLQEFNIEHQMIIDELKRNKPELPYPELYTEMFQLTAF 563          
BLAST of Nuclear receptor 2DBD gamma vs. Planmine SMEST
Match: SMESG000008787.1 (SMESG000008787.1)

HSP 1 Score: 390.193 bits (1001), Expect = 5.616e-125
Identity = 236/558 (42.29%), Postives = 315/558 (56.45%), Query Frame = 1
Query:  100 TFSSPESAFYEYQIKMENQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKN--CDLEKIGRRKCSFCRYQKCLNVGMKFFGLRSNKSKIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRAEPLKDKLECVSGKLN-CVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEIIHYQNRNSSPSTLDIPYHEISSRISESNSDGNQRSISYSIPSTPVPXXXXXXXXXXPDGHSQA-------FCSKLI----EAIKILQKPLLEAEKLFHMTRFPVH---------RNQSLLEVWNSMMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEEDKDEFFNYFDFSKDEYEVILFHFPEMKKILAHVMEISRIIYKLNITKDQIGLLCIIELSKNYINLESFDAVRTIHKEVVRLFWISILKELDNEALLTEPGNPPSLPQMSVLLQVLNCPDDLISQIVFKIPKCTENKWCQKLHIIFKVLGEKLQEFNIEHQMIIDELKRNKPELPYPELYTEMFQL 1704
            TF+SPESAFY+YQ KME+QLCQVC   AAGFHHGAYVCEACKKFF R++ N     + C     C   K GR KC  CR++KC+++GM      +  SK DIS+IPCRVCGGKSSGFHFG+LTCEGCKGFFRR E  K  L C++G  + C+  SS +  CK CR++RC+ VGMSK GSRIGRQPNAVK HC LEI+          T D          SES +D ++R   +      V  +   +       H          F +K I    E   I +  L EA ++  +++  +          +  +L ++WN MM +FDVH+ ++V F K +PGFN   L  +R++VQDAMY IMLL LA+ Y+ D DE +NYFDFS  + EVIL +F   K+I  H++ ISR+++ L ++   I LLC+ EL KNY  L   +  + I  +   L W+ +    +NE      GN      ++   ++LN P           PK       QK   IF+ + + L E N EH  II ELK   PEL +PELY +MF +
Sbjct:  152 TFTSPESAFYDYQQKMESQLCQVCRESAAGFHHGAYVCEACKKFFMRHNLNSTKFTIPCPTGGQCAQLKTGRIKCQSCRFKKCVSIGMALQNPNNGNSKFDISKIPCRVCGGKSSGFHFGALTCEGCKGFFRRTESTKQHLACITGNNDCCLTGSSSRNLCKSCRFNRCLGVGMSKKGSRIGRQPNAVKFHCVLEIMQ--------RTCD-----QYDGASESANDNSKRKSVFHRAYRKVCQQSQKNLIRCSQNHFDKLKNDLSIFDTKDIFYSNEEKFIFESSLKEATRIIEISKANLQDLSSRQFSKKYLTLNDLWNYMMNNFDVHSAMIVQFVKAIPGFNKFELKSRRSLVQDAMYPIMLLKLAQDYKPDVDE-YNYFDFSLIDREVILNNFQSFKRITDHLLSISRMVHSLQLSSYPISLLCVTELMKNYHLLSDEEEGKRILNQAKSLLWLFL---ENNEVEDNTIGN------LTKQTEMLNLP-----------PKNY-----QKYIKIFEEMPKLLSEMNSEHLKIIQELKYLHPELLFPELYIDMFNI 670          
BLAST of Nuclear receptor 2DBD gamma vs. Planmine SMEST
Match: SMESG000020242.1 (SMESG000020242.1)

HSP 1 Score: 205.682 bits (522), Expect = 2.179e-55
Identity = 129/293 (44.03%), Postives = 165/293 (56.31%), Query Frame = 1
Query:   28 SFQKLDKNKVQSVILKTNTMLNNATFSSPESAF-------YEYQIKMENQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKN--CDLEKIGRRKCSFCRYQKCLNVGMKFFGLRSNKSKIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRA--EPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEII---------HYQNRNS-SPSTLD-------IPYHEISSRISESNSDGN--QRSISYSIPSTPVP 816
            S+ K D++ V    LK  T  N  +  +P SA        Y Y+   E + C VC  ++AGFH  A+VCEACKKFF R S     +K  C KN  C++ K  R  C +CR+QKCL++GM   G   N++  DIS IPCRVCG +SSGFHFG++TCEGCKGFFRR   E    K  C +G  NCVI+ + +  CK CRY +C+ +GMSK GSRIGRQPNA+KH CA EI          H+ N NS S    D       +P H  S+ +S  N D N       Y   + P+P
Sbjct:  211 SYLKYDQSPVGWYKLKEETRPN-CSVPTPLSADQLSNGYDYNYREMKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMTLPGANLNQN-TDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGG-NCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRAGLALNHFSNNNSHSIGHTDSGMIQAYLPNHLSSAIMSTMNLDFNLTNGQTRYQQTTAPLP 500          

HSP 2 Score: 106.301 bits (264), Expect = 3.072e-23
Identity = 75/239 (31.38%), Postives = 111/239 (46.44%), Query Frame = 1
Query:  982 VWNSMMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEEDKDEFFNYFDFSKDEYEVILFHFPEMKKILAHVMEISRIIYKLNITKDQIGLLCIIELSKNYINLESFDAVRTIHKEVVRLFWISILKELDNEALLTEPGNPPSLPQMSVLLQVLNCPDDLISQIVFKIPKCTENKWCQKLHIIFKVLGEKLQEFNIEHQMIIDELKRNKPELPYPELYTEMF 1698
            VW+ MM+HF  H   ++ FAK VPGF +L  +D + +VQ+ MY I+L+ L+R +    DE FNYF+FS  E E+IL  F    KI  HVM+  R+I   N+      L+C +EL K        ++     +  V   +   +  L  +  +TE G+                               T+N+    L  IF VL +       EHQ  +  L+ +KP L +P LYT+MF
Sbjct:  679 VWDVMMQHFQAHAIQVIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDE-FNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKG-------ESCSVFDRNKVNQMYQYSMNAL--KLYMTEIGS-------------------------------TQNEIDSVLE-IFPVLSKMTH----EHQEAVMMLRTSKPHLKFPNLYTQMF 871          
BLAST of Nuclear receptor 2DBD gamma vs. Planmine SMEST
Match: SMESG000020242.1 (SMESG000020242.1)

HSP 1 Score: 205.682 bits (522), Expect = 2.254e-55
Identity = 129/293 (44.03%), Postives = 165/293 (56.31%), Query Frame = 1
Query:   28 SFQKLDKNKVQSVILKTNTMLNNATFSSPESAF-------YEYQIKMENQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKN--CDLEKIGRRKCSFCRYQKCLNVGMKFFGLRSNKSKIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRA--EPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEII---------HYQNRNS-SPSTLD-------IPYHEISSRISESNSDGN--QRSISYSIPSTPVP 816
            S+ K D++ V    LK  T  N  +  +P SA        Y Y+   E + C VC  ++AGFH  A+VCEACKKFF R S     +K  C KN  C++ K  R  C +CR+QKCL++GM   G   N++  DIS IPCRVCG +SSGFHFG++TCEGCKGFFRR   E    K  C +G  NCVI+ + +  CK CRY +C+ +GMSK GSRIGRQPNA+KH CA EI          H+ N NS S    D       +P H  S+ +S  N D N       Y   + P+P
Sbjct:  229 SYLKYDQSPVGWYKLKEETRPN-CSVPTPLSADQLSNGYDYNYREMKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMTLPGANLNQN-TDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGG-NCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRAGLALNHFSNNNSHSIGHTDSGMIQAYLPNHLSSAIMSTMNLDFNLTNGQTRYQQTTAPLP 518          

HSP 2 Score: 106.301 bits (264), Expect = 3.217e-23
Identity = 75/239 (31.38%), Postives = 111/239 (46.44%), Query Frame = 1
Query:  982 VWNSMMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEEDKDEFFNYFDFSKDEYEVILFHFPEMKKILAHVMEISRIIYKLNITKDQIGLLCIIELSKNYINLESFDAVRTIHKEVVRLFWISILKELDNEALLTEPGNPPSLPQMSVLLQVLNCPDDLISQIVFKIPKCTENKWCQKLHIIFKVLGEKLQEFNIEHQMIIDELKRNKPELPYPELYTEMF 1698
            VW+ MM+HF  H   ++ FAK VPGF +L  +D + +VQ+ MY I+L+ L+R +    DE FNYF+FS  E E+IL  F    KI  HVM+  R+I   N+      L+C +EL K        ++     +  V   +   +  L  +  +TE G+                               T+N+    L  IF VL +       EHQ  +  L+ +KP L +P LYT+MF
Sbjct:  697 VWDVMMQHFQAHAIQVIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDE-FNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKG-------ESCSVFDRNKVNQMYQYSMNAL--KLYMTEIGS-------------------------------TQNEIDSVLE-IFPVLSKMTH----EHQEAVMMLRTSKPHLKFPNLYTQMF 889          
BLAST of Nuclear receptor 2DBD gamma vs. Planmine SMEST
Match: SMESG000020242.1 (SMESG000020242.1)

HSP 1 Score: 205.297 bits (521), Expect = 2.919e-55
Identity = 129/293 (44.03%), Postives = 165/293 (56.31%), Query Frame = 1
Query:   28 SFQKLDKNKVQSVILKTNTMLNNATFSSPESAF-------YEYQIKMENQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKN--CDLEKIGRRKCSFCRYQKCLNVGMKFFGLRSNKSKIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRA--EPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEII---------HYQNRNS-SPSTLD-------IPYHEISSRISESNSDGN--QRSISYSIPSTPVP 816
            S+ K D++ V    LK  T  N  +  +P SA        Y Y+   E + C VC  ++AGFH  A+VCEACKKFF R S     +K  C KN  C++ K  R  C +CR+QKCL++GM   G   N++  DIS IPCRVCG +SSGFHFG++TCEGCKGFFRR   E    K  C +G  NCVI+ + +  CK CRY +C+ +GMSK GSRIGRQPNA+KH CA EI          H+ N NS S    D       +P H  S+ +S  N D N       Y   + P+P
Sbjct:  211 SYLKYDQSPVGWYKLKEETRPN-CSVPTPLSADQLSNGYDYNYREMKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMTLPGANLNQN-TDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGG-NCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRAGLALNHFSNNNSHSIGHTDSGMIQAYLPNHLSSAIMSTMNLDFNLTNGQTRYQQTTAPLP 500          

HSP 2 Score: 105.916 bits (263), Expect = 3.372e-23
Identity = 75/239 (31.38%), Postives = 111/239 (46.44%), Query Frame = 1
Query:  982 VWNSMMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEEDKDEFFNYFDFSKDEYEVILFHFPEMKKILAHVMEISRIIYKLNITKDQIGLLCIIELSKNYINLESFDAVRTIHKEVVRLFWISILKELDNEALLTEPGNPPSLPQMSVLLQVLNCPDDLISQIVFKIPKCTENKWCQKLHIIFKVLGEKLQEFNIEHQMIIDELKRNKPELPYPELYTEMF 1698
            VW+ MM+HF  H   ++ FAK VPGF +L  +D + +VQ+ MY I+L+ L+R +    DE FNYF+FS  E E+IL  F    KI  HVM+  R+I   N+      L+C +EL K        ++     +  V   +   +  L  +  +TE G+                               T+N+    L  IF VL +       EHQ  +  L+ +KP L +P LYT+MF
Sbjct:  685 VWDVMMQHFQAHAIQVIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDE-FNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKG-------ESCSVFDRNKVNQMYQYSMNAL--KLYMTEIGS-------------------------------TQNEIDSVLE-IFPVLSKMTH----EHQEAVMMLRTSKPHLKFPNLYTQMF 877          
The following BLAST results are available for this feature:
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RORA1.449e-1945.26RAR related orphan receptor A [Source:HGNC Symbol;... [more]
PPARG1.491e-1928.13peroxisome proliferator activated receptor gamma [... [more]
PPARG3.545e-1928.40peroxisome proliferator activated receptor gamma [... [more]
PPARG7.034e-1948.35peroxisome proliferator activated receptor gamma [... [more]
PPARG7.295e-1948.35peroxisome proliferator activated receptor gamma [... [more]
back to top
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nhr-231.082e-2047.96Nuclear hormone receptor family member nhr-23 [So... [more]
nhr-231.102e-2047.96Nuclear hormone receptor family member nhr-23 [So... [more]
nhr-231.358e-2047.96Nuclear hormone receptor family member nhr-23 [So... [more]
nhr-237.216e-1949.38Nuclear hormone receptor family member nhr-23 [So... [more]
nhr-237.637e-1949.38Nuclear hormone receptor family member nhr-23 [So... [more]
back to top
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hr32.251e-2125.60gene:FBgn0000448 transcript:FBtr0112799[more]
Hr32.658e-2125.76gene:FBgn0000448 transcript:FBtr0088368[more]
Hr32.658e-2125.76gene:FBgn0000448 transcript:FBtr0306345[more]
Hr35.712e-2125.93gene:FBgn0000448 transcript:FBtr0330609[more]
Hr32.113e-2025.69gene:FBgn0000448 transcript:FBtr0088366[more]
back to top
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rorca4.521e-2036.17RAR-related orphan receptor C a [Source:ZFIN;Acc:Z... [more]
rorca5.541e-2036.17RAR-related orphan receptor C a [Source:ZFIN;Acc:Z... [more]
roraa1.773e-1945.26RAR-related orphan receptor A, paralog a [Source:N... [more]
rorab3.607e-1934.72RAR-related orphan receptor A, paralog b [Source:N... [more]
rorab1.301e-1834.75RAR-related orphan receptor A, paralog b [Source:N... [more]
back to top
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctr94.768e-2121.18CTR9 homolog, Paf1/RNA polymerase II complex compo... [more]
ctr95.026e-2121.04CTR9 homolog, Paf1/RNA polymerase II complex compo... [more]
ctr95.848e-2121.04CTR9 homolog, Paf1/RNA polymerase II complex compo... [more]
ctr96.396e-2121.18CTR9 homolog, Paf1/RNA polymerase II complex compo... [more]
ctr97.868e-2121.18CTR9 homolog, Paf1/RNA polymerase II complex compo... [more]
back to top
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pparg2.865e-1948.35peroxisome proliferator activated receptor gamma [... [more]
Rora3.309e-1945.16RAR-related orphan receptor alpha [Source:MGI Symb... [more]
Pparg6.122e-1928.79peroxisome proliferator activated receptor gamma [... [more]
Pparg6.122e-1928.79peroxisome proliferator activated receptor gamma [... [more]
Pparg1.083e-1828.79peroxisome proliferator activated receptor gamma [... [more]
back to top
BLAST of Nuclear receptor 2DBD gamma vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P31396|HR3_DROME2.664e-2025.76Probable nuclear hormone receptor HR3 OS=Drosophil... [more]
sp|P41828|NHR23_CAEEL1.727e-1947.96Nuclear hormone receptor family member nhr-23 OS=C... [more]
sp|P49868|HR3_GALME1.959e-1924.18Probable nuclear hormone receptor HR3 OS=Galleria ... [more]
sp|O35507|PPARA_CAVPO5.004e-1926.20Peroxisome proliferator-activated receptor alpha O... [more]
sp|F1QLY4|RORAA_DANRE1.338e-1845.26Nuclear receptor ROR-alpha A OS=Danio rerio OX=795... [more]
back to top
BLAST of Nuclear receptor 2DBD gamma vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564Y0P12.376e-7254.70Uncharacterized protein (Fragment) OS=Hymenolepis ... [more]
A0A0R3TT294.178e-7259.33Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A158QEI51.420e-7154.70Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A3Q8VLE62.367e-7161.862DBD nuclear receptor alpha OS=Echinococcus granul... [more]
A0A068WW593.934e-7161.86Nuclear receptor 2DBD gamma OS=Echinococcus granul... [more]
back to top
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rorca1.818e-2136.03nuclear receptor ROR-beta-like [Source:NCBI gene;A... [more]
rorca6.009e-2135.56nuclear receptor ROR-beta-like [Source:NCBI gene;A... [more]
rorca1.437e-2036.43nuclear receptor ROR-beta-like [Source:NCBI gene;A... [more]
roraa2.820e-1945.26nuclear receptor ROR-alpha [Source:NCBI gene;Acc:1... [more]
pparab1.165e-1827.48peroxisome proliferator-activated receptor alpha b... [more]
back to top
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006486.14.350e-1822.78pep scaffold:Pmarinus_7.0:GL477261:3134:78930:1 ge... [more]
rorb6.083e-1845.68RAR-related orphan receptor B [Source:ZFIN;Acc:ZDB... [more]
ESR24.017e-1526.28estrogen receptor 2 [Source:HGNC Symbol;Acc:HGNC:3... [more]
nr1d2a7.692e-1440.82nuclear receptor subfamily 1, group D, member 2a [... [more]
ESR29.967e-1427.14estrogen receptor 2 [Source:HGNC Symbol;Acc:HGNC:3... [more]
back to top
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO399824.588e-1625.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO270178.686e-1640.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421959.059e-1641.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376451.357e-1544.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422774.788e-1445.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
roraa1.353e-1945.26RAR related orphan receptor A [Source:NCBI gene;Ac... [more]
PPARA2.737e-1928.02peroxisome proliferator-activated receptor alpha [... [more]
PPARA2.737e-1928.02peroxisome proliferator-activated receptor alpha [... [more]
rorb9.834e-1931.43RAR related orphan receptor B [Source:NCBI gene;Ac... [more]
rorb1.125e-1831.47RAR related orphan receptor B [Source:NCBI gene;Ac... [more]
back to top
BLAST of Nuclear receptor 2DBD gamma vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007787.10.000e+099.47SMESG000007787.1[more]
SMESG000008787.15.616e-12542.29SMESG000008787.1[more]
SMESG000020242.12.179e-5544.03SMESG000020242.1[more]
SMESG000020242.12.254e-5544.03SMESG000020242.1[more]
SMESG000020242.12.919e-5544.03SMESG000020242.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001785 ID=SMED30001785|Name=Nuclear receptor 2DBD gamma|organism=Schmidtea mediterranea sexual|type=transcript|length=2370bp
CAATTAAATTTTACTTTATTTTAGATGTCATTTCAAAAACTAGATAAAAA
TAAAGTTCAGTCAGTTATTCTCAAGACAAATACAATGCTTAACAACGCAA
CATTTTCTAGTCCAGAATCTGCATTTTATGAGTATCAAATTAAAATGGAA
AACCAACTTTGCCAAGTATGTAATTGCTTAGCTGCAGGATTTCATCACGG
AGCTTATGTTTGTGAAGCGTGCAAAAAATTTTTCAAGCGCTATTCAACTA
ATCAGTTGAATTCGAAAGTAGTTTGCAAAAAGAATTGCGATTTGGAGAAA
ATTGGCAGGAGGAAATGTTCGTTTTGTCGTTATCAGAAATGTTTGAATGT
AGGAATGAAGTTTTTCGGATTAAGATCAAATAAATCCAAAATCGACATAT
CACAAATTCCGTGCCGTGTTTGCGGAGGAAAATCTTCTGGGTTTCATTTC
GGATCTTTAACCTGTGAAGGATGTAAGGGTTTTTTTCGTCGAGCCGAGCC
ACTGAAAGATAAATTGGAATGCGTGAGCGGAAAACTGAATTGCGTGATTG
ATTCCTCCCATAAAATGCCTTGTAAATGGTGTAGATATCACCGTTGTATT
AAGGTTGGGATGTCGAAAATTGGTAGTCGGATAGGTCGGCAGCCAAATGC
TGTCAAGCATCATTGCGCTCTGGAAATTATCCATTATCAGAATAGAAATT
CATCGCCGAGCACCTTGGATATTCCATATCACGAAATCAGTTCTAGAATT
TCTGAATCCAACTCTGATGGAAATCAGCGTTCAATAAGCTACAGTATTCC
TTCAACTCCAGTTCCATCTGAGTGGTCTATGAGTTTTTCATCGTCTCCCG
ATGGTCATTCACAGGCATTTTGTTCAAAATTAATTGAAGCAATTAAAATA
CTACAAAAGCCGTTATTAGAAGCAGAAAAGTTATTCCACATGACTCGTTT
CCCAGTTCACAGGAATCAATCTCTTCTCGAAGTGTGGAATAGCATGATGC
GGCATTTTGACGTTCACACTTGTATTTTAGTGTATTTTGCGAAAAAAGTT
CCTGGGTTCAATGATCTATCGCTGTCCGACAAACGGACAATGGTTCAGGA
TGCTATGTATTCGATTATGTTGCTCAATTTGGCACGTTCGTATGAGGAGG
ACAAAGACGAATTTTTCAATTATTTTGACTTTTCCAAAGATGAATACGAA
GTGATATTGTTTCACTTTCCTGAAATGAAAAAGATCTTAGCACATGTTAT
GGAAATAAGCAGAATAATCTATAAACTGAATATCACTAAAGATCAGATCG
GACTTCTTTGTATTATTGAATTGTCTAAAAATTATATAAATTTGGAATCA
TTTGATGCCGTTCGAACGATACACAAGGAAGTTGTGCGATTATTTTGGAT
ATCAATTTTAAAAGAATTGGACAATGAAGCATTGTTGACAGAACCAGGAA
ACCCTCCGTCTTTACCTCAAATGTCGGTGCTACTACAAGTGTTAAACTGT
CCCGATGATCTGATCAGTCAAATTGTATTTAAAATACCGAAATGTACCGA
AAATAAATGGTGTCAAAAGTTGCACATAATTTTTAAAGTGCTCGGTGAAA
AGTTACAAGAATTCAATATTGAACATCAAATGATAATCGATGAATTGAAA
AGAAATAAGCCTGAATTGCCATATCCGGAACTTTACACTGAAATGTTTCA
ACTGACTGCTTTTTAATCCATGATTTTTTTTCTTGGAATTAGTCGATGTT
TCAATTGAATTGTGTTTCGATCAAATAATTTTGTATAAATTTATAAATGT
TTTTGCAATGTCGCTCTTCGTTATTAATTCGTGTTTAAACGTATTTGATT
GGTTGATTTATTTCTCGTGCTAAATTTATAATTGTTTTAAAAAGATTTTA
TTGGTCGATTTTATTAAGCGTGTTGGAAGGTTATGTTTTGATAAATGTTG
AACAATAAAACATTTTTTTTGATAGTCACTGAATTTTCATAATGCCTTCT
TTGTGACAACGAAAAGAGACATCAGAAAAAGAGATACAGAGAAAATGTTA
TCAGTTTTTATTTCGAGCTCGGTGGTAAAGAACGTTGCAGCTCTTAATTG
TTCAATCATTACTTTCATTTCATTTGTTATTAAAATCGGGAAATGCTTTC
AACCTTTTATGACCTGGACTACATTTTCGCTTTAAATAGTATTTTTTTCA
GGCAAAAGGGACCTGGAATTTCTAACAAAACTGTATAAAGGAGTACAATA
AGTTGATGTGTATGATTAATTTGTACTTTTTATAGATGTAAAAAAAATAG
ACTTTCAATGTTTTAAAGCGATCTTGTAAAGTGAAAATTATTTTTGTGAA
ATGTTGTTAGACATGACAGG
back to top

protein sequence of SMED30001785-orf-1

>SMED30001785-orf-1 ID=SMED30001785-orf-1|Name=SMED30001785-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=564bp
MSFQKLDKNKVQSVILKTNTMLNNATFSSPESAFYEYQIKMENQLCQVCN
CLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKNCDLEKIGRRKCSF
CRYQKCLNVGMKFFGLRSNKSKIDISQIPCRVCGGKSSGFHFGSLTCEGC
KGFFRRAEPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIG
SRIGRQPNAVKHHCALEIIHYQNRNSSPSTLDIPYHEISSRISESNSDGN
QRSISYSIPSTPVPSEWSMSFSSSPDGHSQAFCSKLIEAIKILQKPLLEA
EKLFHMTRFPVHRNQSLLEVWNSMMRHFDVHTCILVYFAKKVPGFNDLSL
SDKRTMVQDAMYSIMLLNLARSYEEDKDEFFNYFDFSKDEYEVILFHFPE
MKKILAHVMEISRIIYKLNITKDQIGLLCIIELSKNYINLESFDAVRTIH
KEVVRLFWISILKELDNEALLTEPGNPPSLPQMSVLLQVLNCPDDLISQI
VFKIPKCTENKWCQKLHIIFKVLGEKLQEFNIEHQMIIDELKRNKPELPY
PELYTEMFQLTAF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0042025host cell nucleus
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR035500NHR-like_dom_sf
IPR001723Nuclear_hrmn_rcpt
IPR001628Znf_hrmn_rcpt
IPR013088Znf_NHR/GATA
IPR000536Nucl_hrmn_rcpt_lig-bd
Vocabulary: molecular function
TermDefinition
GO:0003707steroid hormone receptor activity
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
GO:0008270zinc ion binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0043401steroid hormone mediated signaling pathway
GO:0006351transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001723Nuclear hormone receptorPRINTSPR00398STRDHORMONERcoord: 418..433
score: 24.67
coord: 192..202
score: 39.39
coord: 327..348
score: 32.61
coord: 348..364
score: 21.33
IPR001628Zinc finger, nuclear hormone receptor-typePRINTSPR00047STROIDFINGERcoord: 146..161
score: 57.09
coord: 130..146
score: 48.69
coord: 180..188
score: 36.39
coord: 188..196
score: 44.47
IPR001628Zinc finger, nuclear hormone receptor-typeSMARTSM00399c4goldcoord: 127..199
e-value: 2.0E-25
score: 100.4
coord: 43..114
e-value: 1.6E-16
score: 70.9
IPR001628Zinc finger, nuclear hormone receptor-typePFAMPF00105zf-C4coord: 129..198
e-value: 2.4E-22
score: 79.1
coord: 44..112
e-value: 6.2E-18
score: 65.0
IPR001628Zinc finger, nuclear hormone receptor-typePROSITEPS51030NUCLEAR_REC_DBD_2coord: 127..203
score: 16.311
IPR001628Zinc finger, nuclear hormone receptor-typePROSITEPS51030NUCLEAR_REC_DBD_2coord: 43..118
score: 15.267
IPR013088Zinc finger, NHR/GATA-typeGENE3DG3DSA:3.30.50.10coord: 128..221
e-value: 9.6E-24
score: 85.4
IPR013088Zinc finger, NHR/GATA-typeGENE3DG3DSA:3.30.50.10coord: 36..127
e-value: 1.4E-19
score: 72.0
NoneNo IPR availablePANTHERPTHR24082NUCLEAR HORMONE RECEPTORcoord: 125..455
NoneNo IPR availablePANTHERPTHR24082:SF473NUCLEAR HORMONE RECEPTOR FAMILY MEMBER NHR-2coord: 33..113
NoneNo IPR availablePANTHERPTHR24082:SF473NUCLEAR HORMONE RECEPTOR FAMILY MEMBER NHR-2coord: 125..455
NoneNo IPR availablePANTHERPTHR24082NUCLEAR HORMONE RECEPTORcoord: 33..113
NoneNo IPR availableCDDcd071792DBD_NR_DBD2coord: 130..204
e-value: 1.1064E-29
score: 109.514
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 127..214
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 43..123
IPR000536Nuclear hormone receptor, ligand-binding domainPROSITEPS51843NR_LBDcoord: 289..563
score: 12.455
IPR035500Nuclear hormone receptor-like domain superfamilySUPERFAMILYSSF48508Nuclear receptor ligand-binding domaincoord: 264..465