Fibronectin type III domain-containing protein

Overview
NameFibronectin type III domain-containing protein
Smed IDSMED30001782
Length (bp)5522
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fibronectin type III domain-containing protein (SMED30001782) t-SNE clustered cells

Violin plots show distribution of expression levels for Fibronectin type III domain-containing protein (SMED30001782) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fibronectin type III domain-containing protein (SMED30001782) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fibronectin type III domain-containing protein (SMED30001782) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001782

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30001782SMESG000024682.1 dd_Smed_v4_3381_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30001782SMESG000024682.1 dd_Smed_v4_3381_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001782SMESG000024682.1 dd_Smed_v4_3381_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001782SMESG000024682.1 dd_Smed_v4_3381_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001782SMESG000024682.1 dd_Smed_v4_3381_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001782SMESG000024682.1 Contig45309uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001782SMESG000024682.1 Contig45309newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30001782SMESG000024682.1 dd_Smed_v4_3381_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 117.472 bits (293), Expect = 2.997e-25
Identity = 175/774 (22.61%), Postives = 305/774 (39.41%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSS-CPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTY--INDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE----KPISFT-------------------IIPTERYQPADDNS---------DISSPQRTQMIFSNTI----------VRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYN-THFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            I W KDN  I P  + ++ L  N+ +    + +    + DAGQY C   N     + S    L V  Q+    I K          E    +  + G   +PE  +++      +  SS    S V S  +++ ++  +S++D G Y       +    + T L++ E P F        +L G  + +   ++      P  + W K+K  L     S K Y  +++N      I     A +G+Y C+ +N+ G D            + S   I + A P    +LSD  ++  VG  ++L           VVW KD   +      I I Y  E+  +L+ +     ++G Y   +K     Q     ++ ++ A +++  P+SI+     +  + C V   P   S  W     DG   + L ++ +YK+     NK++G      L   NV  SD G Y   V+N  G  S    + V+      ++   P F +KL KE        V++ CKV G+P   + W   G E+S     +      T  L +   ++SD+G Y   A+N  GS+     L V +P   V    P++      ++FT                   ++P +R   + ++S         D S       I SN            +++P +FV    D  +++G  ++L+    G P   + W  N  +   + R  +        L + +    D+G+Y+   EN+SG  +CSA +++
Sbjct: 7243 ITWAKDNREIRPGGNYKMTLVENTAT----LTVLKVGKGDAGQYTCYASNIAG--KDSCSAQLGV--QEPPRFIKKLEPSRIVKQDEFTRYECKIGG---SPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHN--LSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGADVHLECELQG---TPPFHVSWYKDKRELR----SGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSD----------TCVGS---IALKAPPRFVKKLSD--ISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISY-SENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEK-PESIKVTTGDTCTLECTVAGTPEL-STKWF---KDG---KELTSDNKYKI--SFFNKVSG------LKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVS------DRTVPPSFTRKL-KETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQKPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILI 7957          

HSP 2 Score: 88.1965 bits (217), Expect = 2.171e-16
Identity = 119/543 (21.92%), Postives = 203/543 (37.38%), Query Frame = 3
Query: 3243 FEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRN--LVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE------KPISFTIIPTERYQPA--DDNSDISSPQRTQM----------IFS------------------------NTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
             EI +      G+YTC+ SNE+G       L+  EA   +    P S             +T  VG + K           + +W KD   L S  P  +I    E+K  L+++  T+ D G Y               E+  I     I++  + +++  N  +++ C V+      ++ WS       P ++  +    +   +  PL KL                 D G Y     N AG SS    +TV         +  P F++K+D   +    E   + CK+ G+P   + W KN +ELSES+ +++  V     L I + K  D+G Y  +A N  GS+     + + +P   + T +P +        +   +  T  ++ +   D   I S ++ ++          IFS                          +++ PP FV    D I   G  V L+  + G  P  + W         + + +M        LI+ ++Q    G+Y+  AEN +G  T    +IV
Sbjct: 3513 LEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKS-------------LTTFVGKAAKFICTVTGTPVIETIWQKDGAAL-SPSPNWRIS-DAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIKEL-EPVQSAINKKVHLECQVDEDRKV-TVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKL----------------KDSGTYVCTASNEAGSSSCSATVTV---------REPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEPADIVRGTNALLQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIV 4013          

HSP 3 Score: 86.2705 bits (212), Expect = 6.457e-16
Identity = 157/740 (21.22%), Postives = 272/740 (36.76%), Query Frame = 3
Query: 2538 RIDKDQ-YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVS---SKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTY--INDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            ++D+D+   + W KD + + P  D +I  +    +    + I   +  D+G Y C   N       SS    +V  ++  + + K          E   L   L G   +P   + +      ++ S+       ++E I  +   V ++D G Y          D   T + I E P F+      + + G +  +   +       P  I W K+K  +     S K Y   +    +  EI  F  A VG+Y C V+NE G    K    A   L    T +          ++ D    G  G ++ L           V W+K  Q +   D +I++ +       L I    ++  G Y  + +    +QT++ E+   + A +I+   + I+        +   V   P        +KP      R LV + +Y++          N+ +++ Y  +    D G+Y   + N  G SS     TV       ++  +P F + L + + S +N    + CK++G+    + W K+G+E++ SD  +I  V  T  L I     +DAG +  +A+N+ GS+ S   L V +P                                                   P FVT    + V  G  V LK    G  P  + W+  N   ++     + +E  E  L L  ++  DSG Y+    N +G   CSA + V
Sbjct: 3666 QVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIAT----LEIPLAKLKDSGTYVCTASNEAG----SSSCSATVTVREPPSFVKKVDPSYLMLPGESARLHCKLKG---SPVIQVTWFKNNKELSESNTVRMYFVNSEAI-LDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEPADIVRGTNALLQCEVSG---TGPFEISWFKDKKQIR----SSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVG----KCGCMATHLLKEPPTFV---------KKVDDLIALG--GQTVTLQAAVRGSEPISVTWMK-GQEVIREDGKIKMSF-SNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKIIERA-ELIQVTAGDPATLEYTVAGTPE-------LKPKWYKDGRPLVASKKYRI------SFKNNVAQLKFY--SAELHDSGQYTFEISNEVGSSSCETTFTVL------DRDIAPFFTKPL-RNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEP---------------------------------------------------PSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFV 4295          

HSP 4 Score: 85.8853 bits (211), Expect = 8.588e-16
Identity = 163/719 (22.67%), Postives = 256/719 (35.61%), Query Frame = 3
Query: 2631 SQSGKMKMHIDNCRESDAGQYWCEVR---NGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAK---PISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKE---TGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWS-----IKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALV 4730
            SQSG+    + N    +AGQ  C  R     P+   K     LS  S + G  I    E T+   T P+S+    DGF        I  +   N+         V++ +       + + +D GQY   +   + +DV    +   E P FV       + +GDS+++   +    ++   T+ W K  T L         + N+   LVF   K      G+YTC+  N  G               SS+T+  +  +   P  + QL D  +  +VG  + L           V W +D   L   D  +Q  +  ++  +LKI    ++ SG Y         T  +   +    P + +P     P SI      S +  C V  + P    I WS     I+P  G+ T   V N  +  I K                  V   D G+Y  +  N  G       ++V         K  PKF++KL+   ++   E + + CK+SG+P   + W +N  EL ES    +  +     L I      D+G Y  +A N  G       L V  P   V T KP   P+                                                  +G DV+L+C + G P   ++W        N+ +F++  +  +  L + N++  D G Y   A N  G  TCS  V
Sbjct: 5958 SQSGEYTCVVSN----NAGQASCTTRLFVKEPAAFLKR----LSDHSVEPGKSI--ILESTYTG-TLPISVTWKKDGFN-------ITTSEKCNI---------VTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSVSLQCQVAGTPEI---TVSWYKGDTKLRPTPEYRTYFTNNVATLVFN--KVNINDSGEYTCKAENSIG-------------TASSKTVFRIQERQLPPSFARQLKD--IEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRD-DENLQTSF-VDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREP-KKSPFFDIKPVSIDVIAGESADFECHVTGAQP--MRITWSKDNKEIRPG-GNYTITCVGNTPHLRILK------------------VGKGDSGQYTCQATNDVGKDMCSAQLSV---------KEPPKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAP--PVFTQKP--SPVG-----------------------------------------------ALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSV 6545          

HSP 5 Score: 83.5741 bits (205), Expect = 5.388e-15
Identity = 153/744 (20.56%), Postives = 265/744 (35.62%), Query Frame = 3
Query: 2679 DAGQYWCEVRNGPS-------VIRKSSPVLLSVFSQKQGTVIPKFSEKTFA--ANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN-SRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQF--APVIQDFPQSIRAKQNGSINIVCVV-NSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPL-----EKPISF----TIIPTERYQPADDNSDISSPQRTQMIFSNTI----------------------------------VRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALV 4730
            D+G+Y CE +N          VI K SP     F  K   V+ ++     A  A T P  +    D                  +  S   +     + ++          D G+Y  RV+++    +    + + E P F+      +SL G + A    +K      P T+ W K+   +T +     T+ N+   L          H G Y CQ  N+ G       +    AL+S +    ++ + +S        +  + GD   L V+F         W KD Q L      +I +    ++   LKI      DSG Y   ++      +    IN +     P      + + + +   I++ C+V  S+P   SI W          + +  + +YK           N   +E+    +  +D G Y     N AG +     +TV         K  P F++K   + ++P N +V ++  V G     +KW K+ +EL       + K   +  L +   K +D+G Y  Q SN  G+  SK  L V +P   +    P+      +  +F    T  P  R     D ++I++ Q+  + F + +                                  V+ PP F+       V +  DV L+C + G P   + W   N    ++ ++ +   +  + L +      D+G Y     N  G  +CS  V
Sbjct: 4366 DSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEF--KPIEVLKEYDVMLLAEVAGTPPFEITWFKDN----------------TILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFIKKIESTSSLRGGTAAFQATLKG---SLPITVTWLKDSDEITEDDNIRMTFENNVASLYLS--GIEVKHDGKYVCQAKNDAG-------IQRCSALLSVKEPATITEEAVS--------IDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISV---TDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPI--SIQWF------KDDQEISASEKYKF------SFHDNTAFLEI--SQLEGTDSGTYTCSATNKAGHNQCSGHLTV---------KEPPYFVEKPQSQDVNP-NTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRV 5042          

HSP 6 Score: 82.4185 bits (202), Expect = 1.072e-14
Identity = 160/755 (21.19%), Postives = 289/755 (38.28%), Query Frame = 3
Query: 2652 MHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLS---VFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNH-RSVSLKDVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHK-TYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKET-GQTQTTIV-----EINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG--------SVNTTKPL--------EKPISFTIIPTERYQPADDNSDISSPQRTQM--IFSNTI------------------------VRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSH 4745
            + I+     D+G Y CE  NG      S+ + +    VF+QK   V         A     + L+  + G    P  ++++      V +S     K++S       H  ++   DVG+Y  + +++   D     ++  E P FV      ++L+GD++ +   ++ F    P +++W K++  +     + + ++I++   L    P+ + +  G Y CQ+ N+ G      + SA   ++    +I    KP          +T + G+   L+            W KD + L S D +  I +  +   SLKI  A ++D G Y   +K + G++  T+       I P  F   ++D    + A    S+ + C V+      S+ W     DG+           ++++ P  + + +     L    +  SD G Y     N AG       +TV         +  P F Q  D   + P    +     + G P   +KW K   EL   +   I       EL +   +  ++G Y    +N  GS     HL V +P          SV T  P+          PIS + I  E      +   I+  +++ +  I  +TI                        V  PP F+          G+   L+C + G PE  I W+  +T   + P ++M+ + +   L++  +   D G YS  A+NS G    SA++++ + 
Sbjct: 6422 LTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSPV--------GALKGSDVILQCEISG---TPPFEVVWVKDRKQVRNSKK--FKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSDTSTLIGDAVELRAIVEGFQ---PISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNS--GKYICQIKNDAG----MRECSAVLTVLEPARII---EKP--------EPMTVTTGNPFALECVVTGTPELSAKWFKDGREL-SADSKHHITFINKV-ASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKD----VNAILGASVVLECRVSGSAPI-SVGWF---QDGN-----------EIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTV---------QEPPSFEQTPDSVEVLP-GMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKAR 7112          

HSP 7 Score: 80.4925 bits (197), Expect = 3.676e-14
Identity = 161/786 (20.48%), Postives = 290/786 (36.90%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKT---FAANTEPLSLKLVLDG-----FKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHV---GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSI---NIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVI-----------DPI-----------GSVNTTKPLE----------------------KPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            ++I W+KD + I      R+     SQ   + + I +   +D G+Y C V N    + K   +   +  +      P F +K     A   + ++L+  + G       +    ++I  +  I ++ S+     +  +  I F  +   L +          + + K   +I E+ E +          GD   +   +    ++ PK   W K+  PL  +K    ++ N+  +L     KF  A +   G YT ++SNE G    +   +     +  + + P   KP+ +    D+ V G+     +LD +    +   V W KD + + + D R +I +  E   SL+I    +ND+G +           T  V       A ++Q+ P  +    +  +   + VC+ +++    S   +I+   G+  + LV+     +  + L         +ELY   V TSD G Y  +V N AG       + V         K    F++KL+   +    +   + CKV+G P   + W  N  E+ ES   ++  V  T  L + +    D+G Y  +A N  GS+   C   VI            PI             V  T P E                        +S  I+        +    +++   + +  +   +R PP F+          G     +  L G  P  + W   +     +    M  E +   L L  I+    G+Y   A+N +G+  CSAL+ V
Sbjct: 3860 FEISWFKDKKQIRSSKKYRLF----SQKSLVCLEIFSFNSADVGEYECVVANE---VGKCGCMATHLLKEP-----PTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKIIERAELI------QVTAGDPATLEYTVAGTPELKPK---WYKDGRPLVASKKYRISFKNNVAQL-----KFYSAELHDSGQYTFEISNEVGSSSCETTFT-----VLDRDIAPFFTKPLRNV---DSVVNGTC----RLDCKIAGSLPMRVSWFKDGKEIAASD-RYRIAF-VEGTASLEIIRVDMNDAGNFTC-------RATNSVGSKDSSGALIVQEPPSFVTKPGSKDVLPGSAVCLKSTFQG--STPLTIRWFKGN--KELVSGGSCYITKEALE------SSLELYL--VKTSDSGTYTCKVSNVAGGVECSANLFV---------KEPATFVEKLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSD--HCSSIVIVKESPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSV 4575          

HSP 8 Score: 80.1073 bits (196), Expect = 5.317e-14
Identity = 151/746 (20.24%), Postives = 270/746 (36.19%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNG-------PSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDR 4769
            + + WYKD   +      +I+    S++    +HI N   +D G+Y C+  N         S+  K+ P  +   S     V  +   +T     EP+S+    D  +   ESD I+ +   N+  ++  +S+V      ++  +  +   + +    +S  + A     I EKPE +          GD+  +   +    ++S K   W K+   LT++     ++ N    L  +I     +  G Y+ +V N  G+D     L      +S +T+ P   + +  +        G  G S+ ++ +        V W  +   ++S   R       ++ C+L +N    +DSG Y  +      +      +  ++  P     P  +      ++    +V   P   S++W      GS    LV   R  +       L  ++  +EL+  +V TS  GEY   V N AG +S    + + A A         KF+++L+   I    + +I+    +G P   + W KNG  ++ S    I    ++  L I +    DAG Y     N +G +     + +++P                                                   P FV       V  GD   L+C L G PE  + W+  +T       ++M    +   L+   +   DSG Y   AENS G  + S  + V       S  R
Sbjct: 7428 FHVSWYKDKRELRSGKKYKIM----SENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENI--ATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPAT----IVEKPESI------KVTTGDTCTLECTVAGTPELSTK---WFKDGKELTSDNKYKISFFNKVSGL--KIINVAPSDSGVYSFEVQNPVGKDSCTASLQ-----VSDRTVPPSFTRKLKETN-------GLSGSSVVMECKVYGSPPISVSWFHEGNEISSG--RKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLT-VREPPSFVQKPDPMDVLTGTNVTFTSIVKGTPP-FSVSW----FKGS--SELVPGDRCNV------SLEDSVAELELF--DVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPA---------KFVKRLNDYSIEK-GKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEP---------------------------------------------------PYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSR 8061          

HSP 9 Score: 76.6406 bits (187), Expect = 6.469e-13
Identity = 120/547 (21.94%), Postives = 199/547 (36.38%), Query Frame = 3
Query: 3276 GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPR-FEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLPPETYSNLVKTHINDESRVMQASPRGWQEFQFHSNAST 4913
            G Y CQ+SN+ G    K  L   E         P   K  S   +  N      G S   + +        V W  D   + +       +   +   + +I+GA V +SGTY    +    T +  +E+   +    I++  + +   +   + + C V   P    + W            L NN   +   K    LT  +    L+      SD GEY   V N  G  S     T  AL E       P FI+K++    + +      +  V+G+P   + W+K+ + L E D++ I  V     L I++     +G Y  QA N +G  V +C+                    +F ++                             + P Q V       V E D + L+C + G PE  + W  +   I   R F M  E +     ++++ K DSG+Y+   EN  G ++C A + V        +D++  PS +K L       ++ + I+ E +V  + P   Q F+     ST
Sbjct: 4836 GTYICQLSNDVGTATSKATLFVKEP--------PQFIKKPSPVLVLRN------GQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFI--DGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIREL-KPVEVVKYSDVELECEVTGTPP-FEVTW------------LKNNREIRSSKK--YTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCS---TRVALKEP------PSFIKKIEN-TTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESG--VERCY--------------------AFLLV-----------------------------QEPAQIVEKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRV--------LDQNIPPSFTKKL--TKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEIST 5279          

HSP 10 Score: 73.1738 bits (178), Expect = 6.276e-12
Identity = 154/731 (21.07%), Postives = 261/731 (35.70%), Query Frame = 3
Query: 2652 MHIDNCRESDAGQYWCEVRN-------GPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKY--APESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVS---SKDVAKTHLEIGEK---PEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN----------SRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-----VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPIN----EKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYF-LILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            + I N  + DAGQY CE+ N       G  V     P  ++     +  V    S +   A T  +++       K    PE    F N   NV               + FN   V++ D G+Y  +         +KT   I E+   P F          +G  + ++      +  +P  + W ++   L  ++    +++++   L  +I +   +H G Y+C  SN  G      +L+A E   S    I    KP+S   ++        G+S   +          + W KDN+ +              P ++I         LK+      DSG Y       V K+    Q ++ E  P +F   ++    S  AKQ  SI + C ++  P    ++W    ++      L  + +Y M    +N +        L  +  +  D G+Y     N  G +S    +TV         K  P F QK      SP+       VI++C++SG P   + W+K+ +++  S   KI        L I N + SD G Y  +A+N  GS+   C ++  +P                                                   P+FV   +D     GD V L+  + G+ P  ++W       I          +D    L L + +  +SG+Y    +N +G+  CSA++ V
Sbjct: 6043 LEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTN---NV-------------ATLVFNK--VNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTC---RLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATL--KILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDI----KPVSIDVIA--------GESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRI---------LKVGKG---DSGQYTCQATNDVGKDMCSAQLSVKE--PPKF---VKKLEASKVAKQGESIQLECKISGSPEIK-VSWFRNDSE------LHESWKYNM--SFINSVA------LLTINEASAEDSGDYICEAHNGVGDASCSTALTV---------KAPPVFTQKP-----SPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEP---------------------------------------------------PRFVKKLSDTSTLIGDAVELRAIVEGFQPISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTV 6641          

HSP 11 Score: 70.4774 bits (171), Expect = 4.389e-11
Identity = 80/321 (24.92%), Postives = 133/321 (41.43%), Query Frame = 3
Query: 3780 INWSIKPADG-SPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRV--ENSAG---WSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRK---VGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI-NNPRFEMKRELDEYFLILKN-IQKGDSGRYSITAENSSGL 4709
            + W    +DG +  RN     R K  NK ++  T  ++       N+   +G EY  RV  EN  G   WS +  PIT  +    Q    +P F ++L    +   +   +V CKV+G+P PI+KW + G+E+  +D LK R     G  H+L+I +    DA +Y+ +A+N  GS      L+V  P                              + I  P+  + + +   +R                G+ V +K    G P+P+I W      I NN  +++        L+  N +++ D+G Y + A+N  G+
Sbjct: 30843 VAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLI--EGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQ----APHFKEELRNLNVRYQSNATLV-CKVTGHPKPIVKWYRQGKEII-ADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVP------------------------------AKIHLPKTLEGMGAVHALR----------------GEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGI 31109          

HSP 12 Score: 69.3218 bits (168), Expect = 1.024e-10
Identity = 147/742 (19.81%), Postives = 262/742 (35.31%), Query Frame = 3
Query: 2565 QWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPS-------VIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQF-NHRSVSLKDVGQYLFRVS---SKDVAKTHLEIGEKPEFVYHQFKENSLL--GDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESK---CSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLN-KLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            QW+KD + I      R++  C+ +S  + + ++N    D   Y C+V N          +  K  P  L    ++Q         K     T P  +K   D                 +V   S P   +       F N  SV     GQY   V+     D   T L + E P+FV  + + + ++  GDS  +   +    ++    ++W +N+  L  +     T+I+     V ++   +    GD+ C+  N  G      ++   E  + S    P   + + ++++S             L+ E       +VVW KD + L S        Y   SK    S+ I     +D G Y    +    + T +  +        +++ P+ +       +N + VV   P+   +  SI+ A   P        + ++I +  N ++T       L F     ++ G+Y  +++N  G    M  + V            P  I +    +   + E   + CKV+G P   ++W K+G+ L+ S   K     +   L I + ++ DAG Y  Q  N  G   S C   V                               D SD +                PP F     +     G   +L+C + G  P  + W+   T  ++  +++     +   L L ++   D G Y+  A N +G   C A++ V
Sbjct: 5269 QWFKDGKEISTSAKYRLV--CHERS--VSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPSFLVKPGRQQAIPDSTVEFKAILKGTPPFKIKWFKD-----------------DVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFV-KKLEASKIVKAGDSSRLECKIAGSPEIR---VVWFRNEHELPASDKYRMTFIDSVA--VIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSS--FPPIVETLKNAEVS-------------LECELSGTPPFEVVWYKDKRQLRSSK-----KYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVK-------LKEPPRFV-----SKLNSLTVVAGEPA--ELQASIEGA--QPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVL----------EPAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGK--SSCTAVV-------------------------------DVSDRA---------------VPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTV 5889          

HSP 13 Score: 68.5514 bits (166), Expect = 1.707e-10
Identity = 172/792 (21.72%), Postives = 274/792 (34.60%), Query Frame = 3
Query: 2472 LLLVNAESSCPTRLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRILLQCNSQS---GKMKMHIDNCRESDAGQYWCEVRNG---------------PSVIRKSSPVLLSVFS----QKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVA---KTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDN-QPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQ-------NGSINIVC-VVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTF-TDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI-NNPRFEMKRELDEYFLI-LKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            L+L N +S   T  +  +   P+I      + WY D   I         +Q +  S   G     I   R  ++G Y CE RN                P+ IR+  PV +  +S    + + T  P F       N E  S K      KY     +   N+ I     S                      D G+Y   VS++  +    T + + E P F+       ++L  S              P +I W K+   L  +   + ++++    L  +I      H G YTCQ  NE G     ++   A  L+     I   AK +  ++           D + L+          V WLKD  Q + SR   +     E +  S +I      DSG Y   ++    + +    +  +      Q+ P S   K          SI++ C V  S P   S  W     DG   + +  +A+Y+++         + + + L  +N+   D   Y  +V N AG  +    +TV         K  P F+ K  ++   P +  V  +  + G P   +KW K+  EL       I   G T  L + +   S  G Y    +N  GS+     L V +P                                                   P+FV      +IVK GD   L+C + G PE  + W  N H +  + ++ M   +D   +I + N+   DSG +   A+N +G  +CS  VIV
Sbjct: 4871 LVLRNGQS---TTFECQITGTPKIR-----VSWYLDGNEI-------TAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSK------KYTLTDRVSVFNLHITKCDPS----------------------DTGEYQCIVSNEGGSCSCSTRVALKEPPSFIKKIENTTTVLKSSATF---QSTVAGSPPISITWLKDDQILDEDDNVYISFVDSVATL--QIRSVDNGHSGRYTCQAKNESG-----VERCYAFLLVQEPAQIVEKAKSVDVTE----------KDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSF---ENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLD-----QNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPI--SAQWF---KDG---KEISTSAKYRLVC--------HERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTV---------KEPPSFLVKPGRQQAIP-DSTVEFKAILKGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEP---------------------------------------------------PKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTF-IDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIV 5513          

HSP 14 Score: 68.5514 bits (166), Expect = 1.904e-10
Identity = 149/743 (20.05%), Postives = 269/743 (36.20%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKV-------SSNEMIQFNHRSVSLK-------DVGQYLFRVSSKDVAKTH---LEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSV-GDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIF-SNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSAL 4727
            +++ WYKD   +      +I     S++    +HI N   SD G+Y C+ +N       S   + +V  ++    + K +  T  A  EP  L+  ++G +            PI V      W K        S N  I F     +L+       + G+Y+ ++ +    + +   L + E    V         +G++  +   +    ++S   + W K+   LT+++    ++ N    L   I    +   G YT QV N  G+              S   ++ VS + +  S       TG V G S  L+ +        V W  +   + S   + Q  +  ++ C+L++N    +D G Y  V      +      +  +Q  P     P+ +      ++    V+   P    +NW          R LV   R  +           +  +EL+  N+  S  GEY   V N+AG +S    + V         K    F+++L    + P  + +I+    +G     + W K+G  ++ S+   I    +T  L I N  K DAG Y  +  N  G +V    +  ++P   V   +PLE  +  ++  + + Q A       +P+ T   +  +T +R  P++ T FT+ +                                             L+   +   DSG Y+  AENS G A+   +
Sbjct: 5546 FEVVWYKDKRQLRSSKKYKIA----SKNFHTSIHILNVDTSDIGEYHCKAQNEVG----SDTCVCTVKLKEPPRFVSKLNSLTVVAG-EPAELQASIEGAQ------------PIFVQ-----WLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKAGPMTVTVGETCTLECKVAGTPELS---VEWYKDGKLLTSSQKHKFSFYNKISSL--RILSVERQDAGTYTFQVQNNVGKS-------------SCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVS-GAKYQTTF-SDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLT-VQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTPP-FKVNWF------RGARELVKGDRCNIY------FEDTVAELELF--NIDISQSGEYTCVVSNNAGQASCTTRLFV---------KEPAAFLKRLSDHSVEP-GKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSV--SLQCQVA------GTPEITVSWYKGDTKLRPTPEYRTYFTNNVAT-------------------------------------------LVFNKVNINDSGEYTCKAENSIGTASSKTV 6165          

HSP 15 Score: 67.3958 bits (163), Expect = 3.481e-10
Identity = 119/514 (23.15%), Postives = 190/514 (36.96%), Query Frame = 3
Query: 3255 KFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-----VLKETGQTQTTIVE-INPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNS-DISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNT--HFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSID 4766
            K  ++  G Y+C  +N  G        S++  LI ++   P    P    +L+   V   VG+S   +          V W KD++ + S   + QI Y E S   L +      DSG Y       V K++   Q  I E + P  F    +   +++   +  S  +   V  S P   ++ W     +  PT N               ++T     + L       +D G Y  +V N AG +     I +      +  K  P F Q L    +S   E V + C V G+    ++W+K G E+  SD         T  L +++  K+D+G Y  +ASN  GS+ +K  + + D        KP        + P  +    D     +S PQ  +++   T          TF   I K G D          P P + W+           R  + ++ DE  L +++  K DSG Y   A N  G    +  + VD   K   I+
Sbjct: 8118 KTDRSLAGQYSCTATNPIG------SASSSARLILTEGKNP----PFFDIRLAP--VDAVVGESADFECHVTGTQPIKVSWAKDSREIRSGG-KYQISYLENS-AHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFT---KRLSETVEETEGNSFKLEGRVAGSQPI--TVAWYKNNIEIQPTSNC--------------EITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVI------KEPKKPPVFDQHLTPVTVSE-GEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKD--------KP-------AVAPATKKAAVDGRLFFVSEPQSIRVVEKTT---------ATF---IAKVGGD----------PIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKIE 8554          

HSP 16 Score: 64.6994 bits (156), Expect = 2.220e-9
Identity = 80/311 (25.72%), Postives = 130/311 (41.80%), Query Frame = 3
Query: 3918 TTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIK--NCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSP------------QRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCL--IGYPEPLIWWSYNTHFINNP-RFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPL 4799
            T SD GE+ +  +N AG SS+ + +TV    EA   +  P F++KL K +      ++ ++ + +GNPNP + W+KN + +    + KIR  G   E  +K  +    D+  Y A A N  G + ++C + V      V   +P  +P    IIP   Y+      +I++P            Q  +    +   +  P F    T   +K       +C L  IG P  ++ W ++   +    R  M  E     L        DSG  +  A N  G    SA +IV   ++   ++ SQ P   K L
Sbjct: 1521 TPSDSGEWTVVAQNRAGRSSISVILTV----EAVEHQVKPMFVEKL-KNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNV-----EVEFAEP--EPERKLIIPRGTYR----AKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIV--KDEKSLVEESQLPEGRKGL 1813          

HSP 17 Score: 64.3142 bits (155), Expect = 2.831e-9
Identity = 39/134 (29.10%), Postives = 68/134 (50.75%), Query Frame = 3
Query: 3927 DGGEYCLRV--ENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG 4322
            +G +Y  RV   N+ G   V +P     + EA+ +   PK +  + ++I     +K+ +   V G P+P  KW K  +E+  S HL + K   +  L+IK+  + D+G Y   A N++G++  K  + V+D  G
Sbjct: 18865 EGKKYKFRVAARNAVG---VSLPREAEGVYEAKEQLLPPKIL--MPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPG 18993          

HSP 18 Score: 63.5438 bits (153), Expect = 6.174e-9
Identity = 37/139 (26.62%), Postives = 68/139 (48.92%), Query Frame = 3
Query: 3891 RIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV 4307
            R +L    VT ++ G Y L+  N +G ++    + V A      +   P F+Q+L    +     +V ++ +V+G P P++K+ ++G E+  S   +I + G+ + L+I      D+G Y   A+N+ G   S   L V
Sbjct:   62 RAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKA------ETAPPNFVQRLQSMTVRQ-GSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLV 193          

HSP 19 Score: 63.1586 bits (152), Expect = 7.550e-9
Identity = 44/138 (31.88%), Postives = 65/138 (47.10%), Query Frame = 3
Query: 3897 ELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVG-ETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV 4307
            +L  ++VTT D  EY +   N  G  S    +TV       +    P F ++L         + V    +VSG P P LKW K+G+ LS   +++I   G + + L I++    D G Y   A+NT GS   + HLQV
Sbjct: 31749 QLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMF-KRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 31885          

HSP 20 Score: 63.1586 bits (152), Expect = 7.940e-9
Identity = 79/381 (20.73%), Postives = 148/381 (38.85%), Query Frame = 3
Query: 3657 VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQN---KKTSPKFIQKLDK--------EIISP-------INEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRE-LDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVD 4739
            V++  I+  PV      ++  ++ G +  VC + +Y     + W          R L N+ +Y++  +    +        LY  ++T  D G Y  +V N  G  S    + V  + E  +   ++T  K  ++ D         E   P       + E V     ++ +P P + W K+G+++   D+ K            K   +SD G+Y+                     I SV T    E    +T++   +Y   +D+             +++ +R  P F     +   +EG  V  +  + G P P + W  +   ++  P  E+  E LD Y L +++    D+G Y +TA N++G  +C A + V+
Sbjct: 31560 VKVASIEIGPVSGQIMHAV-GEEGGHVKYVCKIENYDQSTQVTWYFG------VRQLENSEKYEITYEDGVAI--------LYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDK------------KYTFESDKGLYQLT-------------------INSVTTDDDAE----YTVVARNKY--GEDSCKAKLTVTLHPPPTDSTLR--PMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVE 31886          

HSP 21 Score: 61.2326 bits (147), Expect = 2.792e-8
Identity = 156/790 (19.75%), Postives = 295/790 (37.34%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANT-EPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVS--SDVVWLKDNQPLNS----RDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNT----------------------------NGSEVS-KCHLQVIDP--IGSVNTTKPLEKPISFTIIPTERYQPA-----DDNSDISSPQ--RTQMIFSNTIV-----RSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYF---------LILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            + ++W+K +  ++P     I L+        ++ +   +  ++G Y C V N       S+     +F ++  T + + ++  F+  T  P+ L+    G    P S     +  +      C  +    + +++    ++  +D  QY   +   + +D+ +  + + E P F+       +++G+   +   +    ++    I W K  T L +       + N+   LV  I K   + VG+Y+C+  N  G        S+A  +I ++ L P  A+ +     +  +    V    +++   P  VS   D V LKD+  L +        +QI   ++S    + N +  N  GT  +  K         + ++  +  P     P S+      S    C V        I W+         R +     YKM       L  N   + +    V   D G+Y     N AG  S    + V         +  P+FI+KL+   I   +E     CK+ G+P   + W K+  E+ ES   ++  V     L + N    D+G Y  +A N                              G++V  +C LQ   P  +      + L     + I+ +E +  +      D +DI   Q   T  + S+T V     ++PP+FV   +D     G +V L+  + G  P  ++W+          + E+ RE D  +         L    ++  ++G+Y+   +N +G+  C A + V
Sbjct: 6863 FKVKWFKGSRELVPGESCNISLE----DFVTELELFEVQPLESGDYSCLVTNDAG----SASCTTHLFVKEPATFVKRLAD--FSVETGSPIVLEATYTG--TPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTI--EDYAQYSCLIENEAGQDICEALVSVLEPPYFIEPLEHVEAVIGEPATLQCKVDGTPEIR---ISWYKEHTKLRSAPAYKMQFKNNVASLV--INKVDHSDVGEYSCKADNSVG-----AVASSAVLVIKARKLPPFFARKLKDVHETLGF---PVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIG-QYNCSASNPLGTASSSAK---------LILSEHEVPPFFDLKPVSVDLALGESGTFKCHVTGTAPIK-ITWA------KDNREIRPGGNYKMT------LVENTATLTVL--KVGKGDAGQYTCYASNIAGKDSCSAQLGV---------QEPPRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIM-SENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWF--------KDKGEIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSV 7582          

HSP 22 Score: 59.3066 bits (142), Expect = 9.573e-8
Identity = 54/247 (21.86%), Postives = 105/247 (42.51%), Query Frame = 3
Query: 4029 TSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVR---------SPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYN-THFINNPRFEMK--RELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVI 4733
            T P  +  L K +     E V + C +SG P+P + W +   ++  S   +I        L+I+     D+G +   A N  G+  + C+L       +V  ++  EK    T   TE++   ++   + S     ++ ++T +          + P F+T    + + EG  VV  C + G P+P ++W  +        R+++   ++  E  L++      D+G Y+I   N  G  + SA ++
Sbjct:  941 TPPTLVSGL-KNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYL-------AVQVSEEFEKE---TTAVTEKFT-TEEKRFVES---RDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLL 1172          

HSP 23 Score: 57.7658 bits (138), Expect = 2.944e-7
Identity = 53/243 (21.81%), Postives = 96/243 (39.51%), Query Frame = 3
Query: 4032 SPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESD--HLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNK 4751
            +P F Q L + ++            +SG P P + W ++G+ +S S    ++I       +L I    K+++G Y  +A+N +G   S   L                                             ++ + T   +PP FV       V++G  V L+  + G P P++ ++       ++  F++ +E D Y L++      DSG YS+ A NS G AT +A ++V    +
Sbjct:    5 APTFTQPL-QSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAEL---------------------------------------------LVKAET---APPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEE 198          

HSP 24 Score: 57.7658 bits (138), Expect = 3.201e-7
Identity = 65/285 (22.81%), Postives = 109/285 (38.25%), Query Frame = 3
Query: 3927 DGGEYCLRV--ENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKE------GDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEY-FLILKNIQ-KGDSGRYSITAENSSGLATCSALVIVDSHNK 4751
            +  EY  RV  EN  G S    P   A   + +        I+K  K++ + + E   + C++ G P P +KW + G+EL +S   K+   G TH L +   ++ D G+Y   A+N                +G V T+                                    S  ++++ PQF   +    +KE      G  + L    IG P P + W +    + N         + Y  L++KN+Q K  +G+Y +   N  G  T  A++ V+  +K
Sbjct: 30497 EATEYEFRVFAENETGLSR---PRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNE---------------VGEVETS------------------------------------SKLLLQATPQFHPGYP---LKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFG--TVDAILDVEIQDK 30722          

HSP 25 Score: 55.0694 bits (131), Expect = 2.024e-6
Identity = 46/148 (31.08%), Postives = 61/148 (41.22%), Query Frame = 3
Query: 3930 GGEYCLRV--EN--SAGWSSVMIPITVAALAEAQNKKTSP------KFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVID----PIGSVN 4331
            G  Y  RV  EN    G     IPI      E Q K   P      K I+ L  +  + +    I+R    G P P  KW  +G E+   +H  +     +  L IKNC + D G Y+   SN  GS+    HL V+D    P G +N
Sbjct: 17475 GKTYRFRVKAENIVGLGLPDTTIPI------ECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIR----GVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPIN 17612          

HSP 26 Score: 54.6842 bits (130), Expect = 2.581e-6
Identity = 66/243 (27.16%), Postives = 105/243 (43.21%), Query Frame = 3
Query: 3894 IELYFDNVTTSDGGEYCLRV--ENSAGW----SSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTER----YQP--ADDNSDISS---PQRTQMIFSNTIVRSPPQFVTTFTDEIVK--EGDDVVLKCCLI---GYPEPL 4562
            IE  F     ++   Y  RV  +N+AG     S    PIT     E       PKF       I+    E   +   V G P P ++W++  +E+ ES   +I+       L++K+  + D G Y  +ASN  GS+    +++V+D  G      P E P+  T + +E+    + P   D  SDIS     +R     + T+V S    V T + ++ K  EG++ V +   +   G  EPL
Sbjct: 23576 IETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKF----RDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPG------PPEGPVQVTGVTSEKCSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASE---VVTNSLKVTKLLEGNEYVFRIMAVNKYGVGEPL 23805          

HSP 27 Score: 54.299 bits (129), Expect = 3.670e-6
Identity = 55/215 (25.58%), Postives = 74/215 (34.42%), Query Frame = 3
Query: 4101 CKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSA-LVIVD 4739
            C++   PN   +W K G E+ ESD   IR       L I   +  D G Y  +ASN  GS      L V                       TE Y P                       S P+ +TTF  +  K        C + G P    IW         +P + +    +++ L L N+   D G YS  A N  G   C A L+I+D
Sbjct: 3477 CEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTV-----------------------TEAYPPT--------------------FLSRPKSLTTFVGKAAK------FICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIID 3642          

HSP 28 Score: 53.9138 bits (128), Expect = 3.991e-6
Identity = 50/206 (24.27%), Postives = 89/206 (43.20%), Query Frame = 3
Query: 4131 LKWMKNGEELSESDHLKIRKVGE-THELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDS 4742
            + W K+G++L E+ H +     + T+EL I N  +SD G Y  + S   G+  SK +LQ +         K + + +S  I  T++   +D  +  S+  R     +   + S P  VT   D  V             G P P   W+ +   I    ++++  +   +FL +      DSG Y+ T +NS+G  + S  + + +
Sbjct: 32749 VTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGT--SKTNLQFMG-----QAFKSIHEKVS-KISETKK---SDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKA 32943          

HSP 29 Score: 53.1434 bits (126), Expect = 6.881e-6
Identity = 95/475 (20.00%), Postives = 182/475 (38.32%), Query Frame = 3
Query: 3438 GDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK-ETGQTQTTI---VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVA---ALAEAQNKKTSPKFIQKLDKEIISPINEKVIVR----------------------------------------CKVS--GNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTK-PLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGL 4709
            G + + D++       +  W  D Q + + D   ++   E+   SL I  AT +DSG +  V +   G++  ++   VE    Q  P+  +  +++  K+   + +       P+   I W +K +D      ++   +Y  I     ++ G      L  D+  + D   Y     N AG  +    + V    A  E + K   P+   +  KEI +P  E + +R                                        C+++  G+P  +++W+ +G+ L  ++ L++        L        D+GI   +A+N  G++ +   L V D    V  ++ P  +     I   ER       + +++ Q+          +  P  V       V EG+    +C + GYP+P + W  N   I  + RF ++ +   Y  I+ + +  D+G   +TAEN  G+
Sbjct: 1471 GQTARFDLKVVGRPMPETFWFHDGQQIVN-DYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPN-PDIVW-LKNSD------IIVPHKYPKI-----RIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRA-KEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKE---------KQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIV-DCKSYDTGEVKVTAENPEGV 1920          

HSP 30 Score: 53.1434 bits (126), Expect = 7.674e-6
Identity = 57/249 (22.89%), Postives = 102/249 (40.96%), Query Frame = 3
Query: 4089 VIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETH-ELVIKNCKKSDAGIYEAQASNTNGSEV--SKCHLQVIDPIGS---VNTTKPLEK-----PISFTIIPTE----RYQPADDNSDISSPQRT--------------QMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFE--MKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDS 4742
            V   CK+SG P P + W K+G+ +   +  ++  + +    L I      D GIY A ASN  G+ +   K +++   P+G+   + T +P+ +     P S +  P      R  PA  +    SP R               + ++    V  P  F          EG        ++G P P  +W ++   I N      + +E     LI+      DSG +++ A+N +G ++ S ++ V++
Sbjct: 1308 VTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCL-------EGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEA 1549          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 117.087 bits (292), Expect = 3.400e-25
Identity = 175/774 (22.61%), Postives = 305/774 (39.41%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSS-CPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTY--INDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE----KPISFT-------------------IIPTERYQPADDNS---------DISSPQRTQMIFSNTI----------VRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYN-THFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            I W KDN  I P  + ++ L  N+ +    + +    + DAGQY C   N     + S    L V  Q+    I K          E    +  + G   +PE  +++      +  SS    S V S  +++ ++  +S++D G Y       +    + T L++ E P F        +L G  + +   ++      P  + W K+K  L     S K Y  +++N      I     A +G+Y C+ +N+ G D            + S   I + A P    +LSD  ++  VG  ++L           VVW KD   +      I I Y  E+  +L+ +     ++G Y   +K     Q     ++ ++ A +++  P+SI+     +  + C V   P   S  W     DG   + L ++ +YK+     NK++G      L   NV  SD G Y   V+N  G  S    + V+      ++   P F +KL KE        V++ CKV G+P   + W   G E+S     +      T  L +   ++SD+G Y   A+N  GS+     L V +P   V    P++      ++FT                   ++P +R   + ++S         D S       I SN            +++P +FV    D  +++G  ++L+    G P   + W  N  +   + R  +        L + +    D+G+Y+   EN+SG  +CSA +++
Sbjct: 8170 ITWAKDNREIRPGGNYKMTLVENTAT----LTVLKVGKGDAGQYTCYASNIAG--KDSCSAQLGV--QEPPRFIKKLEPSRIVKQDEFTRYECKIGG---SPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHN--LSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGADVHLECELQG---TPPFHVSWYKDKRELR----SGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSD----------TCVGS---IALKAPPRFVKKLSD--ISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISY-SENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEK-PESIKVTTGDTCTLECTVAGTPEL-STKWF---KDG---KELTSDNKYKI--SFFNKVSG------LKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVS------DRTVPPSFTRKL-KETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQKPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILI 8884          

HSP 2 Score: 88.1965 bits (217), Expect = 2.065e-16
Identity = 119/543 (21.92%), Postives = 203/543 (37.38%), Query Frame = 3
Query: 3243 FEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRN--LVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE------KPISFTIIPTERYQPA--DDNSDISSPQRTQM----------IFS------------------------NTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
             EI +      G+YTC+ SNE+G       L+  EA   +    P S             +T  VG + K           + +W KD   L S  P  +I    E+K  L+++  T+ D G Y               E+  I     I++  + +++  N  +++ C V+      ++ WS       P ++  +    +   +  PL KL                 D G Y     N AG SS    +TV         +  P F++K+D   +    E   + CK+ G+P   + W KN +ELSES+ +++  V     L I + K  D+G Y  +A N  GS+     + + +P   + T +P +        +   +  T  ++ +   D   I S ++ ++          IFS                          +++ PP FV    D I   G  V L+  + G  P  + W         + + +M        LI+ ++Q    G+Y+  AEN +G  T    +IV
Sbjct: 4440 LEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKS-------------LTTFVGKAAKFICTVTGTPVIETIWQKDGAAL-SPSPNWRIS-DAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIKEL-EPVQSAINKKVHLECQVDEDRKV-TVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKL----------------KDSGTYVCTASNEAGSSSCSATVTV---------REPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEPADIVRGTNALLQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIV 4940          

HSP 3 Score: 86.2705 bits (212), Expect = 7.703e-16
Identity = 157/740 (21.22%), Postives = 272/740 (36.76%), Query Frame = 3
Query: 2538 RIDKDQ-YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVS---SKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTY--INDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            ++D+D+   + W KD + + P  D +I  +    +    + I   +  D+G Y C   N       SS    +V  ++  + + K          E   L   L G   +P   + +      ++ S+       ++E I  +   V ++D G Y          D   T + I E P F+      + + G +  +   +       P  I W K+K  +     S K Y   +    +  EI  F  A VG+Y C V+NE G    K    A   L    T +          ++ D    G  G ++ L           V W+K  Q +   D +I++ +       L I    ++  G Y  + +    +QT++ E+   + A +I+   + I+        +   V   P        +KP      R LV + +Y++          N+ +++ Y  +    D G+Y   + N  G SS     TV       ++  +P F + L + + S +N    + CK++G+    + W K+G+E++ SD  +I  V  T  L I     +DAG +  +A+N+ GS+ S   L V +P                                                   P FVT    + V  G  V LK    G  P  + W+  N   ++     + +E  E  L L  ++  DSG Y+    N +G   CSA + V
Sbjct: 4593 QVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIAT----LEIPLAKLKDSGTYVCTASNEAG----SSSCSATVTVREPPSFVKKVDPSYLMLPGESARLHCKLKG---SPVIQVTWFKNNKELSESNTVRMYFVNSEAI-LDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEPADIVRGTNALLQCEVSG---TGPFEISWFKDKKQIR----SSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVG----KCGCMATHLLKEPPTFV---------KKVDDLIALG--GQTVTLQAAVRGSEPISVTWMK-GQEVIREDGKIKMSF-SNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKIIERA-ELIQVTAGDPATLEYTVAGTPE-------LKPKWYKDGRPLVASKKYRI------SFKNNVAQLKFY--SAELHDSGQYTFEISNEVGSSSCETTFTVL------DRDIAPFFTKPL-RNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEP---------------------------------------------------PSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFV 5222          

HSP 4 Score: 85.8853 bits (211), Expect = 8.883e-16
Identity = 163/719 (22.67%), Postives = 256/719 (35.61%), Query Frame = 3
Query: 2631 SQSGKMKMHIDNCRESDAGQYWCEVR---NGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAK---PISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKE---TGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWS-----IKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALV 4730
            SQSG+    + N    +AGQ  C  R     P+   K     LS  S + G  I    E T+   T P+S+    DGF        I  +   N+         V++ +       + + +D GQY   +   + +DV    +   E P FV       + +GDS+++   +    ++   T+ W K  T L         + N+   LVF   K      G+YTC+  N  G               SS+T+  +  +   P  + QL D  +  +VG  + L           V W +D   L   D  +Q  +  ++  +LKI    ++ SG Y         T  +   +    P + +P     P SI      S +  C V  + P    I WS     I+P  G+ T   V N  +  I K                  V   D G+Y  +  N  G       ++V         K  PKF++KL+   ++   E + + CK+SG+P   + W +N  EL ES    +  +     L I      D+G Y  +A N  G       L V  P   V T KP   P+                                                  +G DV+L+C + G P   ++W        N+ +F++  +  +  L + N++  D G Y   A N  G  TCS  V
Sbjct: 6885 SQSGEYTCVVSN----NAGQASCTTRLFVKEPAAFLKR----LSDHSVEPGKSI--ILESTYTG-TLPISVTWKKDGFN-------ITTSEKCNI---------VTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSVSLQCQVAGTPEI---TVSWYKGDTKLRPTPEYRTYFTNNVATLVFN--KVNINDSGEYTCKAENSIG-------------TASSKTVFRIQERQLPPSFARQLKD--IEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRD-DENLQTSF-VDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREP-KKSPFFDIKPVSIDVIAGESADFECHVTGAQP--MRITWSKDNKEIRPG-GNYTITCVGNTPHLRILK------------------VGKGDSGQYTCQATNDVGKDMCSAQLSV---------KEPPKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAP--PVFTQKP--SPVG-----------------------------------------------ALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSV 7472          

HSP 5 Score: 83.5741 bits (205), Expect = 5.390e-15
Identity = 153/744 (20.56%), Postives = 265/744 (35.62%), Query Frame = 3
Query: 2679 DAGQYWCEVRNGPS-------VIRKSSPVLLSVFSQKQGTVIPKFSEKTFA--ANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN-SRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQF--APVIQDFPQSIRAKQNGSINIVCVV-NSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPL-----EKPISF----TIIPTERYQPADDNSDISSPQRTQMIFSNTI----------------------------------VRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALV 4730
            D+G+Y CE +N          VI K SP     F  K   V+ ++     A  A T P  +    D                  +  S   +     + ++          D G+Y  RV+++    +    + + E P F+      +SL G + A    +K      P T+ W K+   +T +     T+ N+   L          H G Y CQ  N+ G       +    AL+S +    ++ + +S        +  + GD   L V+F         W KD Q L      +I +    ++   LKI      DSG Y   ++      +    IN +     P      + + + +   I++ C+V  S+P   SI W          + +  + +YK           N   +E+    +  +D G Y     N AG +     +TV         K  P F++K   + ++P N +V ++  V G     +KW K+ +EL       + K   +  L +   K +D+G Y  Q SN  G+  SK  L V +P   +    P+      +  +F    T  P  R     D ++I++ Q+  + F + +                                  V+ PP F+       V +  DV L+C + G P   + W   N    ++ ++ +   +  + L +      D+G Y     N  G  +CS  V
Sbjct: 5293 DSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEF--KPIEVLKEYDVMLLAEVAGTPPFEITWFKDN----------------TILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFIKKIESTSSLRGGTAAFQATLKG---SLPITVTWLKDSDEITEDDNIRMTFENNVASLYLS--GIEVKHDGKYVCQAKNDAG-------IQRCSALLSVKEPATITEEAVS--------IDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISV---TDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPI--SIQWF------KDDQEISASEKYKF------SFHDNTAFLEI--SQLEGTDSGTYTCSATNKAGHNQCSGHLTV---------KEPPYFVEKPQSQDVNP-NTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRV 5969          

HSP 6 Score: 82.4185 bits (202), Expect = 1.081e-14
Identity = 160/755 (21.19%), Postives = 289/755 (38.28%), Query Frame = 3
Query: 2652 MHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLS---VFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNH-RSVSLKDVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHK-TYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKET-GQTQTTIV-----EINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG--------SVNTTKPL--------EKPISFTIIPTERYQPADDNSDISSPQRTQM--IFSNTI------------------------VRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSH 4745
            + I+     D+G Y CE  NG      S+ + +    VF+QK   V         A     + L+  + G    P  ++++      V +S     K++S       H  ++   DVG+Y  + +++   D     ++  E P FV      ++L+GD++ +   ++ F    P +++W K++  +     + + ++I++   L    P+ + +  G Y CQ+ N+ G      + SA   ++    +I    KP          +T + G+   L+            W KD + L S D +  I +  +   SLKI  A ++D G Y   +K + G++  T+       I P  F   ++D    + A    S+ + C V+      S+ W     DG+           ++++ P  + + +     L    +  SD G Y     N AG       +TV         +  P F Q  D   + P    +     + G P   +KW K   EL   +   I       EL +   +  ++G Y    +N  GS     HL V +P          SV T  P+          PIS + I  E      +   I+  +++ +  I  +TI                        V  PP F+          G+   L+C + G PE  I W+  +T   + P ++M+ + +   L++  +   D G YS  A+NS G    SA++++ + 
Sbjct: 7349 LTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSPV--------GALKGSDVILQCEISG---TPPFEVVWVKDRKQVRNSKK--FKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSDTSTLIGDAVELRAIVEGFQ---PISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNS--GKYICQIKNDAG----MRECSAVLTVLEPARII---EKP--------EPMTVTTGNPFALECVVTGTPELSAKWFKDGREL-SADSKHHITFINKV-ASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKD----VNAILGASVVLECRVSGSAPI-SVGWF---QDGN-----------EIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTV---------QEPPSFEQTPDSVEVLP-GMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKAR 8039          

HSP 7 Score: 80.4925 bits (197), Expect = 4.385e-14
Identity = 161/786 (20.48%), Postives = 290/786 (36.90%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKT---FAANTEPLSLKLVLDG-----FKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHV---GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSI---NIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVI-----------DPI-----------GSVNTTKPLE----------------------KPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            ++I W+KD + I      R+     SQ   + + I +   +D G+Y C V N    + K   +   +  +      P F +K     A   + ++L+  + G       +    ++I  +  I ++ S+     +  +  I F  +   L +          + + K   +I E+ E +          GD   +   +    ++ PK   W K+  PL  +K    ++ N+  +L     KF  A +   G YT ++SNE G    +   +     +  + + P   KP+ +    D+ V G+     +LD +    +   V W KD + + + D R +I +  E   SL+I    +ND+G +           T  V       A ++Q+ P  +    +  +   + VC+ +++    S   +I+   G+  + LV+     +  + L         +ELY   V TSD G Y  +V N AG       + V         K    F++KL+   +    +   + CKV+G P   + W  N  E+ ES   ++  V  T  L + +    D+G Y  +A N  GS+   C   VI            PI             V  T P E                        +S  I+        +    +++   + +  +   +R PP F+          G     +  L G  P  + W   +     +    M  E +   L L  I+    G+Y   A+N +G+  CSAL+ V
Sbjct: 4787 FEISWFKDKKQIRSSKKYRLF----SQKSLVCLEIFSFNSADVGEYECVVANE---VGKCGCMATHLLKEP-----PTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKIIERAELI------QVTAGDPATLEYTVAGTPELKPK---WYKDGRPLVASKKYRISFKNNVAQL-----KFYSAELHDSGQYTFEISNEVGSSSCETTFT-----VLDRDIAPFFTKPLRNV---DSVVNGTC----RLDCKIAGSLPMRVSWFKDGKEIAASD-RYRIAF-VEGTASLEIIRVDMNDAGNFTC-------RATNSVGSKDSSGALIVQEPPSFVTKPGSKDVLPGSAVCLKSTFQG--STPLTIRWFKGN--KELVSGGSCYITKEALE------SSLELYL--VKTSDSGTYTCKVSNVAGGVECSANLFV---------KEPATFVEKLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSD--HCSSIVIVKESPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSV 5502          

HSP 8 Score: 80.1073 bits (196), Expect = 5.783e-14
Identity = 151/746 (20.24%), Postives = 270/746 (36.19%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNG-------PSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDR 4769
            + + WYKD   +      +I+    S++    +HI N   +D G+Y C+  N         S+  K+ P  +   S     V  +   +T     EP+S+    D  +   ESD I+ +   N+  ++  +S+V      ++  +  +   + +    +S  + A     I EKPE +          GD+  +   +    ++S K   W K+   LT++     ++ N    L  +I     +  G Y+ +V N  G+D     L      +S +T+ P   + +  +        G  G S+ ++ +        V W  +   ++S   R       ++ C+L +N    +DSG Y  +      +      +  ++  P     P  +      ++    +V   P   S++W      GS    LV   R  +       L  ++  +EL+  +V TS  GEY   V N AG +S    + + A A         KF+++L+   I    + +I+    +G P   + W KNG  ++ S    I    ++  L I +    DAG Y     N +G +     + +++P                                                   P FV       V  GD   L+C L G PE  + W+  +T       ++M    +   L+   +   DSG Y   AENS G  + S  + V       S  R
Sbjct: 8355 FHVSWYKDKRELRSGKKYKIM----SENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENI--ATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPAT----IVEKPESI------KVTTGDTCTLECTVAGTPELSTK---WFKDGKELTSDNKYKISFFNKVSGL--KIINVAPSDSGVYSFEVQNPVGKDSCTASLQ-----VSDRTVPPSFTRKLKETN-------GLSGSSVVMECKVYGSPPISVSWFHEGNEISSG--RKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLT-VREPPSFVQKPDPMDVLTGTNVTFTSIVKGTPP-FSVSW----FKGS--SELVPGDRCNV------SLEDSVAELELF--DVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPA---------KFVKRLNDYSIEK-GKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEP---------------------------------------------------PYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSR 8988          

HSP 9 Score: 76.2554 bits (186), Expect = 7.156e-13
Identity = 120/547 (21.94%), Postives = 199/547 (36.38%), Query Frame = 3
Query: 3276 GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPR-FEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLPPETYSNLVKTHINDESRVMQASPRGWQEFQFHSNAST 4913
            G Y CQ+SN+ G    K  L   E         P   K  S   +  N      G S   + +        V W  D   + +       +   +   + +I+GA V +SGTY    +    T +  +E+   +    I++  + +   +   + + C V   P    + W            L NN   +   K    LT  +    L+      SD GEY   V N  G  S     T  AL E       P FI+K++    + +      +  V+G+P   + W+K+ + L E D++ I  V     L I++     +G Y  QA N +G  V +C+                    +F ++                             + P Q V       V E D + L+C + G PE  + W  +   I   R F M  E +     ++++ K DSG+Y+   EN  G ++C A + V        +D++  PS +K L       ++ + I+ E +V  + P   Q F+     ST
Sbjct: 5763 GTYICQLSNDVGTATSKATLFVKEP--------PQFIKKPSPVLVLRN------GQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFI--DGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIREL-KPVEVVKYSDVELECEVTGTPP-FEVTW------------LKNNREIRSSKK--YTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCS---TRVALKEP------PSFIKKIEN-TTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESG--VERCY--------------------AFLLV-----------------------------QEPAQIVEKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRV--------LDQNIPPSFTKKL--TKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEIST 6206          

HSP 10 Score: 73.9442 bits (180), Expect = 3.579e-12
Identity = 113/548 (20.62%), Postives = 189/548 (34.49%), Query Frame = 3
Query: 3261 TQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKC---------SLKINGATVNDSGTYQA-VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNL-VNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTE--------RYQPA------DDNSDISSPQRTQMIFSNT----------------------------------IVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSA 4724
            T+ H G+Y C+  N+ G+     +L+  +            A P+   ++    V  ++G   K   E  +  +    W K  +         +IY  E  KC         SL+I    V D G Y      E G    T        + P     P+S+      +   +C V   P   +I W    A  SP+ N  +++A  K I               L   N+T  D G Y  +  N  G       + +            P FI++L+  + S IN+KV + C+V  +    + W K+G++L      KI    +   L I   K  D+G Y   ASN  GS      + V +P   V    P     S+ ++P E        +  P        +N ++S     +M F N+                                  +++ PP F+ T     +  G + +L+C + G  P  + W+       ++ ++ +  +     L + +    D G Y     N  G   C A
Sbjct: 4351 TEDHQGEYVCEALNDSGKTATSAKLTVVK-----------RAAPVIKRKIEPLEV--ALGHLAKFTCEIQSAPNVRFQWFKAGR---------EIY--ESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKSLTTFVGKAAKFICTVTGTPVIETI-WQKDGAALSPSPNWRISDAENKHI---------------LELSNLTIQDRGVYSCKASNKFGADICQAELIII---------DKPHFIKELEP-VQSAINKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVREPPSFVKKVDP-----SYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEPADIVRGTNALLQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMA 4843          

HSP 11 Score: 73.1738 bits (178), Expect = 6.657e-12
Identity = 154/731 (21.07%), Postives = 264/731 (36.11%), Query Frame = 3
Query: 2652 MHIDNCRESDAGQYWCEVRN-------GPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKY--APESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVS---SKDVAKTHLEIGEK--PEFVYHQFKENSLLGDSLAISIPMK-NFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN----------SRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-----VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPIN----EKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYF-LILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            + I N  + DAGQY CE+ N       G  V     P  ++     +  V    S +   A T  +++       K    PE    F N   NV               + FN   V++ D G+Y  +         +KT   I E+  P     Q K+   +  ++ + + +    +  +P  + W ++   L  ++    +++++   L  +I +   +H G Y+C  SN  G      +L+A E   S    I    KP+S   ++        G+S   +          + W KDN+ +              P ++I         LK+      DSG Y       V K+    Q ++ E  P +F   ++    S  AKQ  SI + C ++  P    ++W    ++      L  + +Y M    +N +        L  +  +  D G+Y     N  G +S    +TV         K  P F QK      SP+       VI++C++SG P   + W+K+ +++  S   KI        L I N + SD G Y  +A+N  GS+   C ++  +P                                                   P+FV   +D     GD V L+  + G+ P  ++W       I          +D    L L + +  +SG+Y    +N +G+  CSA++ V
Sbjct: 6970 LEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTN---NVA-------------TLVFNK--VNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKD---IEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATL--KILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDI----KPVSIDVIA--------GESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRI---------LKVGKG---DSGQYTCQATNDVGKDMCSAQLSVKE--PPKF---VKKLEASKVAKQGESIQLECKISGSPEIK-VSWFRNDSE------LHESWKYNM--SFINSVA------LLTINEASAEDSGDYICEAHNGVGDASCSTALTV---------KAPPVFTQKP-----SPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEP---------------------------------------------------PRFVKKLSDTSTLIGDAVELRAIVEGFQPISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTV 7568          

HSP 12 Score: 70.4774 bits (171), Expect = 4.979e-11
Identity = 80/321 (24.92%), Postives = 133/321 (41.43%), Query Frame = 3
Query: 3780 INWSIKPADG-SPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRV--ENSAG---WSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRK---VGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI-NNPRFEMKRELDEYFLILKN-IQKGDSGRYSITAENSSGL 4709
            + W    +DG +  RN     R K  NK ++  T  ++       N+   +G EY  RV  EN  G   WS +  PIT  +    Q    +P F ++L    +   +   +V CKV+G+P PI+KW + G+E+  +D LK R     G  H+L+I +    DA +Y+ +A+N  GS      L+V  P                              + I  P+  + + +   +R                G+ V +K    G P+P+I W      I NN  +++        L+  N +++ D+G Y + A+N  G+
Sbjct: 31770 VAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLI--EGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQ----APHFKEELRNLNVRYQSNATLV-CKVTGHPKPIVKWYRQGKEII-ADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVP------------------------------AKIHLPKTLEGMGAVHALR----------------GEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGI 32036          

HSP 13 Score: 69.3218 bits (168), Expect = 1.015e-10
Identity = 147/742 (19.81%), Postives = 262/742 (35.31%), Query Frame = 3
Query: 2565 QWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPS-------VIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQF-NHRSVSLKDVGQYLFRVS---SKDVAKTHLEIGEKPEFVYHQFKENSLL--GDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESK---CSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLN-KLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            QW+KD + I      R++  C+ +S  + + ++N    D   Y C+V N          +  K  P  L    ++Q         K     T P  +K   D                 +V   S P   +       F N  SV     GQY   V+     D   T L + E P+FV  + + + ++  GDS  +   +    ++    ++W +N+  L  +     T+I+     V ++   +    GD+ C+  N  G      ++   E  + S    P   + + ++++S             L+ E       +VVW KD + L S        Y   SK    S+ I     +D G Y    +    + T +  +        +++ P+ +       +N + VV   P+   +  SI+ A   P        + ++I +  N ++T       L F     ++ G+Y  +++N  G    M  + V            P  I +    +   + E   + CKV+G P   ++W K+G+ L+ S   K     +   L I + ++ DAG Y  Q  N  G   S C   V                               D SD +                PP F     +     G   +L+C + G  P  + W+   T  ++  +++     +   L L ++   D G Y+  A N +G   C A++ V
Sbjct: 6196 QWFKDGKEISTSAKYRLV--CHERS--VSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPSFLVKPGRQQAIPDSTVEFKAILKGTPPFKIKWFKD-----------------DVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFV-KKLEASKIVKAGDSSRLECKIAGSPEIR---VVWFRNEHELPASDKYRMTFIDSVA--VIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSS--FPPIVETLKNAEVS-------------LECELSGTPPFEVVWYKDKRQLRSSK-----KYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVK-------LKEPPRFV-----SKLNSLTVVAGEPA--ELQASIEGA--QPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVL----------EPAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGK--SSCTAVV-------------------------------DVSDRA---------------VPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTV 6816          

HSP 14 Score: 68.1662 bits (165), Expect = 1.953e-10
Identity = 172/792 (21.72%), Postives = 274/792 (34.60%), Query Frame = 3
Query: 2472 LLLVNAESSCPTRLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRILLQCNSQS---GKMKMHIDNCRESDAGQYWCEVRNG---------------PSVIRKSSPVLLSVFS----QKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVA---KTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDN-QPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQ-------NGSINIVC-VVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTF-TDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI-NNPRFEMKRELDEYFLI-LKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            L+L N +S   T  +  +   P+I      + WY D   I         +Q +  S   G     I   R  ++G Y CE RN                P+ IR+  PV +  +S    + + T  P F       N E  S K      KY     +   N+ I     S                      D G+Y   VS++  +    T + + E P F+       ++L  S              P +I W K+   L  +   + ++++    L  +I      H G YTCQ  NE G     ++   A  L+     I   AK +  ++           D + L+          V WLKD  Q + SR   +     E +  S +I      DSG Y   ++    + +    +  +      Q+ P S   K          SI++ C V  S P   S  W     DG   + +  +A+Y+++         + + + L  +N+   D   Y  +V N AG  +    +TV         K  P F+ K  ++   P +  V  +  + G P   +KW K+  EL       I   G T  L + +   S  G Y    +N  GS+     L V +P                                                   P+FV      +IVK GD   L+C + G PE  + W  N H +  + ++ M   +D   +I + N+   DSG +   A+N +G  +CS  VIV
Sbjct: 5798 LVLRNGQS---TTFECQITGTPKIR-----VSWYLDGNEI-------TAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSK------KYTLTDRVSVFNLHITKCDPS----------------------DTGEYQCIVSNEGGSCSCSTRVALKEPPSFIKKIENTTTVLKSSATF---QSTVAGSPPISITWLKDDQILDEDDNVYISFVDSVATL--QIRSVDNGHSGRYTCQAKNESG-----VERCYAFLLVQEPAQIVEKAKSVDVTE----------KDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSF---ENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLD-----QNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPI--SAQWF---KDG---KEISTSAKYRLVC--------HERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTV---------KEPPSFLVKPGRQQAIP-DSTVEFKAILKGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEP---------------------------------------------------PKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTF-IDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIV 6440          

HSP 15 Score: 68.1662 bits (165), Expect = 2.123e-10
Identity = 149/743 (20.05%), Postives = 269/743 (36.20%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKV-------SSNEMIQFNHRSVSLK-------DVGQYLFRVSSKDVAKTH---LEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSV-GDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIF-SNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSAL 4727
            +++ WYKD   +      +I     S++    +HI N   SD G+Y C+ +N       S   + +V  ++    + K +  T  A  EP  L+  ++G +            PI V      W K        S N  I F     +L+       + G+Y+ ++ +    + +   L + E    V         +G++  +   +    ++S   + W K+   LT+++    ++ N    L   I    +   G YT QV N  G+              S   ++ VS + +  S       TG V G S  L+ +        V W  +   + S   + Q  +  ++ C+L++N    +D G Y  V      +      +  +Q  P     P+ +      ++    V+   P    +NW          R LV   R  +           +  +EL+  N+  S  GEY   V N+AG +S    + V         K    F+++L    + P  + +I+    +G     + W K+G  ++ S+   I    +T  L I N  K DAG Y  +  N  G +V    +  ++P   V   +PLE  +  ++  + + Q A       +P+ T   +  +T +R  P++ T FT+ +                                             L+   +   DSG Y+  AENS G A+   +
Sbjct: 6473 FEVVWYKDKRQLRSSKKYKIA----SKNFHTSIHILNVDTSDIGEYHCKAQNEVG----SDTCVCTVKLKEPPRFVSKLNSLTVVAG-EPAELQASIEGAQ------------PIFVQ-----WLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKAGPMTVTVGETCTLECKVAGTPELS---VEWYKDGKLLTSSQKHKFSFYNKISSL--RILSVERQDAGTYTFQVQNNVGKS-------------SCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVS-GAKYQTTF-SDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLT-VQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTPP-FKVNWF------RGARELVKGDRCNIY------FEDTVAELELF--NIDISQSGEYTCVVSNNAGQASCTTRLFV---------KEPAAFLKRLSDHSVEP-GKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSV--SLQCQVA------GTPEITVSWYKGDTKLRPTPEYRTYFTNNVAT-------------------------------------------LVFNKVNINDSGEYTCKAENSIGTASSKTV 7092          

HSP 16 Score: 67.3958 bits (163), Expect = 3.571e-10
Identity = 119/514 (23.15%), Postives = 190/514 (36.96%), Query Frame = 3
Query: 3255 KFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-----VLKETGQTQTTIVE-INPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNS-DISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNT--HFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSID 4766
            K  ++  G Y+C  +N  G        S++  LI ++   P    P    +L+   V   VG+S   +          V W KD++ + S   + QI Y E S   L +      DSG Y       V K++   Q  I E + P  F    +   +++   +  S  +   V  S P   ++ W     +  PT N               ++T     + L       +D G Y  +V N AG +     I +      +  K  P F Q L    +S   E V + C V G+    ++W+K G E+  SD         T  L +++  K+D+G Y  +ASN  GS+ +K  + + D        KP        + P  +    D     +S PQ  +++   T          TF   I K G D          P P + W+           R  + ++ DE  L +++  K DSG Y   A N  G    +  + VD   K   I+
Sbjct: 9045 KTDRSLAGQYSCTATNPIG------SASSSARLILTEGKNP----PFFDIRLAP--VDAVVGESADFECHVTGTQPIKVSWAKDSREIRSGG-KYQISYLENS-AHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFT---KRLSETVEETEGNSFKLEGRVAGSQPI--TVAWYKNNIEIQPTSNC--------------EITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVI------KEPKKPPVFDQHLTPVTVSE-GEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKD--------KP-------AVAPATKKAAVDGRLFFVSEPQSIRVVEKTT---------ATF---IAKVGGD----------PIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKIE 9481          

HSP 17 Score: 64.6994 bits (156), Expect = 2.296e-9
Identity = 80/311 (25.72%), Postives = 130/311 (41.80%), Query Frame = 3
Query: 3918 TTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIK--NCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSP------------QRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCL--IGYPEPLIWWSYNTHFINNP-RFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPL 4799
            T SD GE+ +  +N AG SS+ + +TV    EA   +  P F++KL K +      ++ ++ + +GNPNP + W+KN + +    + KIR  G   E  +K  +    D+  Y A A N  G + ++C + V      V   +P  +P    IIP   Y+      +I++P            Q  +    +   +  P F    T   +K       +C L  IG P  ++ W ++   +    R  M  E     L        DSG  +  A N  G    SA +IV   ++   ++ SQ P   K L
Sbjct: 1521 TPSDSGEWTVVAQNRAGRSSISVILTV----EAVEHQVKPMFVEKL-KNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNV-----EVEFAEP--EPERKLIIPRGTYR----AKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIV--KDEKSLVEESQLPEGRKGL 1813          

HSP 18 Score: 64.3142 bits (155), Expect = 3.028e-9
Identity = 39/134 (29.10%), Postives = 68/134 (50.75%), Query Frame = 3
Query: 3927 DGGEYCLRV--ENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG 4322
            +G +Y  RV   N+ G   V +P     + EA+ +   PK +  + ++I     +K+ +   V G P+P  KW K  +E+  S HL + K   +  L+IK+  + D+G Y   A N++G++  K  + V+D  G
Sbjct: 19792 EGKKYKFRVAARNAVG---VSLPREAEGVYEAKEQLLPPKIL--MPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPG 19920          

HSP 19 Score: 63.5438 bits (153), Expect = 6.175e-9
Identity = 37/139 (26.62%), Postives = 68/139 (48.92%), Query Frame = 3
Query: 3891 RIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV 4307
            R +L    VT ++ G Y L+  N +G ++    + V A      +   P F+Q+L    +     +V ++ +V+G P P++K+ ++G E+  S   +I + G+ + L+I      D+G Y   A+N+ G   S   L V
Sbjct:   62 RAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKA------ETAPPNFVQRLQSMTVRQ-GSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLV 193          

HSP 20 Score: 63.1586 bits (152), Expect = 7.941e-9
Identity = 44/138 (31.88%), Postives = 65/138 (47.10%), Query Frame = 3
Query: 3897 ELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVG-ETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV 4307
            +L  ++VTT D  EY +   N  G  S    +TV       +    P F ++L         + V    +VSG P P LKW K+G+ LS   +++I   G + + L I++    D G Y   A+NT GS   + HLQV
Sbjct: 32676 QLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMF-KRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 32812          

HSP 21 Score: 62.7734 bits (151), Expect = 8.421e-9
Identity = 79/381 (20.73%), Postives = 148/381 (38.85%), Query Frame = 3
Query: 3657 VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQN---KKTSPKFIQKLDK--------EIISP-------INEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRE-LDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVD 4739
            V++  I+  PV      ++  ++ G +  VC + +Y     + W          R L N+ +Y++  +    +        LY  ++T  D G Y  +V N  G  S    + V  + E  +   ++T  K  ++ D         E   P       + E V     ++ +P P + W K+G+++   D+ K            K   +SD G+Y+                     I SV T    E    +T++   +Y   +D+             +++ +R  P F     +   +EG  V  +  + G P P + W  +   ++  P  E+  E LD Y L +++    D+G Y +TA N++G  +C A + V+
Sbjct: 32487 VKVASIEIGPVSGQIMHAV-GEEGGHVKYVCKIENYDQSTQVTWYFG------VRQLENSEKYEITYEDGVAI--------LYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDK------------KYTFESDKGLYQLT-------------------INSVTTDDDAE----YTVVARNKY--GEDSCKAKLTVTLHPPPTDSTLR--PMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVE 32813          

HSP 22 Score: 62.003 bits (149), Expect = 1.761e-8
Identity = 70/283 (24.73%), Postives = 101/283 (35.69%), Query Frame = 3
Query: 3900 LYFDNVTTSD-GGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSA-LVIVD 4739
            L  D V T D  GEY     N +G ++    +TV        K+ +P   +K++   ++ +       C++   PN   +W K G E+ ESD   IR       L I   +  D G Y  +ASN  GS      L V                       TE Y P                       S P+ +TTF  +  K        C + G P    IW         +P + +    +++ L L N+   D G YS  A N  G   C A L+I+D
Sbjct: 4344 LVIDKVNTEDHQGEYVCEALNDSGKTATSAKLTVV-------KRAAPVIKRKIEPLEVA-LGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTV-----------------------TEAYPPT--------------------FLSRPKSLTTFVGKAAK------FICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIID 4569          

HSP 23 Score: 61.2326 bits (147), Expect = 3.088e-8
Identity = 158/789 (20.03%), Postives = 294/789 (37.26%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANT-EPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVS--SDVVWLKDNQPLNS----RDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEK----------------PISFTIIPTER-------YQPADDN------------SDISSPQ--RTQMIFSNTIV-----RSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYF---------LILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            + ++W+K +  ++P     I L+        ++ +   +  ++G Y C V N       S+     +F ++  T + + ++  F+  T  P+ L+    G    P S     +  +      C  +    + +++    ++  +D  QY   +   + +D+ +  + + E P F+       +++G+   +   +    ++    I W K  T L +       + N+   LV  I K   + VG+Y+C+  N  G        S+A  +I ++ L P  A+ +     +  +    V    +++   P  VS   D V LKD+  L +        +QI   ++S    + N +  N  GT  +  K         + ++  +  P     P S+      S    C V        I W+         R +     YKM       L  N   + +    V   D G+Y     N AG  S    + V         +  P+FI+KL+   I   +E     CK+ G+P   + W K+  E+ ES   ++  V     L + N    D+G Y  +A N  GS  S   L+V +P        P+E                 P   +    +R       Y+   +N            +DI   Q   T  + S+T V     ++PP+FV   +D     G +V L+  + G  P  ++W+          + E+ RE D  +         L    ++  ++G+Y+   +N +G+  C A + V
Sbjct: 7790 FKVKWFKGSRELVPGESCNISLE----DFVTELELFEVQPLESGDYSCLVTNDAG----SASCTTHLFVKEPATFVKRLAD--FSVETGSPIVLEATYTG--TPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTI--EDYAQYSCLIENEAGQDICEALVSVLEPPYFIEPLEHVEAVIGEPATLQCKVDGTPEIR---ISWYKEHTKLRSAPAYKMQFKNNVASLV--INKVDHSDVGEYSCKADNSVG-----AVASSAVLVIKARKLPPFFARKLKDVHETLGF---PVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIG-QYNCSASNPLGTASSSAK---------LILSEHEVPPFFDLKPVSVDLALGESGTFKCHVTGTAPIK-ITWA------KDNREIRPGGNYKMT------LVENTATLTVL--KVGKGDAGQYTCYASNIAGKDSCSAQLGV---------QEPPRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWF--------KDKGEIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSV 8509          

HSP 24 Score: 59.3066 bits (142), Expect = 9.575e-8
Identity = 54/247 (21.86%), Postives = 105/247 (42.51%), Query Frame = 3
Query: 4029 TSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVR---------SPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYN-THFINNPRFEMK--RELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVI 4733
            T P  +  L K +     E V + C +SG P+P + W +   ++  S   +I        L+I+     D+G +   A N  G+  + C+L       +V  ++  EK    T   TE++   ++   + S     ++ ++T +          + P F+T    + + EG  VV  C + G P+P ++W  +        R+++   ++  E  L++      D+G Y+I   N  G  + SA ++
Sbjct:  941 TPPTLVSGL-KNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYL-------AVQVSEEFEKE---TTAVTEKFT-TEEKRFVES---RDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLL 1172          

HSP 25 Score: 59.3066 bits (142), Expect = 1.068e-7
Identity = 59/251 (23.51%), Postives = 99/251 (39.44%), Query Frame = 3
Query: 4011 EAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWW---------SYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +++ + T P FI+++    IS + +   +   V G P P ++W  NG  L+ S   K    G+ H L+I   K  D G Y   ASN  G  +   +L+ I+  G  +     E  ++ ++              +  P              PP F+         +G   + +  ++G P P + W         S     I+NP             I+ + Q+ DSG Y   AEN  G +TC+A ++V
Sbjct: 3495 DSEKEGTGPIFIKEVSNADIS-MGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLK-INSKGEGHKDTETESAVAKSL------------EKLGGP-------------CPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPN-------GSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLV 3711          

HSP 26 Score: 58.151 bits (139), Expect = 2.348e-7
Identity = 57/254 (22.44%), Postives = 104/254 (40.94%), Query Frame = 3
Query: 4065 IISPINEKVI-------VRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE-----KPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVR----------SPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNH 4757
            II+P+ + V         +C+VSG  +  + W    +++  S   ++ +  +T++L I      D G Y   ASN  G   S  +L +  P   ++     E     K  S + +  E          +S    T  + S + V           + P F+   ++  +  GD   L   +IG P+P I W +N   +  +  ++   + D++ LI+   +  D G Y+  A N  G   CSA + ++S  + H
Sbjct: 3347 IITPLQDTVTSEGQPARFQCRVSGT-DLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSKINETLELLSESPVYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGH 3599          

HSP 27 Score: 57.7658 bits (138), Expect = 3.045e-7
Identity = 53/243 (21.81%), Postives = 96/243 (39.51%), Query Frame = 3
Query: 4032 SPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESD--HLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNK 4751
            +P F Q L + ++            +SG P P + W ++G+ +S S    ++I       +L I    K+++G Y  +A+N +G   S   L                                             ++ + T   +PP FV       V++G  V L+  + G P P++ ++       ++  F++ +E D Y L++      DSG YS+ A NS G AT +A ++V    +
Sbjct:    5 APTFTQPL-QSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAEL---------------------------------------------LVKAET---APPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEE 198          

HSP 28 Score: 57.7658 bits (138), Expect = 3.229e-7
Identity = 65/285 (22.81%), Postives = 109/285 (38.25%), Query Frame = 3
Query: 3927 DGGEYCLRV--ENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKE------GDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEY-FLILKNIQ-KGDSGRYSITAENSSGLATCSALVIVDSHNK 4751
            +  EY  RV  EN  G S    P   A   + +        I+K  K++ + + E   + C++ G P P +KW + G+EL +S   K+   G TH L +   ++ D G+Y   A+N                +G V T+                                    S  ++++ PQF   +    +KE      G  + L    IG P P + W +    + N         + Y  L++KN+Q K  +G+Y +   N  G  T  A++ V+  +K
Sbjct: 31424 EATEYEFRVFAENETGLSR---PRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNE---------------VGEVETS------------------------------------SKLLLQATPQFHPGYP---LKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFG--TVDAILDVEIQDK 31649          

HSP 29 Score: 55.0694 bits (131), Expect = 2.276e-6
Identity = 46/148 (31.08%), Postives = 61/148 (41.22%), Query Frame = 3
Query: 3930 GGEYCLRV--EN--SAGWSSVMIPITVAALAEAQNKKTSP------KFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVID----PIGSVN 4331
            G  Y  RV  EN    G     IPI      E Q K   P      K I+ L  +  + +    I+R    G P P  KW  +G E+   +H  +     +  L IKNC + D G Y+   SN  GS+    HL V+D    P G +N
Sbjct: 18402 GKTYRFRVKAENIVGLGLPDTTIPI------ECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIR----GVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPIN 18539          

HSP 30 Score: 54.6842 bits (130), Expect = 2.714e-6
Identity = 66/243 (27.16%), Postives = 105/243 (43.21%), Query Frame = 3
Query: 3894 IELYFDNVTTSDGGEYCLRV--ENSAGW----SSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTER----YQP--ADDNSDISS---PQRTQMIFSNTIVRSPPQFVTTFTDEIVK--EGDDVVLKCCLI---GYPEPL 4562
            IE  F     ++   Y  RV  +N+AG     S    PIT     E       PKF       I+    E   +   V G P P ++W++  +E+ ES   +I+       L++K+  + D G Y  +ASN  GS+    +++V+D  G      P E P+  T + +E+    + P   D  SDIS     +R     + T+V S    V T + ++ K  EG++ V +   +   G  EPL
Sbjct: 24503 IETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKF----RDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPG------PPEGPVQVTGVTSEKCSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASE---VVTNSLKVTKLLEGNEYVFRIMAVNKYGVGEPL 24732          

HSP 31 Score: 53.9138 bits (128), Expect = 3.991e-6
Identity = 50/206 (24.27%), Postives = 89/206 (43.20%), Query Frame = 3
Query: 4131 LKWMKNGEELSESDHLKIRKVGE-THELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDS 4742
            + W K+G++L E+ H +     + T+EL I N  +SD G Y  + S   G+  SK +LQ +         K + + +S  I  T++   +D  +  S+  R     +   + S P  VT   D  V             G P P   W+ +   I    ++++  +   +FL +      DSG Y+ T +NS+G  + S  + + +
Sbjct: 33676 VTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGT--SKTNLQFMG-----QAFKSIHEKVS-KISETKK---SDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKA 33870          

HSP 32 Score: 53.1434 bits (126), Expect = 7.360e-6
Identity = 95/475 (20.00%), Postives = 182/475 (38.32%), Query Frame = 3
Query: 3438 GDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK-ETGQTQTTI---VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVA---ALAEAQNKKTSPKFIQKLDKEIISPINEKVIVR----------------------------------------CKVS--GNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTK-PLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGL 4709
            G + + D++       +  W  D Q + + D   ++   E+   SL I  AT +DSG +  V +   G++  ++   VE    Q  P+  +  +++  K+   + +       P+   I W +K +D      ++   +Y  I     ++ G      L  D+  + D   Y     N AG  +    + V    A  E + K   P+   +  KEI +P  E + +R                                        C+++  G+P  +++W+ +G+ L  ++ L++        L        D+GI   +A+N  G++ +   L V D    V  ++ P  +     I   ER       + +++ Q+          +  P  V       V EG+    +C + GYP+P + W  N   I  + RF ++ +   Y  I+ + +  D+G   +TAEN  G+
Sbjct: 1471 GQTARFDLKVVGRPMPETFWFHDGQQIVN-DYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPN-PDIVW-LKNSD------IIVPHKYPKI-----RIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRA-KEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKE---------KQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIV-DCKSYDTGEVKVTAENPEGV 1920          

HSP 33 Score: 53.1434 bits (126), Expect = 8.207e-6
Identity = 57/249 (22.89%), Postives = 102/249 (40.96%), Query Frame = 3
Query: 4089 VIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETH-ELVIKNCKKSDAGIYEAQASNTNGSEV--SKCHLQVIDPIGS---VNTTKPLEK-----PISFTIIPTE----RYQPADDNSDISSPQRT--------------QMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFE--MKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDS 4742
            V   CK+SG P P + W K+G+ +   +  ++  + +    L I      D GIY A ASN  G+ +   K +++   P+G+   + T +P+ +     P S +  P      R  PA  +    SP R               + ++    V  P  F          EG        ++G P P  +W ++   I N      + +E     LI+      DSG +++ A+N +G ++ S ++ V++
Sbjct: 1308 VTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCL-------EGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEA 1549          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 117.087 bits (292), Expect = 3.400e-25
Identity = 175/774 (22.61%), Postives = 305/774 (39.41%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSS-CPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTY--INDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE----KPISFT-------------------IIPTERYQPADDNS---------DISSPQRTQMIFSNTI----------VRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYN-THFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            I W KDN  I P  + ++ L  N+ +    + +    + DAGQY C   N     + S    L V  Q+    I K          E    +  + G   +PE  +++      +  SS    S V S  +++ ++  +S++D G Y       +    + T L++ E P F        +L G  + +   ++      P  + W K+K  L     S K Y  +++N      I     A +G+Y C+ +N+ G D            + S   I + A P    +LSD  ++  VG  ++L           VVW KD   +      I I Y  E+  +L+ +     ++G Y   +K     Q     ++ ++ A +++  P+SI+     +  + C V   P   S  W     DG   + L ++ +YK+     NK++G      L   NV  SD G Y   V+N  G  S    + V+      ++   P F +KL KE        V++ CKV G+P   + W   G E+S     +      T  L +   ++SD+G Y   A+N  GS+     L V +P   V    P++      ++FT                   ++P +R   + ++S         D S       I SN            +++P +FV    D  +++G  ++L+    G P   + W  N  +   + R  +        L + +    D+G+Y+   EN+SG  +CSA +++
Sbjct: 8170 ITWAKDNREIRPGGNYKMTLVENTAT----LTVLKVGKGDAGQYTCYASNIAG--KDSCSAQLGV--QEPPRFIKKLEPSRIVKQDEFTRYECKIGG---SPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHN--LSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGADVHLECELQG---TPPFHVSWYKDKRELR----SGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSD----------TCVGS---IALKAPPRFVKKLSD--ISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISY-SENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEK-PESIKVTTGDTCTLECTVAGTPEL-STKWF---KDG---KELTSDNKYKI--SFFNKVSG------LKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVS------DRTVPPSFTRKL-KETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQKPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILI 8884          

HSP 2 Score: 88.1965 bits (217), Expect = 2.065e-16
Identity = 119/543 (21.92%), Postives = 203/543 (37.38%), Query Frame = 3
Query: 3243 FEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRN--LVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE------KPISFTIIPTERYQPA--DDNSDISSPQRTQM----------IFS------------------------NTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
             EI +      G+YTC+ SNE+G       L+  EA   +    P S             +T  VG + K           + +W KD   L S  P  +I    E+K  L+++  T+ D G Y               E+  I     I++  + +++  N  +++ C V+      ++ WS       P ++  +    +   +  PL KL                 D G Y     N AG SS    +TV         +  P F++K+D   +    E   + CK+ G+P   + W KN +ELSES+ +++  V     L I + K  D+G Y  +A N  GS+     + + +P   + T +P +        +   +  T  ++ +   D   I S ++ ++          IFS                          +++ PP FV    D I   G  V L+  + G  P  + W         + + +M        LI+ ++Q    G+Y+  AEN +G  T    +IV
Sbjct: 4440 LEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKS-------------LTTFVGKAAKFICTVTGTPVIETIWQKDGAAL-SPSPNWRIS-DAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIKEL-EPVQSAINKKVHLECQVDEDRKV-TVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKL----------------KDSGTYVCTASNEAGSSSCSATVTV---------REPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEPADIVRGTNALLQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIV 4940          

HSP 3 Score: 86.2705 bits (212), Expect = 7.703e-16
Identity = 157/740 (21.22%), Postives = 272/740 (36.76%), Query Frame = 3
Query: 2538 RIDKDQ-YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVS---SKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTY--INDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            ++D+D+   + W KD + + P  D +I  +    +    + I   +  D+G Y C   N       SS    +V  ++  + + K          E   L   L G   +P   + +      ++ S+       ++E I  +   V ++D G Y          D   T + I E P F+      + + G +  +   +       P  I W K+K  +     S K Y   +    +  EI  F  A VG+Y C V+NE G    K    A   L    T +          ++ D    G  G ++ L           V W+K  Q +   D +I++ +       L I    ++  G Y  + +    +QT++ E+   + A +I+   + I+        +   V   P        +KP      R LV + +Y++          N+ +++ Y  +    D G+Y   + N  G SS     TV       ++  +P F + L + + S +N    + CK++G+    + W K+G+E++ SD  +I  V  T  L I     +DAG +  +A+N+ GS+ S   L V +P                                                   P FVT    + V  G  V LK    G  P  + W+  N   ++     + +E  E  L L  ++  DSG Y+    N +G   CSA + V
Sbjct: 4593 QVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIAT----LEIPLAKLKDSGTYVCTASNEAG----SSSCSATVTVREPPSFVKKVDPSYLMLPGESARLHCKLKG---SPVIQVTWFKNNKELSESNTVRMYFVNSEAI-LDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEPADIVRGTNALLQCEVSG---TGPFEISWFKDKKQIR----SSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVG----KCGCMATHLLKEPPTFV---------KKVDDLIALG--GQTVTLQAAVRGSEPISVTWMK-GQEVIREDGKIKMSF-SNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKIIERA-ELIQVTAGDPATLEYTVAGTPE-------LKPKWYKDGRPLVASKKYRI------SFKNNVAQLKFY--SAELHDSGQYTFEISNEVGSSSCETTFTVL------DRDIAPFFTKPL-RNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEP---------------------------------------------------PSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFV 5222          

HSP 4 Score: 85.8853 bits (211), Expect = 8.883e-16
Identity = 163/719 (22.67%), Postives = 256/719 (35.61%), Query Frame = 3
Query: 2631 SQSGKMKMHIDNCRESDAGQYWCEVR---NGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAK---PISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKE---TGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWS-----IKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALV 4730
            SQSG+    + N    +AGQ  C  R     P+   K     LS  S + G  I    E T+   T P+S+    DGF        I  +   N+         V++ +       + + +D GQY   +   + +DV    +   E P FV       + +GDS+++   +    ++   T+ W K  T L         + N+   LVF   K      G+YTC+  N  G               SS+T+  +  +   P  + QL D  +  +VG  + L           V W +D   L   D  +Q  +  ++  +LKI    ++ SG Y         T  +   +    P + +P     P SI      S +  C V  + P    I WS     I+P  G+ T   V N  +  I K                  V   D G+Y  +  N  G       ++V         K  PKF++KL+   ++   E + + CK+SG+P   + W +N  EL ES    +  +     L I      D+G Y  +A N  G       L V  P   V T KP   P+                                                  +G DV+L+C + G P   ++W        N+ +F++  +  +  L + N++  D G Y   A N  G  TCS  V
Sbjct: 6885 SQSGEYTCVVSN----NAGQASCTTRLFVKEPAAFLKR----LSDHSVEPGKSI--ILESTYTG-TLPISVTWKKDGFN-------ITTSEKCNI---------VTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSVSLQCQVAGTPEI---TVSWYKGDTKLRPTPEYRTYFTNNVATLVFN--KVNINDSGEYTCKAENSIG-------------TASSKTVFRIQERQLPPSFARQLKD--IEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRD-DENLQTSF-VDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREP-KKSPFFDIKPVSIDVIAGESADFECHVTGAQP--MRITWSKDNKEIRPG-GNYTITCVGNTPHLRILK------------------VGKGDSGQYTCQATNDVGKDMCSAQLSV---------KEPPKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAP--PVFTQKP--SPVG-----------------------------------------------ALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSV 7472          

HSP 5 Score: 83.5741 bits (205), Expect = 5.390e-15
Identity = 153/744 (20.56%), Postives = 265/744 (35.62%), Query Frame = 3
Query: 2679 DAGQYWCEVRNGPS-------VIRKSSPVLLSVFSQKQGTVIPKFSEKTFA--ANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN-SRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQF--APVIQDFPQSIRAKQNGSINIVCVV-NSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPL-----EKPISF----TIIPTERYQPADDNSDISSPQRTQMIFSNTI----------------------------------VRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALV 4730
            D+G+Y CE +N          VI K SP     F  K   V+ ++     A  A T P  +    D                  +  S   +     + ++          D G+Y  RV+++    +    + + E P F+      +SL G + A    +K      P T+ W K+   +T +     T+ N+   L          H G Y CQ  N+ G       +    AL+S +    ++ + +S        +  + GD   L V+F         W KD Q L      +I +    ++   LKI      DSG Y   ++      +    IN +     P      + + + +   I++ C+V  S+P   SI W          + +  + +YK           N   +E+    +  +D G Y     N AG +     +TV         K  P F++K   + ++P N +V ++  V G     +KW K+ +EL       + K   +  L +   K +D+G Y  Q SN  G+  SK  L V +P   +    P+      +  +F    T  P  R     D ++I++ Q+  + F + +                                  V+ PP F+       V +  DV L+C + G P   + W   N    ++ ++ +   +  + L +      D+G Y     N  G  +CS  V
Sbjct: 5293 DSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEF--KPIEVLKEYDVMLLAEVAGTPPFEITWFKDN----------------TILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFIKKIESTSSLRGGTAAFQATLKG---SLPITVTWLKDSDEITEDDNIRMTFENNVASLYLS--GIEVKHDGKYVCQAKNDAG-------IQRCSALLSVKEPATITEEAVS--------IDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISV---TDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPI--SIQWF------KDDQEISASEKYKF------SFHDNTAFLEI--SQLEGTDSGTYTCSATNKAGHNQCSGHLTV---------KEPPYFVEKPQSQDVNP-NTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRV 5969          

HSP 6 Score: 82.4185 bits (202), Expect = 1.081e-14
Identity = 160/755 (21.19%), Postives = 289/755 (38.28%), Query Frame = 3
Query: 2652 MHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLS---VFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNH-RSVSLKDVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHK-TYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKET-GQTQTTIV-----EINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG--------SVNTTKPL--------EKPISFTIIPTERYQPADDNSDISSPQRTQM--IFSNTI------------------------VRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSH 4745
            + I+     D+G Y CE  NG      S+ + +    VF+QK   V         A     + L+  + G    P  ++++      V +S     K++S       H  ++   DVG+Y  + +++   D     ++  E P FV      ++L+GD++ +   ++ F    P +++W K++  +     + + ++I++   L    P+ + +  G Y CQ+ N+ G      + SA   ++    +I    KP          +T + G+   L+            W KD + L S D +  I +  +   SLKI  A ++D G Y   +K + G++  T+       I P  F   ++D    + A    S+ + C V+      S+ W     DG+           ++++ P  + + +     L    +  SD G Y     N AG       +TV         +  P F Q  D   + P    +     + G P   +KW K   EL   +   I       EL +   +  ++G Y    +N  GS     HL V +P          SV T  P+          PIS + I  E      +   I+  +++ +  I  +TI                        V  PP F+          G+   L+C + G PE  I W+  +T   + P ++M+ + +   L++  +   D G YS  A+NS G    SA++++ + 
Sbjct: 7349 LTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSPV--------GALKGSDVILQCEISG---TPPFEVVWVKDRKQVRNSKK--FKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSDTSTLIGDAVELRAIVEGFQ---PISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNS--GKYICQIKNDAG----MRECSAVLTVLEPARII---EKP--------EPMTVTTGNPFALECVVTGTPELSAKWFKDGREL-SADSKHHITFINKV-ASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKD----VNAILGASVVLECRVSGSAPI-SVGWF---QDGN-----------EIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTV---------QEPPSFEQTPDSVEVLP-GMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKAR 8039          

HSP 7 Score: 80.4925 bits (197), Expect = 4.385e-14
Identity = 161/786 (20.48%), Postives = 290/786 (36.90%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKT---FAANTEPLSLKLVLDG-----FKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHV---GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSI---NIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVI-----------DPI-----------GSVNTTKPLE----------------------KPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            ++I W+KD + I      R+     SQ   + + I +   +D G+Y C V N    + K   +   +  +      P F +K     A   + ++L+  + G       +    ++I  +  I ++ S+     +  +  I F  +   L +          + + K   +I E+ E +          GD   +   +    ++ PK   W K+  PL  +K    ++ N+  +L     KF  A +   G YT ++SNE G    +   +     +  + + P   KP+ +    D+ V G+     +LD +    +   V W KD + + + D R +I +  E   SL+I    +ND+G +           T  V       A ++Q+ P  +    +  +   + VC+ +++    S   +I+   G+  + LV+     +  + L         +ELY   V TSD G Y  +V N AG       + V         K    F++KL+   +    +   + CKV+G P   + W  N  E+ ES   ++  V  T  L + +    D+G Y  +A N  GS+   C   VI            PI             V  T P E                        +S  I+        +    +++   + +  +   +R PP F+          G     +  L G  P  + W   +     +    M  E +   L L  I+    G+Y   A+N +G+  CSAL+ V
Sbjct: 4787 FEISWFKDKKQIRSSKKYRLF----SQKSLVCLEIFSFNSADVGEYECVVANE---VGKCGCMATHLLKEP-----PTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKIIERAELI------QVTAGDPATLEYTVAGTPELKPK---WYKDGRPLVASKKYRISFKNNVAQL-----KFYSAELHDSGQYTFEISNEVGSSSCETTFT-----VLDRDIAPFFTKPLRNV---DSVVNGTC----RLDCKIAGSLPMRVSWFKDGKEIAASD-RYRIAF-VEGTASLEIIRVDMNDAGNFTC-------RATNSVGSKDSSGALIVQEPPSFVTKPGSKDVLPGSAVCLKSTFQG--STPLTIRWFKGN--KELVSGGSCYITKEALE------SSLELYL--VKTSDSGTYTCKVSNVAGGVECSANLFV---------KEPATFVEKLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSD--HCSSIVIVKESPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSV 5502          

HSP 8 Score: 80.1073 bits (196), Expect = 5.783e-14
Identity = 151/746 (20.24%), Postives = 270/746 (36.19%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNG-------PSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDR 4769
            + + WYKD   +      +I+    S++    +HI N   +D G+Y C+  N         S+  K+ P  +   S     V  +   +T     EP+S+    D  +   ESD I+ +   N+  ++  +S+V      ++  +  +   + +    +S  + A     I EKPE +          GD+  +   +    ++S K   W K+   LT++     ++ N    L  +I     +  G Y+ +V N  G+D     L      +S +T+ P   + +  +        G  G S+ ++ +        V W  +   ++S   R       ++ C+L +N    +DSG Y  +      +      +  ++  P     P  +      ++    +V   P   S++W      GS    LV   R  +       L  ++  +EL+  +V TS  GEY   V N AG +S    + + A A         KF+++L+   I    + +I+    +G P   + W KNG  ++ S    I    ++  L I +    DAG Y     N +G +     + +++P                                                   P FV       V  GD   L+C L G PE  + W+  +T       ++M    +   L+   +   DSG Y   AENS G  + S  + V       S  R
Sbjct: 8355 FHVSWYKDKRELRSGKKYKIM----SENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENI--ATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPAT----IVEKPESI------KVTTGDTCTLECTVAGTPELSTK---WFKDGKELTSDNKYKISFFNKVSGL--KIINVAPSDSGVYSFEVQNPVGKDSCTASLQ-----VSDRTVPPSFTRKLKETN-------GLSGSSVVMECKVYGSPPISVSWFHEGNEISSG--RKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLT-VREPPSFVQKPDPMDVLTGTNVTFTSIVKGTPP-FSVSW----FKGS--SELVPGDRCNV------SLEDSVAELELF--DVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPA---------KFVKRLNDYSIEK-GKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEP---------------------------------------------------PYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSR 8988          

HSP 9 Score: 76.2554 bits (186), Expect = 7.156e-13
Identity = 120/547 (21.94%), Postives = 199/547 (36.38%), Query Frame = 3
Query: 3276 GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPR-FEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLPPETYSNLVKTHINDESRVMQASPRGWQEFQFHSNAST 4913
            G Y CQ+SN+ G    K  L   E         P   K  S   +  N      G S   + +        V W  D   + +       +   +   + +I+GA V +SGTY    +    T +  +E+   +    I++  + +   +   + + C V   P    + W            L NN   +   K    LT  +    L+      SD GEY   V N  G  S     T  AL E       P FI+K++    + +      +  V+G+P   + W+K+ + L E D++ I  V     L I++     +G Y  QA N +G  V +C+                    +F ++                             + P Q V       V E D + L+C + G PE  + W  +   I   R F M  E +     ++++ K DSG+Y+   EN  G ++C A + V        +D++  PS +K L       ++ + I+ E +V  + P   Q F+     ST
Sbjct: 5763 GTYICQLSNDVGTATSKATLFVKEP--------PQFIKKPSPVLVLRN------GQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFI--DGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIREL-KPVEVVKYSDVELECEVTGTPP-FEVTW------------LKNNREIRSSKK--YTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCS---TRVALKEP------PSFIKKIEN-TTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESG--VERCY--------------------AFLLV-----------------------------QEPAQIVEKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRV--------LDQNIPPSFTKKL--TKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEIST 6206          

HSP 10 Score: 73.9442 bits (180), Expect = 3.579e-12
Identity = 113/548 (20.62%), Postives = 189/548 (34.49%), Query Frame = 3
Query: 3261 TQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKC---------SLKINGATVNDSGTYQA-VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNL-VNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTE--------RYQPA------DDNSDISSPQRTQMIFSNT----------------------------------IVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSA 4724
            T+ H G+Y C+  N+ G+     +L+  +            A P+   ++    V  ++G   K   E  +  +    W K  +         +IY  E  KC         SL+I    V D G Y      E G    T        + P     P+S+      +   +C V   P   +I W    A  SP+ N  +++A  K I               L   N+T  D G Y  +  N  G       + +            P FI++L+  + S IN+KV + C+V  +    + W K+G++L      KI    +   L I   K  D+G Y   ASN  GS      + V +P   V    P     S+ ++P E        +  P        +N ++S     +M F N+                                  +++ PP F+ T     +  G + +L+C + G  P  + W+       ++ ++ +  +     L + +    D G Y     N  G   C A
Sbjct: 4351 TEDHQGEYVCEALNDSGKTATSAKLTVVK-----------RAAPVIKRKIEPLEV--ALGHLAKFTCEIQSAPNVRFQWFKAGR---------EIY--ESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKSLTTFVGKAAKFICTVTGTPVIETI-WQKDGAALSPSPNWRISDAENKHI---------------LELSNLTIQDRGVYSCKASNKFGADICQAELIII---------DKPHFIKELEP-VQSAINKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVREPPSFVKKVDP-----SYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEPADIVRGTNALLQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMA 4843          

HSP 11 Score: 73.1738 bits (178), Expect = 6.657e-12
Identity = 154/731 (21.07%), Postives = 264/731 (36.11%), Query Frame = 3
Query: 2652 MHIDNCRESDAGQYWCEVRN-------GPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKY--APESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVS---SKDVAKTHLEIGEK--PEFVYHQFKENSLLGDSLAISIPMK-NFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN----------SRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-----VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPIN----EKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYF-LILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            + I N  + DAGQY CE+ N       G  V     P  ++     +  V    S +   A T  +++       K    PE    F N   NV               + FN   V++ D G+Y  +         +KT   I E+  P     Q K+   +  ++ + + +    +  +P  + W ++   L  ++    +++++   L  +I +   +H G Y+C  SN  G      +L+A E   S    I    KP+S   ++        G+S   +          + W KDN+ +              P ++I         LK+      DSG Y       V K+    Q ++ E  P +F   ++    S  AKQ  SI + C ++  P    ++W    ++      L  + +Y M    +N +        L  +  +  D G+Y     N  G +S    +TV         K  P F QK      SP+       VI++C++SG P   + W+K+ +++  S   KI        L I N + SD G Y  +A+N  GS+   C ++  +P                                                   P+FV   +D     GD V L+  + G+ P  ++W       I          +D    L L + +  +SG+Y    +N +G+  CSA++ V
Sbjct: 6970 LEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTN---NVA-------------TLVFNK--VNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKD---IEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATL--KILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDI----KPVSIDVIA--------GESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRI---------LKVGKG---DSGQYTCQATNDVGKDMCSAQLSVKE--PPKF---VKKLEASKVAKQGESIQLECKISGSPEIK-VSWFRNDSE------LHESWKYNM--SFINSVA------LLTINEASAEDSGDYICEAHNGVGDASCSTALTV---------KAPPVFTQKP-----SPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEP---------------------------------------------------PRFVKKLSDTSTLIGDAVELRAIVEGFQPISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTV 7568          

HSP 12 Score: 70.4774 bits (171), Expect = 4.979e-11
Identity = 80/321 (24.92%), Postives = 133/321 (41.43%), Query Frame = 3
Query: 3780 INWSIKPADG-SPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRV--ENSAG---WSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRK---VGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI-NNPRFEMKRELDEYFLILKN-IQKGDSGRYSITAENSSGL 4709
            + W    +DG +  RN     R K  NK ++  T  ++       N+   +G EY  RV  EN  G   WS +  PIT  +    Q    +P F ++L    +   +   +V CKV+G+P PI+KW + G+E+  +D LK R     G  H+L+I +    DA +Y+ +A+N  GS      L+V  P                              + I  P+  + + +   +R                G+ V +K    G P+P+I W      I NN  +++        L+  N +++ D+G Y + A+N  G+
Sbjct: 31770 VAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLI--EGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQ----APHFKEELRNLNVRYQSNATLV-CKVTGHPKPIVKWYRQGKEII-ADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVP------------------------------AKIHLPKTLEGMGAVHALR----------------GEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGI 32036          

HSP 13 Score: 69.3218 bits (168), Expect = 1.015e-10
Identity = 147/742 (19.81%), Postives = 262/742 (35.31%), Query Frame = 3
Query: 2565 QWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPS-------VIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQF-NHRSVSLKDVGQYLFRVS---SKDVAKTHLEIGEKPEFVYHQFKENSLL--GDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESK---CSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLN-KLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            QW+KD + I      R++  C+ +S  + + ++N    D   Y C+V N          +  K  P  L    ++Q         K     T P  +K   D                 +V   S P   +       F N  SV     GQY   V+     D   T L + E P+FV  + + + ++  GDS  +   +    ++    ++W +N+  L  +     T+I+     V ++   +    GD+ C+  N  G      ++   E  + S    P   + + ++++S             L+ E       +VVW KD + L S        Y   SK    S+ I     +D G Y    +    + T +  +        +++ P+ +       +N + VV   P+   +  SI+ A   P        + ++I +  N ++T       L F     ++ G+Y  +++N  G    M  + V            P  I +    +   + E   + CKV+G P   ++W K+G+ L+ S   K     +   L I + ++ DAG Y  Q  N  G   S C   V                               D SD +                PP F     +     G   +L+C + G  P  + W+   T  ++  +++     +   L L ++   D G Y+  A N +G   C A++ V
Sbjct: 6196 QWFKDGKEISTSAKYRLV--CHERS--VSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPSFLVKPGRQQAIPDSTVEFKAILKGTPPFKIKWFKD-----------------DVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFV-KKLEASKIVKAGDSSRLECKIAGSPEIR---VVWFRNEHELPASDKYRMTFIDSVA--VIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSS--FPPIVETLKNAEVS-------------LECELSGTPPFEVVWYKDKRQLRSSK-----KYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVK-------LKEPPRFV-----SKLNSLTVVAGEPA--ELQASIEGA--QPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVL----------EPAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGK--SSCTAVV-------------------------------DVSDRA---------------VPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTV 6816          

HSP 14 Score: 68.1662 bits (165), Expect = 1.953e-10
Identity = 172/792 (21.72%), Postives = 274/792 (34.60%), Query Frame = 3
Query: 2472 LLLVNAESSCPTRLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRILLQCNSQS---GKMKMHIDNCRESDAGQYWCEVRNG---------------PSVIRKSSPVLLSVFS----QKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVA---KTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDN-QPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQ-------NGSINIVC-VVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTF-TDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI-NNPRFEMKRELDEYFLI-LKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            L+L N +S   T  +  +   P+I      + WY D   I         +Q +  S   G     I   R  ++G Y CE RN                P+ IR+  PV +  +S    + + T  P F       N E  S K      KY     +   N+ I     S                      D G+Y   VS++  +    T + + E P F+       ++L  S              P +I W K+   L  +   + ++++    L  +I      H G YTCQ  NE G     ++   A  L+     I   AK +  ++           D + L+          V WLKD  Q + SR   +     E +  S +I      DSG Y   ++    + +    +  +      Q+ P S   K          SI++ C V  S P   S  W     DG   + +  +A+Y+++         + + + L  +N+   D   Y  +V N AG  +    +TV         K  P F+ K  ++   P +  V  +  + G P   +KW K+  EL       I   G T  L + +   S  G Y    +N  GS+     L V +P                                                   P+FV      +IVK GD   L+C + G PE  + W  N H +  + ++ M   +D   +I + N+   DSG +   A+N +G  +CS  VIV
Sbjct: 5798 LVLRNGQS---TTFECQITGTPKIR-----VSWYLDGNEI-------TAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSK------KYTLTDRVSVFNLHITKCDPS----------------------DTGEYQCIVSNEGGSCSCSTRVALKEPPSFIKKIENTTTVLKSSATF---QSTVAGSPPISITWLKDDQILDEDDNVYISFVDSVATL--QIRSVDNGHSGRYTCQAKNESG-----VERCYAFLLVQEPAQIVEKAKSVDVTE----------KDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSF---ENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLD-----QNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPI--SAQWF---KDG---KEISTSAKYRLVC--------HERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTV---------KEPPSFLVKPGRQQAIP-DSTVEFKAILKGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEP---------------------------------------------------PKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTF-IDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIV 6440          

HSP 15 Score: 68.1662 bits (165), Expect = 2.123e-10
Identity = 149/743 (20.05%), Postives = 269/743 (36.20%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKV-------SSNEMIQFNHRSVSLK-------DVGQYLFRVSSKDVAKTH---LEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSV-GDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIF-SNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSAL 4727
            +++ WYKD   +      +I     S++    +HI N   SD G+Y C+ +N       S   + +V  ++    + K +  T  A  EP  L+  ++G +            PI V      W K        S N  I F     +L+       + G+Y+ ++ +    + +   L + E    V         +G++  +   +    ++S   + W K+   LT+++    ++ N    L   I    +   G YT QV N  G+              S   ++ VS + +  S       TG V G S  L+ +        V W  +   + S   + Q  +  ++ C+L++N    +D G Y  V      +      +  +Q  P     P+ +      ++    V+   P    +NW          R LV   R  +           +  +EL+  N+  S  GEY   V N+AG +S    + V         K    F+++L    + P  + +I+    +G     + W K+G  ++ S+   I    +T  L I N  K DAG Y  +  N  G +V    +  ++P   V   +PLE  +  ++  + + Q A       +P+ T   +  +T +R  P++ T FT+ +                                             L+   +   DSG Y+  AENS G A+   +
Sbjct: 6473 FEVVWYKDKRQLRSSKKYKIA----SKNFHTSIHILNVDTSDIGEYHCKAQNEVG----SDTCVCTVKLKEPPRFVSKLNSLTVVAG-EPAELQASIEGAQ------------PIFVQ-----WLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKAGPMTVTVGETCTLECKVAGTPELS---VEWYKDGKLLTSSQKHKFSFYNKISSL--RILSVERQDAGTYTFQVQNNVGKS-------------SCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVS-GAKYQTTF-SDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLT-VQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTPP-FKVNWF------RGARELVKGDRCNIY------FEDTVAELELF--NIDISQSGEYTCVVSNNAGQASCTTRLFV---------KEPAAFLKRLSDHSVEP-GKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSV--SLQCQVA------GTPEITVSWYKGDTKLRPTPEYRTYFTNNVAT-------------------------------------------LVFNKVNINDSGEYTCKAENSIGTASSKTV 7092          

HSP 16 Score: 67.3958 bits (163), Expect = 3.571e-10
Identity = 119/514 (23.15%), Postives = 190/514 (36.96%), Query Frame = 3
Query: 3255 KFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-----VLKETGQTQTTIVE-INPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNS-DISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNT--HFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSID 4766
            K  ++  G Y+C  +N  G        S++  LI ++   P    P    +L+   V   VG+S   +          V W KD++ + S   + QI Y E S   L +      DSG Y       V K++   Q  I E + P  F    +   +++   +  S  +   V  S P   ++ W     +  PT N               ++T     + L       +D G Y  +V N AG +     I +      +  K  P F Q L    +S   E V + C V G+    ++W+K G E+  SD         T  L +++  K+D+G Y  +ASN  GS+ +K  + + D        KP        + P  +    D     +S PQ  +++   T          TF   I K G D          P P + W+           R  + ++ DE  L +++  K DSG Y   A N  G    +  + VD   K   I+
Sbjct: 9045 KTDRSLAGQYSCTATNPIG------SASSSARLILTEGKNP----PFFDIRLAP--VDAVVGESADFECHVTGTQPIKVSWAKDSREIRSGG-KYQISYLENS-AHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFT---KRLSETVEETEGNSFKLEGRVAGSQPI--TVAWYKNNIEIQPTSNC--------------EITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVI------KEPKKPPVFDQHLTPVTVSE-GEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKD--------KP-------AVAPATKKAAVDGRLFFVSEPQSIRVVEKTT---------ATF---IAKVGGD----------PIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKIE 9481          

HSP 17 Score: 64.6994 bits (156), Expect = 2.296e-9
Identity = 80/311 (25.72%), Postives = 130/311 (41.80%), Query Frame = 3
Query: 3918 TTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIK--NCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSP------------QRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCL--IGYPEPLIWWSYNTHFINNP-RFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPL 4799
            T SD GE+ +  +N AG SS+ + +TV    EA   +  P F++KL K +      ++ ++ + +GNPNP + W+KN + +    + KIR  G   E  +K  +    D+  Y A A N  G + ++C + V      V   +P  +P    IIP   Y+      +I++P            Q  +    +   +  P F    T   +K       +C L  IG P  ++ W ++   +    R  M  E     L        DSG  +  A N  G    SA +IV   ++   ++ SQ P   K L
Sbjct: 1521 TPSDSGEWTVVAQNRAGRSSISVILTV----EAVEHQVKPMFVEKL-KNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNV-----EVEFAEP--EPERKLIIPRGTYR----AKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIV--KDEKSLVEESQLPEGRKGL 1813          

HSP 18 Score: 64.3142 bits (155), Expect = 3.028e-9
Identity = 39/134 (29.10%), Postives = 68/134 (50.75%), Query Frame = 3
Query: 3927 DGGEYCLRV--ENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG 4322
            +G +Y  RV   N+ G   V +P     + EA+ +   PK +  + ++I     +K+ +   V G P+P  KW K  +E+  S HL + K   +  L+IK+  + D+G Y   A N++G++  K  + V+D  G
Sbjct: 19792 EGKKYKFRVAARNAVG---VSLPREAEGVYEAKEQLLPPKIL--MPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPG 19920          

HSP 19 Score: 63.5438 bits (153), Expect = 6.175e-9
Identity = 37/139 (26.62%), Postives = 68/139 (48.92%), Query Frame = 3
Query: 3891 RIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV 4307
            R +L    VT ++ G Y L+  N +G ++    + V A      +   P F+Q+L    +     +V ++ +V+G P P++K+ ++G E+  S   +I + G+ + L+I      D+G Y   A+N+ G   S   L V
Sbjct:   62 RAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKA------ETAPPNFVQRLQSMTVRQ-GSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLV 193          

HSP 20 Score: 63.1586 bits (152), Expect = 7.941e-9
Identity = 44/138 (31.88%), Postives = 65/138 (47.10%), Query Frame = 3
Query: 3897 ELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVG-ETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV 4307
            +L  ++VTT D  EY +   N  G  S    +TV       +    P F ++L         + V    +VSG P P LKW K+G+ LS   +++I   G + + L I++    D G Y   A+NT GS   + HLQV
Sbjct: 32676 QLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMF-KRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 32812          

HSP 21 Score: 62.7734 bits (151), Expect = 8.421e-9
Identity = 79/381 (20.73%), Postives = 148/381 (38.85%), Query Frame = 3
Query: 3657 VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQN---KKTSPKFIQKLDK--------EIISP-------INEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRE-LDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVD 4739
            V++  I+  PV      ++  ++ G +  VC + +Y     + W          R L N+ +Y++  +    +        LY  ++T  D G Y  +V N  G  S    + V  + E  +   ++T  K  ++ D         E   P       + E V     ++ +P P + W K+G+++   D+ K            K   +SD G+Y+                     I SV T    E    +T++   +Y   +D+             +++ +R  P F     +   +EG  V  +  + G P P + W  +   ++  P  E+  E LD Y L +++    D+G Y +TA N++G  +C A + V+
Sbjct: 32487 VKVASIEIGPVSGQIMHAV-GEEGGHVKYVCKIENYDQSTQVTWYFG------VRQLENSEKYEITYEDGVAI--------LYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDK------------KYTFESDKGLYQLT-------------------INSVTTDDDAE----YTVVARNKY--GEDSCKAKLTVTLHPPPTDSTLR--PMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVE 32813          

HSP 22 Score: 62.003 bits (149), Expect = 1.761e-8
Identity = 70/283 (24.73%), Postives = 101/283 (35.69%), Query Frame = 3
Query: 3900 LYFDNVTTSD-GGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSA-LVIVD 4739
            L  D V T D  GEY     N +G ++    +TV        K+ +P   +K++   ++ +       C++   PN   +W K G E+ ESD   IR       L I   +  D G Y  +ASN  GS      L V                       TE Y P                       S P+ +TTF  +  K        C + G P    IW         +P + +    +++ L L N+   D G YS  A N  G   C A L+I+D
Sbjct: 4344 LVIDKVNTEDHQGEYVCEALNDSGKTATSAKLTVV-------KRAAPVIKRKIEPLEVA-LGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTV-----------------------TEAYPPT--------------------FLSRPKSLTTFVGKAAK------FICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIID 4569          

HSP 23 Score: 61.2326 bits (147), Expect = 3.088e-8
Identity = 158/789 (20.03%), Postives = 294/789 (37.26%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANT-EPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVS--SDVVWLKDNQPLNS----RDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEK----------------PISFTIIPTER-------YQPADDN------------SDISSPQ--RTQMIFSNTIV-----RSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYF---------LILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            + ++W+K +  ++P     I L+        ++ +   +  ++G Y C V N       S+     +F ++  T + + ++  F+  T  P+ L+    G    P S     +  +      C  +    + +++    ++  +D  QY   +   + +D+ +  + + E P F+       +++G+   +   +    ++    I W K  T L +       + N+   LV  I K   + VG+Y+C+  N  G        S+A  +I ++ L P  A+ +     +  +    V    +++   P  VS   D V LKD+  L +        +QI   ++S    + N +  N  GT  +  K         + ++  +  P     P S+      S    C V        I W+         R +     YKM       L  N   + +    V   D G+Y     N AG  S    + V         +  P+FI+KL+   I   +E     CK+ G+P   + W K+  E+ ES   ++  V     L + N    D+G Y  +A N  GS  S   L+V +P        P+E                 P   +    +R       Y+   +N            +DI   Q   T  + S+T V     ++PP+FV   +D     G +V L+  + G  P  ++W+          + E+ RE D  +         L    ++  ++G+Y+   +N +G+  C A + V
Sbjct: 7790 FKVKWFKGSRELVPGESCNISLE----DFVTELELFEVQPLESGDYSCLVTNDAG----SASCTTHLFVKEPATFVKRLAD--FSVETGSPIVLEATYTG--TPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTI--EDYAQYSCLIENEAGQDICEALVSVLEPPYFIEPLEHVEAVIGEPATLQCKVDGTPEIR---ISWYKEHTKLRSAPAYKMQFKNNVASLV--INKVDHSDVGEYSCKADNSVG-----AVASSAVLVIKARKLPPFFARKLKDVHETLGF---PVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIG-QYNCSASNPLGTASSSAK---------LILSEHEVPPFFDLKPVSVDLALGESGTFKCHVTGTAPIK-ITWA------KDNREIRPGGNYKMT------LVENTATLTVL--KVGKGDAGQYTCYASNIAGKDSCSAQLGV---------QEPPRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWF--------KDKGEIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSV 8509          

HSP 24 Score: 59.3066 bits (142), Expect = 9.575e-8
Identity = 54/247 (21.86%), Postives = 105/247 (42.51%), Query Frame = 3
Query: 4029 TSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVR---------SPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYN-THFINNPRFEMK--RELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVI 4733
            T P  +  L K +     E V + C +SG P+P + W +   ++  S   +I        L+I+     D+G +   A N  G+  + C+L       +V  ++  EK    T   TE++   ++   + S     ++ ++T +          + P F+T    + + EG  VV  C + G P+P ++W  +        R+++   ++  E  L++      D+G Y+I   N  G  + SA ++
Sbjct:  941 TPPTLVSGL-KNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYL-------AVQVSEEFEKE---TTAVTEKFT-TEEKRFVES---RDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLL 1172          

HSP 25 Score: 59.3066 bits (142), Expect = 1.068e-7
Identity = 59/251 (23.51%), Postives = 99/251 (39.44%), Query Frame = 3
Query: 4011 EAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWW---------SYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +++ + T P FI+++    IS + +   +   V G P P ++W  NG  L+ S   K    G+ H L+I   K  D G Y   ASN  G  +   +L+ I+  G  +     E  ++ ++              +  P              PP F+         +G   + +  ++G P P + W         S     I+NP             I+ + Q+ DSG Y   AEN  G +TC+A ++V
Sbjct: 3495 DSEKEGTGPIFIKEVSNADIS-MGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLK-INSKGEGHKDTETESAVAKSL------------EKLGGP-------------CPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPN-------GSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLV 3711          

HSP 26 Score: 58.151 bits (139), Expect = 2.348e-7
Identity = 57/254 (22.44%), Postives = 104/254 (40.94%), Query Frame = 3
Query: 4065 IISPINEKVI-------VRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE-----KPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVR----------SPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNH 4757
            II+P+ + V         +C+VSG  +  + W    +++  S   ++ +  +T++L I      D G Y   ASN  G   S  +L +  P   ++     E     K  S + +  E          +S    T  + S + V           + P F+   ++  +  GD   L   +IG P+P I W +N   +  +  ++   + D++ LI+   +  D G Y+  A N  G   CSA + ++S  + H
Sbjct: 3347 IITPLQDTVTSEGQPARFQCRVSGT-DLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSKINETLELLSESPVYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGH 3599          

HSP 27 Score: 57.7658 bits (138), Expect = 3.045e-7
Identity = 53/243 (21.81%), Postives = 96/243 (39.51%), Query Frame = 3
Query: 4032 SPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESD--HLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNK 4751
            +P F Q L + ++            +SG P P + W ++G+ +S S    ++I       +L I    K+++G Y  +A+N +G   S   L                                             ++ + T   +PP FV       V++G  V L+  + G P P++ ++       ++  F++ +E D Y L++      DSG YS+ A NS G AT +A ++V    +
Sbjct:    5 APTFTQPL-QSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAEL---------------------------------------------LVKAET---APPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEE 198          

HSP 28 Score: 57.7658 bits (138), Expect = 3.229e-7
Identity = 65/285 (22.81%), Postives = 109/285 (38.25%), Query Frame = 3
Query: 3927 DGGEYCLRV--ENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKE------GDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEY-FLILKNIQ-KGDSGRYSITAENSSGLATCSALVIVDSHNK 4751
            +  EY  RV  EN  G S    P   A   + +        I+K  K++ + + E   + C++ G P P +KW + G+EL +S   K+   G TH L +   ++ D G+Y   A+N                +G V T+                                    S  ++++ PQF   +    +KE      G  + L    IG P P + W +    + N         + Y  L++KN+Q K  +G+Y +   N  G  T  A++ V+  +K
Sbjct: 31424 EATEYEFRVFAENETGLSR---PRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNE---------------VGEVETS------------------------------------SKLLLQATPQFHPGYP---LKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFG--TVDAILDVEIQDK 31649          

HSP 29 Score: 55.0694 bits (131), Expect = 2.276e-6
Identity = 46/148 (31.08%), Postives = 61/148 (41.22%), Query Frame = 3
Query: 3930 GGEYCLRV--EN--SAGWSSVMIPITVAALAEAQNKKTSP------KFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVID----PIGSVN 4331
            G  Y  RV  EN    G     IPI      E Q K   P      K I+ L  +  + +    I+R    G P P  KW  +G E+   +H  +     +  L IKNC + D G Y+   SN  GS+    HL V+D    P G +N
Sbjct: 18402 GKTYRFRVKAENIVGLGLPDTTIPI------ECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIR----GVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPIN 18539          

HSP 30 Score: 54.6842 bits (130), Expect = 2.714e-6
Identity = 66/243 (27.16%), Postives = 105/243 (43.21%), Query Frame = 3
Query: 3894 IELYFDNVTTSDGGEYCLRV--ENSAGW----SSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTER----YQP--ADDNSDISS---PQRTQMIFSNTIVRSPPQFVTTFTDEIVK--EGDDVVLKCCLI---GYPEPL 4562
            IE  F     ++   Y  RV  +N+AG     S    PIT     E       PKF       I+    E   +   V G P P ++W++  +E+ ES   +I+       L++K+  + D G Y  +ASN  GS+    +++V+D  G      P E P+  T + +E+    + P   D  SDIS     +R     + T+V S    V T + ++ K  EG++ V +   +   G  EPL
Sbjct: 24503 IETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKF----RDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPG------PPEGPVQVTGVTSEKCSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASE---VVTNSLKVTKLLEGNEYVFRIMAVNKYGVGEPL 24732          

HSP 31 Score: 53.9138 bits (128), Expect = 3.991e-6
Identity = 50/206 (24.27%), Postives = 89/206 (43.20%), Query Frame = 3
Query: 4131 LKWMKNGEELSESDHLKIRKVGE-THELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDS 4742
            + W K+G++L E+ H +     + T+EL I N  +SD G Y  + S   G+  SK +LQ +         K + + +S  I  T++   +D  +  S+  R     +   + S P  VT   D  V             G P P   W+ +   I    ++++  +   +FL +      DSG Y+ T +NS+G  + S  + + +
Sbjct: 33676 VTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGT--SKTNLQFMG-----QAFKSIHEKVS-KISETKK---SDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKA 33870          

HSP 32 Score: 53.1434 bits (126), Expect = 7.360e-6
Identity = 95/475 (20.00%), Postives = 182/475 (38.32%), Query Frame = 3
Query: 3438 GDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK-ETGQTQTTI---VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVA---ALAEAQNKKTSPKFIQKLDKEIISPINEKVIVR----------------------------------------CKVS--GNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTK-PLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGL 4709
            G + + D++       +  W  D Q + + D   ++   E+   SL I  AT +DSG +  V +   G++  ++   VE    Q  P+  +  +++  K+   + +       P+   I W +K +D      ++   +Y  I     ++ G      L  D+  + D   Y     N AG  +    + V    A  E + K   P+   +  KEI +P  E + +R                                        C+++  G+P  +++W+ +G+ L  ++ L++        L        D+GI   +A+N  G++ +   L V D    V  ++ P  +     I   ER       + +++ Q+          +  P  V       V EG+    +C + GYP+P + W  N   I  + RF ++ +   Y  I+ + +  D+G   +TAEN  G+
Sbjct: 1471 GQTARFDLKVVGRPMPETFWFHDGQQIVN-DYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPN-PDIVW-LKNSD------IIVPHKYPKI-----RIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRA-KEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKE---------KQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIV-DCKSYDTGEVKVTAENPEGV 1920          

HSP 33 Score: 53.1434 bits (126), Expect = 8.207e-6
Identity = 57/249 (22.89%), Postives = 102/249 (40.96%), Query Frame = 3
Query: 4089 VIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETH-ELVIKNCKKSDAGIYEAQASNTNGSEV--SKCHLQVIDPIGS---VNTTKPLEK-----PISFTIIPTE----RYQPADDNSDISSPQRT--------------QMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFE--MKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDS 4742
            V   CK+SG P P + W K+G+ +   +  ++  + +    L I      D GIY A ASN  G+ +   K +++   P+G+   + T +P+ +     P S +  P      R  PA  +    SP R               + ++    V  P  F          EG        ++G P P  +W ++   I N      + +E     LI+      DSG +++ A+N +G ++ S ++ V++
Sbjct: 1308 VTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCL-------EGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEA 1549          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 116.701 bits (291), Expect = 4.759e-25
Identity = 175/774 (22.61%), Postives = 305/774 (39.41%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSS-CPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTY--INDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE----KPISFT-------------------IIPTERYQPADDNS---------DISSPQRTQMIFSNTI----------VRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYN-THFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            I W KDN  I P  + ++ L  N+ +    + +    + DAGQY C   N     + S    L V  Q+    I K          E    +  + G   +PE  +++      +  SS    S V S  +++ ++  +S++D G Y       +    + T L++ E P F        +L G  + +   ++      P  + W K+K  L     S K Y  +++N      I     A +G+Y C+ +N+ G D            + S   I + A P    +LSD  ++  VG  ++L           VVW KD   +      I I Y  E+  +L+ +     ++G Y   +K     Q     ++ ++ A +++  P+SI+     +  + C V   P   S  W     DG   + L ++ +YK+     NK++G      L   NV  SD G Y   V+N  G  S    + V+      ++   P F +KL KE        V++ CKV G+P   + W   G E+S     +      T  L +   ++SD+G Y   A+N  GS+     L V +P   V    P++      ++FT                   ++P +R   + ++S         D S       I SN            +++P +FV    D  +++G  ++L+    G P   + W  N  +   + R  +        L + +    D+G+Y+   EN+SG  +CSA +++
Sbjct: 8487 ITWAKDNREIRPGGNYKMTLVENTAT----LTVLKVGKGDAGQYTCYASNIAG--KDSCSAQLGV--QEPPRFIKKLEPSRIVKQDEFTRYECKIGG---SPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHN--LSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGADVHLECELQG---TPPFHVSWYKDKRELR----SGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSD----------TCVGS---IALKAPPRFVKKLSD--ISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISY-SENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEK-PESIKVTTGDTCTLECTVAGTPEL-STKWF---KDG---KELTSDNKYKISF--FNKVSG------LKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVS------DRTVPPSFTRKL-KETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQKPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILI 9201          

HSP 2 Score: 87.4261 bits (215), Expect = 2.865e-16
Identity = 119/543 (21.92%), Postives = 203/543 (37.38%), Query Frame = 3
Query: 3243 FEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRN--LVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE------KPISFTIIPTERYQPA--DDNSDISSPQRTQM----------IFS------------------------NTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
             EI +      G+YTC+ SNE+G       L+  EA   +    P S             +T  VG + K           + +W KD   L S  P  +I    E+K  L+++  T+ D G Y               E+  I     I++  + +++  N  +++ C V+      ++ WS       P ++  +    +   +  PL KL                 D G Y     N AG SS    +TV         +  P F++K+D   +    E   + CK+ G+P   + W KN +ELSES+ +++  V     L I + K  D+G Y  +A N  GS+     + + +P   + T +P +        +   +  T  ++ +   D   I S ++ ++          IFS                          +++ PP FV    D I   G  V L+  + G  P  + W         + + +M        LI+ ++Q    G+Y+  AEN +G  T    +IV
Sbjct: 4757 LEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKS-------------LTTFVGKAAKFICTVTGTPVIETIWQKDGAAL-SPSPNWRIS-DAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIKEL-EPVQSAINKKVHLECQVDEDRKV-TVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKL----------------KDSGTYVCTASNEAGSSSCSATVTV---------REPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEPADIVRGTNALLQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIV 5257          

HSP 3 Score: 85.8853 bits (211), Expect = 1.025e-15
Identity = 157/740 (21.22%), Postives = 272/740 (36.76%), Query Frame = 3
Query: 2538 RIDKDQ-YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVS---SKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTY--INDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            ++D+D+   + W KD + + P  D +I  +    +    + I   +  D+G Y C   N       SS    +V  ++  + + K          E   L   L G   +P   + +      ++ S+       ++E I  +   V ++D G Y          D   T + I E P F+      + + G +  +   +       P  I W K+K  +     S K Y   +    +  EI  F  A VG+Y C V+NE G    K    A   L    T +          ++ D    G  G ++ L           V W+K  Q +   D +I++ +       L I    ++  G Y  + +    +QT++ E+   + A +I+   + I+        +   V   P        +KP      R LV + +Y++          N+ +++ Y  +    D G+Y   + N  G SS     TV       ++  +P F + L + + S +N    + CK++G+    + W K+G+E++ SD  +I  V  T  L I     +DAG +  +A+N+ GS+ S   L V +P                                                   P FVT    + V  G  V LK    G  P  + W+  N   ++     + +E  E  L L  ++  DSG Y+    N +G   CSA + V
Sbjct: 4910 QVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIAT----LEIPLAKLKDSGTYVCTASNEAG----SSSCSATVTVREPPSFVKKVDPSYLMLPGESARLHCKLKG---SPVIQVTWFKNNKELSESNTVRMYFVNSEAI-LDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEPADIVRGTNALLQCEVSG---TGPFEISWFKDKKQIR----SSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVG----KCGCMATHLLKEPPTFV---------KKVDDLIALG--GQTVTLQAAVRGSEPISVTWMK-GQEVIREDGKIKMSF-SNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKIIERA-ELIQVTAGDPATLEYTVAGTPE-------LKPKWYKDGRPLVASKKYRI------SFKNNVAQLKFY--SAELHDSGQYTFEISNEVGSSSCETTFTVL------DRDIAPFFTKPL-RNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEP---------------------------------------------------PSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFV 5539          

HSP 4 Score: 85.8853 bits (211), Expect = 1.034e-15
Identity = 163/719 (22.67%), Postives = 256/719 (35.61%), Query Frame = 3
Query: 2631 SQSGKMKMHIDNCRESDAGQYWCEVR---NGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAK---PISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKE---TGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWS-----IKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALV 4730
            SQSG+    + N    +AGQ  C  R     P+   K     LS  S + G  I    E T+   T P+S+    DGF        I  +   N+         V++ +       + + +D GQY   +   + +DV    +   E P FV       + +GDS+++   +    ++   T+ W K  T L         + N+   LVF   K      G+YTC+  N  G               SS+T+  +  +   P  + QL D  +  +VG  + L           V W +D   L   D  +Q  +  ++  +LKI    ++ SG Y         T  +   +    P + +P     P SI      S +  C V  + P    I WS     I+P  G+ T   V N  +  I K                  V   D G+Y  +  N  G       ++V         K  PKF++KL+   ++   E + + CK+SG+P   + W +N  EL ES    +  +     L I      D+G Y  +A N  G       L V  P   V T KP   P+                                                  +G DV+L+C + G P   ++W        N+ +F++  +  +  L + N++  D G Y   A N  G  TCS  V
Sbjct: 7202 SQSGEYTCVVSN----NAGQASCTTRLFVKEPAAFLKR----LSDHSVEPGKSI--ILESTYTG-TLPISVTWKKDGFN-------ITTSEKCNI---------VTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSVSLQCQVAGTPEI---TVSWYKGDTKLRPTPEYRTYFTNNVATLVFN--KVNINDSGEYTCKAENSIG-------------TASSKTVFRIQERQLPPSFARQLKD--IEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRD-DENLQTSF-VDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREP-KKSPFFDIKPVSIDVIAGESADFECHVTGAQP--MRITWSKDNKEIRPG-GNYTITCVGNTPHLRILK------------------VGKGDSGQYTCQATNDVGKDMCSAQLSV---------KEPPKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAP--PVFTQKP--SPVG-----------------------------------------------ALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSV 7789          

HSP 5 Score: 82.8037 bits (203), Expect = 7.734e-15
Identity = 153/744 (20.56%), Postives = 265/744 (35.62%), Query Frame = 3
Query: 2679 DAGQYWCEVRNGPS-------VIRKSSPVLLSVFSQKQGTVIPKFSEKTFA--ANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN-SRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQF--APVIQDFPQSIRAKQNGSINIVCVV-NSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPL-----EKPISF----TIIPTERYQPADDNSDISSPQRTQMIFSNTI----------------------------------VRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALV 4730
            D+G+Y CE +N          VI K SP     F  K   V+ ++     A  A T P  +    D                  +  S   +     + ++          D G+Y  RV+++    +    + + E P F+      +SL G + A    +K      P T+ W K+   +T +     T+ N+   L          H G Y CQ  N+ G       +    AL+S +    ++ + +S        +  + GD   L V+F         W KD Q L      +I +    ++   LKI      DSG Y   ++      +    IN +     P      + + + +   I++ C+V  S+P   SI W          + +  + +YK           N   +E+    +  +D G Y     N AG +     +TV         K  P F++K   + ++P N +V ++  V G     +KW K+ +EL       + K   +  L +   K +D+G Y  Q SN  G+  SK  L V +P   +    P+      +  +F    T  P  R     D ++I++ Q+  + F + +                                  V+ PP F+       V +  DV L+C + G P   + W   N    ++ ++ +   +  + L +      D+G Y     N  G  +CS  V
Sbjct: 5610 DSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEF--KPIEVLKEYDVMLLAEVAGTPPFEITWFKDN----------------TILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFIKKIESTSSLRGGTAAFQATLKG---SLPITVTWLKDSDEITEDDNIRMTFENNVASLYLS--GIEVKHDGKYVCQAKNDAG-------IQRCSALLSVKEPATITEEAVS--------IDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISV---TDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPI--SIQWF------KDDQEISASEKYKF------SFHDNTAFLEI--SQLEGTDSGTYTCSATNKAGHNQCSGHLTV---------KEPPYFVEKPQSQDVNP-NTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRV 6286          

HSP 6 Score: 82.0333 bits (201), Expect = 1.475e-14
Identity = 160/755 (21.19%), Postives = 289/755 (38.28%), Query Frame = 3
Query: 2652 MHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLS---VFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNH-RSVSLKDVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHK-TYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKET-GQTQTTIV-----EINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG--------SVNTTKPL--------EKPISFTIIPTERYQPADDNSDISSPQRTQM--IFSNTI------------------------VRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSH 4745
            + I+     D+G Y CE  NG      S+ + +    VF+QK   V         A     + L+  + G    P  ++++      V +S     K++S       H  ++   DVG+Y  + +++   D     ++  E P FV      ++L+GD++ +   ++ F    P +++W K++  +     + + ++I++   L    P+ + +  G Y CQ+ N+ G      + SA   ++    +I    KP          +T + G+   L+            W KD + L S D +  I +  +   SLKI  A ++D G Y   +K + G++  T+       I P  F   ++D    + A    S+ + C V+      S+ W     DG+           ++++ P  + + +     L    +  SD G Y     N AG       +TV         +  P F Q  D   + P    +     + G P   +KW K   EL   +   I       EL +   +  ++G Y    +N  GS     HL V +P          SV T  P+          PIS + I  E      +   I+  +++ +  I  +TI                        V  PP F+          G+   L+C + G PE  I W+  +T   + P ++M+ + +   L++  +   D G YS  A+NS G    SA++++ + 
Sbjct: 7666 LTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSPV--------GALKGSDVILQCEISG---TPPFEVVWVKDRKQVRNSKK--FKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSDTSTLIGDAVELRAIVEGFQ---PISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNS--GKYICQIKNDAG----MRECSAVLTVLEPARII---EKP--------EPMTVTTGNPFALECVVTGTPELSAKWFKDGREL-SADSKHHITFINKV-ASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKD----VNAILGASVVLECRVSGSAPI-SVGWF---QDGN-----------EIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTV---------QEPPSFEQTPDSVEVLP-GMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKAR 8356          

HSP 7 Score: 79.7221 bits (195), Expect = 6.900e-14
Identity = 161/786 (20.48%), Postives = 290/786 (36.90%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKT---FAANTEPLSLKLVLDG-----FKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHV---GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSI---NIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVI-----------DPI-----------GSVNTTKPLE----------------------KPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            ++I W+KD + I      R+     SQ   + + I +   +D G+Y C V N    + K   +   +  +      P F +K     A   + ++L+  + G       +    ++I  +  I ++ S+     +  +  I F  +   L +          + + K   +I E+ E +          GD   +   +    ++ PK   W K+  PL  +K    ++ N+  +L     KF  A +   G YT ++SNE G    +   +     +  + + P   KP+ +    D+ V G+     +LD +    +   V W KD + + + D R +I +  E   SL+I    +ND+G +           T  V       A ++Q+ P  +    +  +   + VC+ +++    S   +I+   G+  + LV+     +  + L         +ELY   V TSD G Y  +V N AG       + V         K    F++KL+   +    +   + CKV+G P   + W  N  E+ ES   ++  V  T  L + +    D+G Y  +A N  GS+   C   VI            PI             V  T P E                        +S  I+        +    +++   + +  +   +R PP F+          G     +  L G  P  + W   +     +    M  E +   L L  I+    G+Y   A+N +G+  CSAL+ V
Sbjct: 5104 FEISWFKDKKQIRSSKKYRLF----SQKSLVCLEIFSFNSADVGEYECVVANE---VGKCGCMATHLLKEP-----PTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKIIERAELI------QVTAGDPATLEYTVAGTPELKPK---WYKDGRPLVASKKYRISFKNNVAQL-----KFYSAELHDSGQYTFEISNEVGSSSCETTFT-----VLDRDIAPFFTKPLRNV---DSVVNGTC----RLDCKIAGSLPMRVSWFKDGKEIAASD-RYRIAF-VEGTASLEIIRVDMNDAGNFTC-------RATNSVGSKDSSGALIVQEPPSFVTKPGSKDVLPGSAVCLKSTFQG--STPLTIRWFKGN--KELVSGGSCYITKEALE------SSLELYL--VKTSDSGTYTCKVSNVAGGVECSANLFV---------KEPATFVEKLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSD--HCSSIVIVKESPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSV 5819          

HSP 8 Score: 79.7221 bits (195), Expect = 7.196e-14
Identity = 151/746 (20.24%), Postives = 270/746 (36.19%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNG-------PSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDR 4769
            + + WYKD   +      +I+    S++    +HI N   +D G+Y C+  N         S+  K+ P  +   S     V  +   +T     EP+S+    D  +   ESD I+ +   N+  ++  +S+V      ++  +  +   + +    +S  + A     I EKPE +          GD+  +   +    ++S K   W K+   LT++     ++ N    L  +I     +  G Y+ +V N  G+D     L      +S +T+ P   + +  +        G  G S+ ++ +        V W  +   ++S   R       ++ C+L +N    +DSG Y  +      +      +  ++  P     P  +      ++    +V   P   S++W      GS    LV   R  +       L  ++  +EL+  +V TS  GEY   V N AG +S    + + A A         KF+++L+   I    + +I+    +G P   + W KNG  ++ S    I    ++  L I +    DAG Y     N +G +     + +++P                                                   P FV       V  GD   L+C L G PE  + W+  +T       ++M    +   L+   +   DSG Y   AENS G  + S  + V       S  R
Sbjct: 8672 FHVSWYKDKRELRSGKKYKIM----SENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENI--ATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPAT----IVEKPESI------KVTTGDTCTLECTVAGTPELSTK---WFKDGKELTSDNKYKISFFNKVSGL--KIINVAPSDSGVYSFEVQNPVGKDSCTASLQ-----VSDRTVPPSFTRKLKETN-------GLSGSSVVMECKVYGSPPISVSWFHEGNEISSG--RKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLT-VREPPSFVQKPDPMDVLTGTNVTFTSIVKGTPP-FSVSW----FKGS--SELVPGDRCNV------SLEDSVAELELF--DVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPA---------KFVKRLNDYSIEK-GKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEP---------------------------------------------------PYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSR 9305          

HSP 9 Score: 76.2554 bits (186), Expect = 7.219e-13
Identity = 120/547 (21.94%), Postives = 199/547 (36.38%), Query Frame = 3
Query: 3276 GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPR-FEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLPPETYSNLVKTHINDESRVMQASPRGWQEFQFHSNAST 4913
            G Y CQ+SN+ G    K  L   E         P   K  S   +  N      G S   + +        V W  D   + +       +   +   + +I+GA V +SGTY    +    T +  +E+   +    I++  + +   +   + + C V   P    + W            L NN   +   K    LT  +    L+      SD GEY   V N  G  S     T  AL E       P FI+K++    + +      +  V+G+P   + W+K+ + L E D++ I  V     L I++     +G Y  QA N +G  V +C+                    +F ++                             + P Q V       V E D + L+C + G PE  + W  +   I   R F M  E +     ++++ K DSG+Y+   EN  G ++C A + V        +D++  PS +K L       ++ + I+ E +V  + P   Q F+     ST
Sbjct: 6080 GTYICQLSNDVGTATSKATLFVKEP--------PQFIKKPSPVLVLRN------GQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFI--DGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIREL-KPVEVVKYSDVELECEVTGTPP-FEVTW------------LKNNREIRSSKK--YTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCS---TRVALKEP------PSFIKKIEN-TTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESG--VERCY--------------------AFLLV-----------------------------QEPAQIVEKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRV--------LDQNIPPSFTKKL--TKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEIST 6523          

HSP 10 Score: 73.9442 bits (180), Expect = 3.734e-12
Identity = 113/548 (20.62%), Postives = 189/548 (34.49%), Query Frame = 3
Query: 3261 TQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKC---------SLKINGATVNDSGTYQA-VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNL-VNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTE--------RYQPA------DDNSDISSPQRTQMIFSNT----------------------------------IVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSA 4724
            T+ H G+Y C+  N+ G+     +L+  +            A P+   ++    V  ++G   K   E  +  +    W K  +         +IY  E  KC         SL+I    V D G Y      E G    T        + P     P+S+      +   +C V   P   +I W    A  SP+ N  +++A  K I               L   N+T  D G Y  +  N  G       + +            P FI++L+  + S IN+KV + C+V  +    + W K+G++L      KI    +   L I   K  D+G Y   ASN  GS      + V +P   V    P     S+ ++P E        +  P        +N ++S     +M F N+                                  +++ PP F+ T     +  G + +L+C + G  P  + W+       ++ ++ +  +     L + +    D G Y     N  G   C A
Sbjct: 4668 TEDHQGEYVCEALNDSGKTATSAKLTVVK-----------RAAPVIKRKIEPLEV--ALGHLAKFTCEIQSAPNVRFQWFKAGR---------EIY--ESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKSLTTFVGKAAKFICTVTGTPVIETI-WQKDGAALSPSPNWRISDAENKHI---------------LELSNLTIQDRGVYSCKASNKFGADICQAELIII---------DKPHFIKELEP-VQSAINKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVREPPSFVKKVDP-----SYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEPADIVRGTNALLQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMA 5160          

HSP 11 Score: 72.7886 bits (177), Expect = 8.008e-12
Identity = 154/731 (21.07%), Postives = 261/731 (35.70%), Query Frame = 3
Query: 2652 MHIDNCRESDAGQYWCEVRN-------GPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKY--APESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVS---SKDVAKTHLEIGEK---PEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN----------SRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-----VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPIN----EKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYF-LILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            + I N  + DAGQY CE+ N       G  V     P  ++     +  V    S +   A T  +++       K    PE    F N   NV               + FN   V++ D G+Y  +         +KT   I E+   P F          +G  + ++      +  +P  + W ++   L  ++    +++++   L  +I +   +H G Y+C  SN  G      +L+A E   S    I    KP+S   ++        G+S   +          + W KDN+ +              P ++I         LK+      DSG Y       V K+    Q ++ E  P +F   ++    S  AKQ  SI + C ++  P    ++W    ++      L  + +Y M    +N +        L  +  +  D G+Y     N  G +S    +TV         K  P F QK      SP+       VI++C++SG P   + W+K+ +++  S   KI        L I N + SD G Y  +A+N  GS+   C ++  +P                                                   P+FV   +D     GD V L+  + G+ P  ++W       I          +D    L L + +  +SG+Y    +N +G+  CSA++ V
Sbjct: 7287 LEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTN---NVA-------------TLVFNK--VNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTC---RLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATL--KILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDI----KPVSIDVIA--------GESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRI---------LKVGKG---DSGQYTCQATNDVGKDMCSAQLSVKE--PPKF---VKKLEASKVAKQGESIQLECKISGSPEIK-VSWFRNDSE------LHESWKYNMSF--INSVA------LLTINEASAEDSGDYICEAHNGVGDASCSTALTV---------KAPPVFTQKP-----SPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEP---------------------------------------------------PRFVKKLSDTSTLIGDAVELRAIVEGFQPISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTV 7885          

HSP 12 Score: 70.4774 bits (171), Expect = 4.898e-11
Identity = 82/325 (25.23%), Postives = 135/325 (41.54%), Query Frame = 3
Query: 3768 SCHSINWSIKPADG-SPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRV--ENSAG---WSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRK---VGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI-NNPRFEMKRELDEYFLILKN-IQKGDSGRYSITAENSSGL 4709
            SC  + W    +DG +  RN     R K  NK ++  T  ++       N+   +G EY  RV  EN  G   WS +  PIT  +    Q    +P F ++L    +   +   +V CKV+G+P PI+KW + G+E+  +D LK R     G  H+L+I +    DA +Y+ +A+N  GS      L+V  P                              + I  P+  + + +   +R                G+ V +K    G P+P+I W      I NN  +++        L+  N +++ D+G Y + A+N  G+
Sbjct: 33408 SC-VVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLI--EGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQ----APHFKEELRNLNVRYQSNATLV-CKVTGHPKPIVKWYRQGKEII-ADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVP------------------------------AKIHLPKTLEGMGAVHALR----------------GEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGI 33677          

HSP 13 Score: 68.9366 bits (167), Expect = 1.181e-10
Identity = 147/742 (19.81%), Postives = 263/742 (35.44%), Query Frame = 3
Query: 2565 QWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPS-------VIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQF-NHRSVSLKDVGQYLFRVS---SKDVAKTHLEIGEKPEFVYHQFKENSLL--GDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESK---CSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLN-KLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            QW+KD + I      R++  C+ +S  + + ++N    D   Y C+V N          +  K  P  L    ++Q         K     T P  +K   D                 +V   S P   +       F N  SV     GQY   V+     D   T L + E P+FV  + + + ++  GDS  +   +    ++    ++W +N+  L  +     T+I+     V ++   +    GD+ C+  N  G      ++   E  + S    P   + + ++++S             L+ E       +VVW KD + L S        Y   SK    S+ I     +D G Y    +    + T +  +        +++ P+ +       +N + VV   P+   +  SI+ A     + L    + ++I +  N ++T       L F     ++ G+Y  +++N  G    M  + V            P  I +    +   + E   + CKV+G P   ++W K+G+ L+ S   K     +   L I + ++ DAG Y  Q  N  G   S C   V                               D SD +                PP F     +     G   +L+C + G  P  + W+   T  ++  +++     +   L L ++   D G Y+  A N +G   C A++ V
Sbjct: 6513 QWFKDGKEISTSAKYRLV--CHERS--VSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPSFLVKPGRQQAIPDSTVEFKAILKGTPPFKIKWFKD-----------------DVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFV-KKLEASKIVKAGDSSRLECKIAGSPEIR---VVWFRNEHELPASDKYRMTFIDSVA--VIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSS--FPPIVETLKNAEVS-------------LECELSGTPPFEVVWYKDKRQLRSSK-----KYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVK-------LKEPPRFV-----SKLNSLTVVAGEPA--ELQASIEGAQPIFVQWL--KEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVL----------EPAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGK--SSCTAVV-------------------------------DVSDRA---------------VPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTV 7133          

HSP 14 Score: 68.1662 bits (165), Expect = 2.409e-10
Identity = 172/792 (21.72%), Postives = 274/792 (34.60%), Query Frame = 3
Query: 2472 LLLVNAESSCPTRLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRILLQCNSQS---GKMKMHIDNCRESDAGQYWCEVRNG---------------PSVIRKSSPVLLSVFS----QKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVA---KTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDN-QPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQ-------NGSINIVC-VVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTF-TDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI-NNPRFEMKRELDEYFLI-LKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            L+L N +S   T  +  +   P+I      + WY D   I         +Q +  S   G     I   R  ++G Y CE RN                P+ IR+  PV +  +S    + + T  P F       N E  S K      KY     +   N+ I     S                      D G+Y   VS++  +    T + + E P F+       ++L  S              P +I W K+   L  +   + ++++    L  +I      H G YTCQ  NE G     ++   A  L+     I   AK +  ++           D + L+          V WLKD  Q + SR   +     E +  S +I      DSG Y   ++    + +    +  +      Q+ P S   K          SI++ C V  S P   S  W     DG   + +  +A+Y+++         + + + L  +N+   D   Y  +V N AG  +    +TV         K  P F+ K  ++   P +  V  +  + G P   +KW K+  EL       I   G T  L + +   S  G Y    +N  GS+     L V +P                                                   P+FV      +IVK GD   L+C + G PE  + W  N H +  + ++ M   +D   +I + N+   DSG +   A+N +G  +CS  VIV
Sbjct: 6115 LVLRNGQS---TTFECQITGTPKIR-----VSWYLDGNEI-------TAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSK------KYTLTDRVSVFNLHITKCDPS----------------------DTGEYQCIVSNEGGSCSCSTRVALKEPPSFIKKIENTTTVLKSSATF---QSTVAGSPPISITWLKDDQILDEDDNVYISFVDSVATL--QIRSVDNGHSGRYTCQAKNESG-----VERCYAFLLVQEPAQIVEKAKSVDVTE----------KDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSF---ENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLD-----QNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPI--SAQWF---KDG---KEISTSAKYRLVC--------HERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTV---------KEPPSFLVKPGRQQAIP-DSTVEFKAILKGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEP---------------------------------------------------PKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTF-IDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIV 6757          

HSP 15 Score: 67.781 bits (164), Expect = 3.203e-10
Identity = 149/743 (20.05%), Postives = 269/743 (36.20%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKV-------SSNEMIQFNHRSVSLK-------DVGQYLFRVSSKDVAKTH---LEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSV-GDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIF-SNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSAL 4727
            +++ WYKD   +      +I     S++    +HI N   SD G+Y C+ +N       S   + +V  ++    + K +  T  A  EP  L+  ++G +            PI V      W K        S N  I F     +L+       + G+Y+ ++ +    + +   L + E    V         +G++  +   +    ++S   + W K+   LT+++    ++ N    L   I    +   G YT QV N  G+              S   ++ VS + +  S       TG V G S  L+ +        V W  +   + S   + Q  +  ++ C+L++N    +D G Y  V      +      +  +Q  P     P+ +      ++    V+   P    +NW          R LV   R  +           +  +EL+  N+  S  GEY   V N+AG +S    + V         K    F+++L    + P  + +I+    +G     + W K+G  ++ S+   I    +T  L I N  K DAG Y  +  N  G +V    +  ++P   V   +PLE  +  ++  + + Q A       +P+ T   +  +T +R  P++ T FT+ +                                             L+   +   DSG Y+  AENS G A+   +
Sbjct: 6790 FEVVWYKDKRQLRSSKKYKIA----SKNFHTSIHILNVDTSDIGEYHCKAQNEVG----SDTCVCTVKLKEPPRFVSKLNSLTVVAG-EPAELQASIEGAQ------------PIFVQ-----WLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKAGPMTVTVGETCTLECKVAGTPELS---VEWYKDGKLLTSSQKHKFSFYNKISSL--RILSVERQDAGTYTFQVQNNVGKS-------------SCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVS-GAKYQTTF-SDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLT-VQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTPP-FKVNWF------RGARELVKGDRCNIY------FEDTVAELELF--NIDISQSGEYTCVVSNNAGQASCTTRLFV---------KEPAAFLKRLSDHSVEP-GKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSV--SLQCQVA------GTPEITVSWYKGDTKLRPTPEYRTYFTNNVAT-------------------------------------------LVFNKVNINDSGEYTCKAENSIGTASSKTV 7409          

HSP 16 Score: 67.3958 bits (163), Expect = 4.085e-10
Identity = 119/514 (23.15%), Postives = 190/514 (36.96%), Query Frame = 3
Query: 3255 KFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-----VLKETGQTQTTIVE-INPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNS-DISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNT--HFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSID 4766
            K  ++  G Y+C  +N  G        S++  LI ++   P    P    +L+   V   VG+S   +          V W KD++ + S   + QI Y E S   L +      DSG Y       V K++   Q  I E + P  F    +   +++   +  S  +   V  S P   ++ W     +  PT N               ++T     + L       +D G Y  +V N AG +     I +      +  K  P F Q L    +S   E V + C V G+    ++W+K G E+  SD         T  L +++  K+D+G Y  +ASN  GS+ +K  + + D        KP        + P  +    D     +S PQ  +++   T          TF   I K G D          P P + W+           R  + ++ DE  L +++  K DSG Y   A N  G    +  + VD   K   I+
Sbjct: 9362 KTDRSLAGQYSCTATNPIG------SASSSARLILTEGKNP----PFFDIRLAP--VDAVVGESADFECHVTGTQPIKVSWAKDSREIRSGG-KYQISYLENS-AHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFT---KRLSETVEETEGNSFKLEGRVAGSQPI--TVAWYKNNIEIQPTSNC--------------EITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVI------KEPKKPPVFDQHLTPVTVSE-GEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKD--------KP-------AVAPATKKAAVDGRLFFVSEPQSIRVVEKTT---------ATF---IAKVGGD----------PIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKIE 9798          

HSP 17 Score: 64.6994 bits (156), Expect = 2.786e-9
Identity = 80/311 (25.72%), Postives = 130/311 (41.80%), Query Frame = 3
Query: 3918 TTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIK--NCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSP------------QRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCL--IGYPEPLIWWSYNTHFINNP-RFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPL 4799
            T SD GE+ +  +N AG SS+ + +TV    EA   +  P F++KL K +      ++ ++ + +GNPNP + W+KN + +    + KIR  G   E  +K  +    D+  Y A A N  G + ++C + V      V   +P  +P    IIP   Y+      +I++P            Q  +    +   +  P F    T   +K       +C L  IG P  ++ W ++   +    R  M  E     L        DSG  +  A N  G    SA +IV   ++   ++ SQ P   K L
Sbjct: 1521 TPSDSGEWTVVAQNRAGRSSISVILTV----EAVEHQVKPMFVEKL-KNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNV-----EVEFAEP--EPERKLIIPRGTYR----AKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIV--KDEKSLVEESQLPEGRKGL 1813          

HSP 18 Score: 64.3142 bits (155), Expect = 3.107e-9
Identity = 39/134 (29.10%), Postives = 68/134 (50.75%), Query Frame = 3
Query: 3927 DGGEYCLRV--ENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG 4322
            +G +Y  RV   N+ G   V +P     + EA+ +   PK +  + ++I     +K+ +   V G P+P  KW K  +E+  S HL + K   +  L+IK+  + D+G Y   A N++G++  K  + V+D  G
Sbjct: 21433 EGKKYKFRVAARNAVG---VSLPREAEGVYEAKEQLLPPKIL--MPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPG 21561          

HSP 19 Score: 63.1586 bits (152), Expect = 6.551e-9
Identity = 37/139 (26.62%), Postives = 68/139 (48.92%), Query Frame = 3
Query: 3891 RIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV 4307
            R +L    VT ++ G Y L+  N +G ++    + V A      +   P F+Q+L    +     +V ++ +V+G P P++K+ ++G E+  S   +I + G+ + L+I      D+G Y   A+N+ G   S   L V
Sbjct:   62 RAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKA------ETAPPNFVQRLQSMTVRQ-GSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLV 193          

HSP 20 Score: 63.1586 bits (152), Expect = 7.878e-9
Identity = 44/138 (31.88%), Postives = 65/138 (47.10%), Query Frame = 3
Query: 3897 ELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVG-ETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV 4307
            +L  ++VTT D  EY +   N  G  S    +TV       +    P F ++L         + V    +VSG P P LKW K+G+ LS   +++I   G + + L I++    D G Y   A+NT GS   + HLQV
Sbjct: 34317 QLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMF-KRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 34453          

HSP 21 Score: 62.7734 bits (151), Expect = 9.161e-9
Identity = 79/381 (20.73%), Postives = 148/381 (38.85%), Query Frame = 3
Query: 3657 VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQN---KKTSPKFIQKLDK--------EIISP-------INEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRE-LDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVD 4739
            V++  I+  PV      ++  ++ G +  VC + +Y     + W          R L N+ +Y++  +    +        LY  ++T  D G Y  +V N  G  S    + V  + E  +   ++T  K  ++ D         E   P       + E V     ++ +P P + W K+G+++   D+ K            K   +SD G+Y+                     I SV T    E    +T++   +Y   +D+             +++ +R  P F     +   +EG  V  +  + G P P + W  +   ++  P  E+  E LD Y L +++    D+G Y +TA N++G  +C A + V+
Sbjct: 34128 VKVASIEIGPVSGQIMHAV-GEEGGHVKYVCKIENYDQSTQVTWYFG------VRQLENSEKYEITYEDGVAI--------LYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDK------------KYTFESDKGLYQLT-------------------INSVTTDDDAE----YTVVARNKY--GEDSCKAKLTVTLHPPPTDSTLR--PMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVE 34454          

HSP 22 Score: 61.6178 bits (148), Expect = 1.868e-8
Identity = 70/283 (24.73%), Postives = 101/283 (35.69%), Query Frame = 3
Query: 3900 LYFDNVTTSD-GGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSA-LVIVD 4739
            L  D V T D  GEY     N +G ++    +TV        K+ +P   +K++   ++ +       C++   PN   +W K G E+ ESD   IR       L I   +  D G Y  +ASN  GS      L V                       TE Y P                       S P+ +TTF  +  K        C + G P    IW         +P + +    +++ L L N+   D G YS  A N  G   C A L+I+D
Sbjct: 4661 LVIDKVNTEDHQGEYVCEALNDSGKTATSAKLTVV-------KRAAPVIKRKIEPLEVA-LGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTV-----------------------TEAYPPT--------------------FLSRPKSLTTFVGKAAK------FICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIID 4886          

HSP 23 Score: 60.8474 bits (146), Expect = 4.006e-8
Identity = 158/789 (20.03%), Postives = 294/789 (37.26%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANT-EPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVS--SDVVWLKDNQPLNS----RDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEK----------------PISFTIIPTER-------YQPADDN------------SDISSPQ--RTQMIFSNTIV-----RSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYF---------LILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            + ++W+K +  ++P     I L+        ++ +   +  ++G Y C V N       S+     +F ++  T + + ++  F+  T  P+ L+    G    P S     +  +      C  +    + +++    ++  +D  QY   +   + +D+ +  + + E P F+       +++G+   +   +    ++    I W K  T L +       + N+   LV  I K   + VG+Y+C+  N  G        S+A  +I ++ L P  A+ +     +  +    V    +++   P  VS   D V LKD+  L +        +QI   ++S    + N +  N  GT  +  K         + ++  +  P     P S+      S    C V        I W+         R +     YKM       L  N   + +    V   D G+Y     N AG  S    + V         +  P+FI+KL+   I   +E     CK+ G+P   + W K+  E+ ES   ++  V     L + N    D+G Y  +A N  GS  S   L+V +P        P+E                 P   +    +R       Y+   +N            +DI   Q   T  + S+T V     ++PP+FV   +D     G +V L+  + G  P  ++W+          + E+ RE D  +         L    ++  ++G+Y+   +N +G+  C A + V
Sbjct: 8107 FKVKWFKGSRELVPGESCNISLE----DFVTELELFEVQPLESGDYSCLVTNDAG----SASCTTHLFVKEPATFVKRLAD--FSVETGSPIVLEATYTG--TPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTI--EDYAQYSCLIENEAGQDICEALVSVLEPPYFIEPLEHVEAVIGEPATLQCKVDGTPEIR---ISWYKEHTKLRSAPAYKMQFKNNVASLV--INKVDHSDVGEYSCKADNSVG-----AVASSAVLVIKARKLPPFFARKLKDVHETLGF---PVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIG-QYNCSASNPLGTASSSAK---------LILSEHEVPPFFDLKPVSVDLALGESGTFKCHVTGTAPIK-ITWA------KDNREIRPGGNYKMT------LVENTATLTVL--KVGKGDAGQYTCYASNIAGKDSCSAQLGV---------QEPPRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWF--------KDKGEIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSV 8826          

HSP 24 Score: 59.3066 bits (142), Expect = 1.162e-7
Identity = 54/247 (21.86%), Postives = 105/247 (42.51%), Query Frame = 3
Query: 4029 TSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVR---------SPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYN-THFINNPRFEMK--RELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVI 4733
            T P  +  L K +     E V + C +SG P+P + W +   ++  S   +I        L+I+     D+G +   A N  G+  + C+L       +V  ++  EK    T   TE++   ++   + S     ++ ++T +          + P F+T    + + EG  VV  C + G P+P ++W  +        R+++   ++  E  L++      D+G Y+I   N  G  + SA ++
Sbjct:  941 TPPTLVSGL-KNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYL-------AVQVSEEFEKE---TTAVTEKFT-TEEKRFVES---RDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLL 1172          

HSP 25 Score: 58.9214 bits (141), Expect = 1.339e-7
Identity = 59/251 (23.51%), Postives = 99/251 (39.44%), Query Frame = 3
Query: 4011 EAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWW---------SYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +++ + T P FI+++    IS + +   +   V G P P ++W  NG  L+ S   K    G+ H L+I   K  D G Y   ASN  G  +   +L+ I+  G  +     E  ++ ++              +  P              PP F+         +G   + +  ++G P P + W         S     I+NP             I+ + Q+ DSG Y   AEN  G +TC+A ++V
Sbjct: 3812 DSEKEGTGPIFIKEVSNADIS-MGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLK-INSKGEGHKDTETESAVAKSL------------EKLGGP-------------CPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPN-------GSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLV 4028          

HSP 26 Score: 57.7658 bits (138), Expect = 3.176e-7
Identity = 53/243 (21.81%), Postives = 95/243 (39.09%), Query Frame = 3
Query: 4032 SPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESD--HLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNK 4751
            +P F Q L   ++            +SG P P + W ++G+ +S S    ++I       +L I    K+++G Y  +A+N +G   S   L                                             ++ + T   +PP FV       V++G  V L+  + G P P++ ++       ++  F++ +E D Y L++      DSG YS+ A NS G AT +A ++V    +
Sbjct:    5 APTFTQPLQSVVVLE-GSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAEL---------------------------------------------LVKAET---APPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEE 198          

HSP 27 Score: 57.7658 bits (138), Expect = 3.284e-7
Identity = 65/285 (22.81%), Postives = 109/285 (38.25%), Query Frame = 3
Query: 3927 DGGEYCLRV--ENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKE------GDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEY-FLILKNIQ-KGDSGRYSITAENSSGLATCSALVIVDSHNK 4751
            +  EY  RV  EN  G S    P   A   + +        I+K  K++ + + E   + C++ G P P +KW + G+EL +S   K+   G TH L +   ++ D G+Y   A+N                +G V T+                                    S  ++++ PQF   +    +KE      G  + L    IG P P + W +    + N         + Y  L++KN+Q K  +G+Y +   N  G  T  A++ V+  +K
Sbjct: 33065 EATEYEFRVFAENETGLSR---PRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNE---------------VGEVETS------------------------------------SKLLLQATPQFHPGYP---LKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFG--TVDAILDVEIQDK 33290          

HSP 28 Score: 55.4546 bits (132), Expect = 1.424e-6
Identity = 64/299 (21.40%), Postives = 117/299 (39.13%), Query Frame = 3
Query: 4065 IISPINEKVI-------VRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMI-FSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI---NNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLPPETYSNLVK--THINDESRVMQASPRGWQEFQFHSNASTLRS 4922
            II+P+ + V         +C+VSG  +  + W    +++  S   ++ +  +T++L I      D G Y   ASN  G   S  +L +                        E +   ++N+  S    +  + F    +   P F+   +   V  G+ V     + G P+P I W +N   I    +  F  +       +++ +     +G+YS  A NS+G ATC+A + V    K  ++DR    S+ K +   T S  V   +   +ES++ Q   + +Q   +        S
Sbjct: 3347 IITPLQDTVTSEGQPARFQCRVSGT-DLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSL------------------------EGFSKFEENTSNSQWHVSLSVSFKKEPLGQKPSFIQPLSSLRVHNGETVRFHARVSGIPKPEIQWFHNQQLILPTKDVVFHFEESTGMALMLIVDAYSEHAGQYSCKAANSAGEATCAATLTVTP--KVQALDRQ---SSGKDVRESTKSQAVADSSFTKEESKISQKEIKSFQGSSYEYEVQVFES 3615          

HSP 29 Score: 55.0694 bits (131), Expect = 2.239e-6
Identity = 46/148 (31.08%), Postives = 61/148 (41.22%), Query Frame = 3
Query: 3930 GGEYCLRV--EN--SAGWSSVMIPITVAALAEAQNKKTSP------KFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVID----PIGSVN 4331
            G  Y  RV  EN    G     IPI      E Q K   P      K I+ L  +  + +    I+R    G P P  KW  +G E+   +H  +     +  L IKNC + D G Y+   SN  GS+    HL V+D    P G +N
Sbjct: 20043 GKTYRFRVKAENIVGLGLPDTTIPI------ECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIR----GVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPIN 20180          

HSP 30 Score: 54.299 bits (129), Expect = 3.462e-6
Identity = 66/243 (27.16%), Postives = 105/243 (43.21%), Query Frame = 3
Query: 3894 IELYFDNVTTSDGGEYCLRV--ENSAGW----SSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTER----YQP--ADDNSDISS---PQRTQMIFSNTIVRSPPQFVTTFTDEIVK--EGDDVVLKCCLI---GYPEPL 4562
            IE  F     ++   Y  RV  +N+AG     S    PIT     E       PKF       I+    E   +   V G P P ++W++  +E+ ES   +I+       L++K+  + D G Y  +ASN  GS+    +++V+D  G      P E P+  T + +E+    + P   D  SDIS     +R     + T+V S    V T + ++ K  EG++ V +   +   G  EPL
Sbjct: 26144 IETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKF----RDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPG------PPEGPVQVTGVTSEKCSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASE---VVTNSLKVTKLLEGNEYVFRIMAVNKYGVGEPL 26373          

HSP 31 Score: 53.9138 bits (128), Expect = 4.604e-6
Identity = 50/206 (24.27%), Postives = 89/206 (43.20%), Query Frame = 3
Query: 4131 LKWMKNGEELSESDHLKIRKVGE-THELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDS 4742
            + W K+G++L E+ H +     + T+EL I N  +SD G Y  + S   G+  SK +LQ +         K + + +S  I  T++   +D  +  S+  R     +   + S P  VT   D  V             G P P   W+ +   I    ++++  +   +FL +      DSG Y+ T +NS+G  + S  + + +
Sbjct: 35317 VTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGT--SKTNLQFMG-----QAFKSIHEKVS-KISETKK---SDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKA 35511          

HSP 32 Score: 53.1434 bits (126), Expect = 8.279e-6
Identity = 57/249 (22.89%), Postives = 102/249 (40.96%), Query Frame = 3
Query: 4089 VIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETH-ELVIKNCKKSDAGIYEAQASNTNGSEV--SKCHLQVIDPIGS---VNTTKPLEK-----PISFTIIPTE----RYQPADDNSDISSPQRT--------------QMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFE--MKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDS 4742
            V   CK+SG P P + W K+G+ +   +  ++  + +    L I      D GIY A ASN  G+ +   K +++   P+G+   + T +P+ +     P S +  P      R  PA  +    SP R               + ++    V  P  F          EG        ++G P P  +W ++   I N      + +E     LI+      DSG +++ A+N +G ++ S ++ V++
Sbjct: 1308 VTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCL-------EGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEA 1549          

HSP 33 Score: 52.7582 bits (125), Expect = 9.388e-6
Identity = 95/475 (20.00%), Postives = 182/475 (38.32%), Query Frame = 3
Query: 3438 GDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK-ETGQTQTTI---VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVA---ALAEAQNKKTSPKFIQKLDKEIISPINEKVIVR----------------------------------------CKVS--GNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTK-PLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGL 4709
            G + + D++       +  W  D Q + + D   ++   E+   SL I  AT +DSG +  V +   G++  ++   VE    Q  P+  +  +++  K+   + +       P+   I W +K +D      ++   +Y  I     ++ G      L  D+  + D   Y     N AG  +    + V    A  E + K   P+   +  KEI +P  E + +R                                        C+++  G+P  +++W+ +G+ L  ++ L++        L        D+GI   +A+N  G++ +   L V D    V  ++ P  +     I   ER       + +++ Q+          +  P  V       V EG+    +C + GYP+P + W  N   I  + RF ++ +   Y  I+ + +  D+G   +TAEN  G+
Sbjct: 1471 GQTARFDLKVVGRPMPETFWFHDGQQIVN-DYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPN-PDIVW-LKNSD------IIVPHKYPKI-----RIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRA-KEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKE---------KQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIV-DCKSYDTGEVKVTAENPEGV 1920          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Human
Match: SPEG (striated muscle enriched protein kinase [Source:HGNC Symbol;Acc:HGNC:16901])

HSP 1 Score: 98.2117 bits (243), Expect = 9.693e-20
Identity = 68/255 (26.67%), Postives = 113/255 (44.31%), Query Frame = 3
Query: 4032 SPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPI------------------SFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI--NNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +P F   L   +++P    V+++C ++ NP P + W K+G  L     L +R  GE H L+++  + +DAG Y A A+N  G       L  + P GS   T P   PI                  ++   PT +  P+ +              S+T  ++PP F  +  D+ V+EG DV++   + G P+P++ W  N   +  +  RF  + E     L +   ++GD+G Y+  A N  G   C A + V
Sbjct:  617 APVFEIPLQNVVVAP-GADVLLKCIITANPPPQVSWHKDGSALRSEGRLLLRAEGERHTLLLREARAADAGSYMATATNELGQATCAASL-TVRPGGS---TSPFSSPITSDEEYLSPPEEFPEPGETWPRTPTMKPSPSQNRRS-----------SDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEV 855          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Celegans
Match: unc-89 (Muscle M-line assembly protein unc-89 [Source:UniProtKB/Swiss-Prot;Acc:O01761])

HSP 1 Score: 125.561 bits (314), Expect = 3.174e-28
Identity = 169/772 (21.89%), Postives = 291/772 (37.69%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTF---AANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK-DVAKTHLEIG-----EKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA--------------------------VLKETGQTQ----------TTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGE-THELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            ++W+KD+  I    D   ++Q  +  G   + I++ R+ D G Y C  RN          +  + F   + ++ P+F++K         E L LK+ + G    P  +   ++ PIN+++S   ++K   +       +    +DVG Y  + +++   AKT   +      E P FV          G    + + ++   K  P+ + W K+  P+  +         +NG     I     A  G YTCQ +N+ G+D    +L   +     QT   V  KP+    L + +     GD++ L+ +   +    + + K++QP+      +Q+   E+    L I  A   D G Y+                           V  E+GQ +          T   + +  + AP   +  +S    +     + C V   P    I W+ +       + +  +AR +  +K    LT       L FDNVT +D GEY    EN  G +    PI V      +    +P F+Q +   +++ + E  ++  K+SG P P +KW KNGEEL  SD +KI  + + T  L + N K  D   Y  +ASN  G   S   L V +P                                                +  P F    +   VKE +    +C + G    + W+   T    + R   +   D    L++++ +  D G Y I   N +G+A     + V
Sbjct: 2842 VEWFKDDTPI--SIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRARN-----EAGEALTTANFGIIRDSIPPEFTQKLRPLEVREQETLDLKVTVIGTP-VPNVEWFKDDKPINIDNSHI-FAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAPLFVQGLKPYEVEQGKPAELVVRVEG--KPEPE-VKWFKDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEV--KPLFIEPLKETFAVE--GDTVVLECKVNKESHPQIKFFKNDQPVEIGQ-HMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPK-IKWTKE------GKEVEMSARVRAEHKDDGTLT-------LTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAVVT-VGETAVLEGKISGKPKPSVKWYKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEP-----------------------------------------------AQVAPGFFKELSAIQVKETETAKFECKVSGTKPDVKWFKDGTPLKEDKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTV 3534          

HSP 2 Score: 125.176 bits (313), Expect = 4.632e-28
Identity = 183/800 (22.88%), Postives = 306/800 (38.25%), Query Frame = 3
Query: 2481 VNAESSCPTRLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFS---EKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK--------DVAKTHLEIGE---KPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYIND--NGELVFEIPKFTQAHVGDYTCQVSNEFGED--VLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAV-LKETGQTQTT----------IVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGE-THELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTH-FINNPRFEMKRELDE--YFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYP 4781
            V+ E   P  L   +E +P++      I+WYK+ + + PD D     +   +SG+  + I + ++SD G Y   + N    +   S V +      + T    F    + T     + L+L+  + G    P  ++I+    + +        +V+ +       RS    D+GQY  RV++K        D   T  E GE   KP+FV       +L GD    ++ ++   K    T+ W  N  P+       +  ++D  +G     I    +   G   C   NE G D  V + Q  A     S   L      P  +  L D  +   VGD + ++    A+ +++V W KD + +       +I    +  C +KI     +D G Y  V + E GQ +T           + E    ++AP I    +         I + C V++ P   S+ W     DG P R    ++R  +  +     T       L  ++ T  D G Y     N+ G  +    + V    +   K+    F  K   ++ +   +   ++C V+G+P P +KW +NG+ L       I    + +  L +     SD GIY  +A N +G   ++    V   +G        EKP              D+                     PP+F+   +D  V  G+ + L+C + G P P + WS +    I + RFE   E  +  Y L +KN    D G Y   A N +G AT  + V +D    +  +  SQ P
Sbjct: 4404 VDVEEPQPVELKVKVEGIPKV------IKWYKNGQELKPDAD-GFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHVKSAKSSEPTSGANFLSPLKDTEVEEGDMLTLQCTIAG---EPFPEVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQY--RVTAKNEAGSATSDCKVTVTEQGEQPSKPKFVIPLKTGAALPGDKKEFNVKVRGLPK---PTLQWFLNGIPIKF---DDRITLDDMADGNYCLTIRDVREEDFGTLKCIAKNENGTDETVCEFQQGAGHDDGSRDDL---RYPPRFNVPLWDRRI--PVGDPMFIECHVDANPTAEVEWFKDGKKIE-HTAHTEIRNTVDGACRIKIIPFEESDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTVNGGQPIRLSCKVDAIPRA-SVVWY---KDGLPLRA---DSRTSIQYEEDGTAT-------LAINDSTEEDIGAYRCVATNAHGTINTSCSVNVKVPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHVQMALGKT------EKP------------KMDEG-------------------KPPKFILELSDMSVSLGNVIDLECKVTGLPNPSVKWSKDGGPLIEDSRFEWSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTASQPP 5128          

HSP 3 Score: 105.916 bits (263), Expect = 3.012e-22
Identity = 161/760 (21.18%), Postives = 288/760 (37.89%), Query Frame = 3
Query: 2559 DIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSS-KDVAKTHLEIGE-----KPEFVYH------QFKENSLLG---------------DSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQTQTTI-VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVM--IPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETH-ELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRELDEYF-LILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            D++W+KD++ +  D +    ++ N ++G   + +     +DAG+Y  +  N P+   +SS       S ++ T + +        N E  +L + + G    P  + + +  P+  + S    +KV  +       +   L+D G+Y  R ++    AKT            PEFV        + KE++ L                D   ISI   N H +  +T +                      G     I    Q  VG Y+C+  NE GE      L+ A   I   ++ P   + +   ++ +        +++ L V        +V W KD++P+N  +  I          +L I  A   D G Y      E G+ +TT  + +     AP+     +    +Q     +V  V   P    + W     DG P           + N+ + +  G      L   +   +D G+Y  +  N AG    +  + I   +  +   ++  P FI+ L KE  +   + V++ CKV+   +P +K+ KN + +    H+++  + + + +L I+N KK D G Y  +A N  G   +   L++            +E+ ++      E     +   D +S +           R  P+FV       V E    +LKC + G P P I W+     +  + R   + + D    L   N+ + D+G Y   AEN  G A     +IV
Sbjct: 2645 DVEWFKDDKPVSEDGNHE--MKKNPETGVFTLVVKQAATTDAGKYTAKASN-PAGTAESSAEAEVTQSLEKPTFVRELVTTEVKIN-ETATLSVTVKGVP-DPSVEWLKDGQPVQTDSSHV-IAKVEGSGSYSITIKDARLEDSGKYACRATNPAGEAKTEANFAVVKNLVPPEFVEKLSPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISI--DNVHVIQKQTAV----------------------GSFSLTINDARQGDVGIYSCRARNEAGE-----ALTTANFGIIRDSIPPEFTQKLRPLEVREQ-------ETLDLKVTVIGTPVPNVEWFKDDKPINIDNSHIFAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAPLFVQGLKPYEVEQGKPAELVVRVEGKPEPE-VKWF---KDGVP---------IAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEVKPLFIEPL-KETFAVEGDTVVLECKVNKESHPQIKFFKNDQPVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKI-------QFAAKVEEHVTDESGQLEEIGQFETVGDTASSK-------TDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIV 3334          

HSP 4 Score: 100.138 bits (248), Expect = 1.557e-20
Identity = 181/828 (21.86%), Postives = 298/828 (35.99%), Query Frame = 3
Query: 2559 DIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWC----EVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFS---EKTFAANTEPLSLKLVLDGFKYAPESDLIF--NNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYL-----------------FRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKN-------------FHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPV---SAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKC--SLKINGATVNDSGTYQAVLKETGQTQTT--------------IVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTT--------SDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTS-----------PKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLK-IRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLP 4802
            +++W+KD + I       I    N+  G  ++ I    ESD G Y C    E+    +       +L  V  +K+    PK +   E       +P+ L   +D     P + +++  + +P+  +  +    +      +  N  +   +D+G Y                   +V  ++V K     GE+P F        +  GDS  +   +                 +  P+T+I                   + +G     + + T +  G Y C+  N  G+   K Q +A   +   +T  P       P    +LSD  V  S+G+ I L+ +     +  V W KD  PL   D R + +  E SK    L+I  ATV+D GTY+ V      + TT              +    P +F   + D    +R  +   + + C V++ P    + +     DG+             I  P +++     +I L  D V T         D G Y +   N +G +      TV  L      + S           PK ++ L+  I  P  +   +RCK SG+P P +KW K+GE +     L+ I       ELV+ +  + DAG Y   A NT GS  + C + VI                          +P D +S I   +              P F T  T    K GD V  +C   G P P I W        ++ + +M+   D    LIL ++     G +   A N  G A+  A ++++        DR+     S+PLP
Sbjct: 4734 EVEWFKDGKKIEHTAHTEIR---NTVDGACRIKIIPFEESDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTVNGGQPIRLSCKVDAI---PRASVVWYKDGLPLRADSRTSIQYEEDGTATLAINDST--EEDIGAYRCVATNAHGTINTSCSVNVKVPKQEVKKE----GEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVI-----------------ETSPDGSCSLTVNESTMSDEGIYRCEAENAHGK--AKTQATAHVQMALGKTEKPKMDEGKPPKFILELSDMSV--SLGNVIDLECKVTGLPNPSVKWSKDGGPL-IEDSRFE-WSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTASQPPRFTLKMGD----VRTTEGQPLKLECKVDASPLPEMVWYK----DGA-------------IVTPSDRI-----QISLSPDGVATLLIPSCVYDDDGIYRVIATNPSGTAQDKGTATVKKLPRDSGARRSADRDVFDANKAPKLMEPLEN-IRIPEKQSFRLRCKFSGDPKPTIKWFKDGERVFPYGRLQLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVI----------------------RGDRKPRDIDSSIREGK-------------APGFTTPLTIRRAKPGDSVTFECLPFGNPFPSIKWLKDGLELFSDEKIKMEAAADGTQRLILSDVTFLSEGYFRCVATNEHGTASTKAELVIEG-------DRT---IGSRPLP 5454          

HSP 5 Score: 91.6633 bits (226), Expect = 6.786e-18
Identity = 172/806 (21.34%), Postives = 306/806 (37.97%), Query Frame = 3
Query: 2490 ESSCPTRLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGT---VIPKFSE---KTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPI--------------------------NVNHSSCPWSKVS------SNEMIQFNHR--------SVSLKDVGQYLFRVSSKDVAKTHLEIGE-KPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFG----EDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQ--TQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGET-HELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDS 4742
            E   P  L   +E  P     + +++W+KD   I    D + +++   ++G   + I +   +D G+Y C+  N          + +  +S ++ T   V P F E   +TFA   + + L+  ++   + P+     N+ P+                          +V    C    V+      ++  IQF  +        S  L+++GQ+    +  D A +  + G   PEFV    +  ++     AI   +K   K  P+  I    +          +    D+G L       TQA  G+Y C+  NE+G    E  + + L  A  +       P   +P+  + +       +VG++  L+ +        V W K+ + L   D R++I   ++    L +  A ++D   Y+     E G   +  T+    P Q AP       +I+ K+  +    C V+   +   + W     DG+P   L  + R               QR  L  ++  T D G Y + V N AG ++  +P+TV      +        I+K   ++      K+++  +V G P  + KW K  E ++ S   KI +V E+ ++L I++ + SD G Y    S  + S         ++   +V  TK  EK IS                                    P F     D+ V +G  +VL+  + G P+ + W+  N   I + + E      +Y L + + Q+ D G YS+TA N +G     A V V +
Sbjct: 3019 EQGKPAELVVRVEGKP-----EPEVKWFKDGVPIA--IDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEVKPLFIEPLKETFAVEGDTVVLECKVNKESH-PQIKFFKNDQPVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFE---TVGDTASSKTDTGRGAPEFV-ELLRSCTVTEKQQAI---LKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGE---APDFLQPVKPAVV-------TVGETAVLEGKISGKPKPSVKWYKNGEELKPSD-RVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEPAQVAPGFFKELSAIQVKETETAKFECKVSG--TKPDVKWF---KDGTP---LKEDKRVH-----FESTDDGTQR--LVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTVVPSETLK--------IKKGLTDVNVTQGTKILLSVEVEGKPKTV-KWYKGTETVTSSQTTKIVQVTESEYKLEIESAEMSDTGAYRVVLSTDSFS---------VESSATVTVTKAAEK-ISL-----------------------------------PSFKKGLADQSVPKGTPLVLEVEIEGKPKDVKWYK-NGDEIKDGKVEDLGN-GKYRLTIPDFQEKDVGEYSVTAANEAGEIESKAKVNVSA 3727          

HSP 6 Score: 84.3445 bits (207), Expect = 9.842e-16
Identity = 118/484 (24.38%), Postives = 189/484 (39.05%), Query Frame = 3
Query: 3444 SIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSI---------------RAKQNGSINIVCV--VNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAA--------LAE--AQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGET-----HELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYN-THFINNPRFEMKR-ELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV-----DSHNKNHSIDRSQY 4778
            S +L  +F  D    + W KD + +     R+Q+    +  C L ++ AT  D+G Y+ V + T  +  T  ++N I+     +D   SI               RAK   S+   C+   N +P   SI W     DG     L ++ + KM            QR  L   +VT    G +     N  G +S    + +          L E   + ++  P+  + L    I   N   ++ C  +G P P +KW K+G+E+   D    ++V  T     H LVI N    D G Y  +A+N  GS  ++  L +I P                      R+    D       +R  M F       PP FV    ++ V      +  C ++G+P P + W +N    +   R +++      + LI+ +    D+G Y  TA+NS G A+ SA++ V     DS   N  ID + Y
Sbjct: 5258 SFRLRCKFSGDPKPTIKWFKDGERVFPYG-RLQLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVIRGDRKPRDIDSSIREGKAPGFTTPLTIRRAKPGDSVTFECLPFGNPFP---SIKWL---KDG---LELFSDEKIKM-----EAAADGTQR--LILSDVTFLSEGYFRCVATNEHGTASTKAELVIEGDRTIGSRPLPEVNGEPEECKPRIRRGLYNMSIHEGNVVEMIVC-ATGIPTPTVKWYKDGQEIV-GDGPDGKRVIFTDERGIHHLVIVNASPDDEGEYSLEATNKLGSAKTEGSLNIIRP----------------------RHIADAD-------ERGGMPF-------PPGFVRQLKNKHVFNHMPTIFDCLVVGHPAPEVEWFHNGKKIVPGGRIKIQSCGGGSHALIILDTTLEDAGEYVATAKNSHGSASSSAVLDVTVPFLDSIKFNGEIDVTPY 5686          

HSP 7 Score: 78.5666 bits (192), Expect = 5.763e-14
Identity = 160/759 (21.08%), Postives = 295/759 (38.87%), Query Frame = 3
Query: 2559 DIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNN---MPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK-DVAKTHLEIGEKPEFVYHQ-FKENSLL-GDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDV----LKLQLSAAEALISSQTLIPVSAKPISS--SQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQN-----GSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLD--KEIISPINEKVIVRCKVSGNPNPILKWMKNGEELS-ESDHLKIRKVGETHE--LVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEP-LIWWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHS 4760
            +I+WYK+ + I P    +     +    K ++ I +  + DA +Y   + +       SS  L      K+  +I    ++  +  + P+ L++   G   +P++   + N   +P      +    K+  N+ +     SV ++D G Y   V+++   A +  +I  +P+  + +  K+ S+  G++   S+         P+ + W             +   I  N   + E     Q     Y   + N   +D     + L+ +A EA  S+Q  +  +   +      L D  V  + G  +  +V+   +   DV WL+D   +++    I I   +++   L I  A + D+G Y   V+ E+G+ ++             + + P+ +R  +N     G  ++  V  S P    + W     +  P  +L      K I           ++ EL  +     DG +Y + + N+AG       +TV            P  ++ +D  K++     + V ++ KV G P  ++KW KNG+EL  ++D  K  +  E+ E  L I + KKSD G Y     N  G   S   + V     S  +++P                                        S   F++   D  V+EGD + L+C + G P P +IW         + R  M+  LD    L +++ +K D G+Y +TA+N +G AT    V V    +  S
Sbjct: 3947 EIKWYKNGKEITPSDKAQ---PGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEPKIIKGLEDQVVSIGS-PIKLEIETSG---SPKTVKWYKNGKELP-GAAAKTIKIQKIDDNKYVLEIPSSV-VEDTGDYKVEVANEAGSANSSGKITVEPKITFLKPLKDQSITEGENAEFSVETNT----KPRIVKW-----------YKNGQEIKPNSRFIIE-----QKTDTKYQLVIKNAVRDDADTYKIVLENTAGEAESSAQLTVKKAKAGLCKIVKGLEDQVV--AKGAKMVFEVKIQGE-PEDVRWLRDANVISAGANAI-IEKIDDTTYRLIIPSADLKDAGEYTVEVINESGKAKS--------DAKGEVDEKPEIVRGLENIEIPEGDDDVFKVEVSAP-VRQVKWYKNDQEIKPNSHL----EAKKIGP---------KKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVV----------KPNVLKIVDGLKDVDVEEPQPVELKVKVEGIPK-VIKWYKNGQELKPDADGFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHV----KSAKSSEPT---------------------------------------SGANFLSPLKDTEVEEGDMLTLQCTIAGEPFPEVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVTVTEQGEQPS 4596          

HSP 8 Score: 77.0258 bits (188), Expect = 1.578e-13
Identity = 167/786 (21.25%), Postives = 295/786 (37.53%), Query Frame = 3
Query: 2559 DIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSS------KDVAKTHLEIGEK---PEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKL-DKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETH-ELVIKNCKKSDAGIYEAQASNTNGSEV-SKCHLQVIDPIGSVNTTKPLE-------KPISFTI-----------------IP-----TERYQPADDNS------------------DISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            D++W+KD   +  D   R+  + ++  G  ++ I++ +  D G Y  EV N   V   +S V L+V   +   +    ++      T+ L L + ++G    P++   +       +  +    +V+ +E  +    S  + D G Y   +S+           T  +  EK   P F      ++   G  L + + ++      PK + W KN   +       K     NG+    IP F +  VG+Y+   +NE GE             I S+  + VSAKP   S L    V    G++   +V+    V   V W K+ + +    P  +     +   SL+I  A V D+  Y+ V+        +   +  ++ A   +D     + K      ++          + N  +K     P + +      K I     K  G+     L   N    D  +Y + V N AG +     +TV     A         ++ L D E+  P  +K +++ + +  P  I KW KNG+E++ SD  +    G+   +LVI +    DA  Y+   ++ +G+   S C L V  P       K LE        PI   I                 +P     T + Q  DDN                   ++++   +        V     F+    D+ + EG++          P  + W+        N RF ++++ D +Y L++KN  + D+  Y I  EN++G A  SA + V
Sbjct: 3474 DVKWFKDGTPLKED--KRVHFE-STDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVA--NSKVPLTVVPSETLKIKKGLTDVNVTQGTKIL-LSVEVEG---KPKTVKWYKGTETVTSSQTTKIVQVTESEY-KLEIESAEMSDTGAYRVVLSTDSFSVESSATVTVTKAAEKISLPSFKKGLADQSVPKGTPLVLEVEIEG----KPKDVKWYKNGDEIK----DGKVEDLGNGKYRLTIPDFQEKDVGEYSVTAANEAGE-------------IESKAKVNVSAKPEIVSGLVPTTV--KQGETATFNVKVKGPVKG-VKWYKNGKEI----PDAKTKDNGDGSYSLEIPNAQVEDAADYKVVVSNDAGDADSSAALT-VKLADDGKD-----KVKPEIVSGLIPTTVKQGETATFNVKVK----GPVKQVKWYKNGKEIPNAKAKDNGDGS-YSLEIPNAQLDDTADYKVVVSNDAGDADSSAALTVKLPGIA--------IVKGLEDAEV--PKGKKAVLQVETNKKPKEI-KWYKNGKEITPSDKAQPGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEPKIIKGLEDQVVSIGSPIKLEIETSGSPKTVKWYKNGKELPGAAAKTIKIQKIDDNKYVLEIPSSVVEDTGDYKVEVANEAGSANSSGKITVEPKITFLKPLKDQSITEGENAEFSVETNTKPRIVKWYKNGQEIKPNSRFIIEQKTDTKYQLVIKNAVRDDADTYKIVLENTAGEAESSAQLTV 4199          

HSP 9 Score: 72.4034 bits (176), Expect = 4.719e-12
Identity = 127/583 (21.78%), Postives = 214/583 (36.71%), Query Frame = 3
Query: 3048 GEKPEFVYHQFKENSLLGDSLAISIPMK-------NFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQF--APVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPI----NEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRK---VGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVI-DPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN--NPRFEMKRE-LDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            GE P F      +   +G+ L +S  +K       +F+  S  T +  K  +         +T  N +  +V  I + T+  +  Y    +N  G        + + + I+++   PV  + +  + + +        + IK++V+     + DV W KD++P++          PE    +L +  A   D+G Y A       T  +  E    Q    P       +   K N +  +   V   P   S+ W     DG P +   ++   K+       +T    R+E         D G+Y  R  N AG +      T A  A  +N    P+F++KL     SP+     E   +  KV G P P ++W K+   +S  +   I+K   VG +  L I + ++ D GIY  +A N  G  ++  +  +I D I                                                 PP+F        V+E + + LK  +IG P P + W  +   IN  N     K E    + L +K  +  D G Y+  A N +G A  +A + V
Sbjct: 2511 GEAPVFTKELQNKELSIGEKLVLSCSVKGSPQPHVDFYSFSETTKVETKITSSSRIAIEHDQT--NTHWRMV--ISQITKEDIVSYKAIATNSIG-------TATSTSKITTKVEAPVFEQGLKKTSVKEK-------EEIKMEVKV-GGSAPDVEWFKDDKPVSEDGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEAEVTQSLEKPTFVRELVTTEVKINETATLSVTVKGVPD-PSVEWL---KDGQPVQTDSSHVIAKVEGSGSYSITIKDARLE---------DSGKYACRATNPAGEAK-----TEANFAVVKN-LVPPEFVEKL-----SPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISIDNVHVIQKQTAVG-SFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSI-------------------------------------------------PPEFTQKLRPLEVREQETLDLKVTVIGTPVPNVEWFKDDKPINIDNSHIFAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAV 3000          

HSP 10 Score: 67.3958 bits (163), Expect = 1.298e-10
Identity = 121/528 (22.92%), Postives = 207/528 (39.20%), Query Frame = 3
Query: 3207 HKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN-SRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK-ETGQTQTT---IVEINPIQ--FAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINK-PLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGET--HELVIKNCK--KSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN--NPRFEMKRELDEYFLILKNIQKGDSGRYSIT----AENSSGLATCSALVIV 4736
            H  Y +++G     I        G YTC  +NE+G+       ++  A      +   +A P   ++L D       GD I  + E       ++VWL D+QPL  S D R+Q Y  + +K  L+I  A  +D+G Y   ++ E G  ++     V+ +P +   AP  Q   + +   +   +    V+   P+   I W I   +G P   L  + + K I++  +  LT  ++ +  +FD + T  G    L   +  G   V +P               P F + L+ + +      V+    VSG P P L +   G+EL   +   +  VG    + + I N    K D  I  A+A N +G+  S+  L V                           +  ++ S                 RS P F+    D+ VK G+  V +  + G P P + W  N H ++  +P  +++    ++ L +      DS +Y+ T    AEN+ G     A ++V
Sbjct:  594 HTFYSDEDGFFAMTIDPVQVTDTGRYTCMATNEYGQ-------ASTSAFFRVLKVEKEAAPPAFVTKLRDKEC--KEGDVIDFECEVEGWPEPELVWLVDDQPLRPSHDFRLQ-YDGQTAK--LEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPDKNHVAPEFQATIEYVECDEGEEVRFKSVITGDPNPEII-WFI---NGKP---LSESEKVKFISEDGICILT--IKDVTRHFDGMVTCQGSNR-LGSASCDGRLKVRVP------------PAPPTFNKPLEDKTVQE-KSTVVFEVDVSGWPEPTLTFTLCGKELKNGEE-GVEIVGHDGFYRISIPNTSMDKHDGEIV-AKAQNEHGTAESRARLTV---------------------------EQEEEES-----------------RSAPTFLKDIEDQTVKTGEFAVFETTVRGNPNPEVTWFINGHKMDQGSPGVKIEAHNHDHKLTI------DSAQYAGTVLCRAENAVGRFETKARLVV 1034          

HSP 11 Score: 66.6254 bits (161), Expect = 2.165e-10
Identity = 72/297 (24.24%), Postives = 119/297 (40.07%), Query Frame = 3
Query: 3486 DVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVL-KETGQTQTTIV--------EINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE 4349
            D+ W KD+  L+  D R   Y  E+   ++ I+   V D+G Y  +   E GQ  T+          E  P  F   ++D       K+   I+  C V  +P    + W +      P+ +               +L  + Q  +L   +    D G Y ++++N  G  S+     +   A+      +P+F Q   + +     E+V  +  ++G+PNP + W  NG+ LSES+ +K         L IK+  +   G+   Q SN  GS      L+V  P       KPLE
Sbjct:  578 DITWYKDDVQLH-EDERHTFYSDEDGFFAMTIDPVQVTDTGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRD----KECKEGDVIDFECEVEGWPEPELV-WLVDDQPLRPSHDF--------------RLQYDGQTAKLEIRDAQPDDTGVYTVKIQNEFG--SIESKAELFVQADPDKNHVAPEF-QATIEYVECDEGEEVRFKSVITGDPNPEIIWFINGKPLSESEKVKFISEDGICILTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPPAPPTFNKPLE 851          

HSP 12 Score: 64.6994 bits (156), Expect = 9.719e-10
Identity = 108/507 (21.30%), Postives = 197/507 (38.86%), Query Frame = 3
Query: 3282 YTCQVSNEFGEDVLKLQLSA--AEALISSQTLIPVS---AKPISSSQLSDNYVTGSVGDSIKLDVEFPA-DVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK-ETGQTQTTI-VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVN--TTKPLEKPISFTIIPTE-----RYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYN------THFINNPRFEMKREL--DEYFLILKNIQKGDSGRYSITAENSSGLATCSALV 4730
            YT ++SN   E    ++++A  +    S Q  + V      P   SQL+D       G+ ++ ++E       ++V WL + QPL   D  +Q+    +    + I  A    SGT  A  K   G+ +T+  V +N     P     PQ+       S+    +V   P   ++ W +        + L+ +   K+      K      +  +          G   +  EN +G       +   A  +   K   PKF   +D   +    E V     V G P P + W  NGE +S+  ++ +      H + I       AG    +A+N  GS+     L V     +    T + +E     TI  +E     +Y    +N++ +S  +T+     T+    P F     ++ +  G+ +VL C + G P+P + ++S++      T   ++ R  ++ +     + +++  I K D   Y   A NS G AT ++ +
Sbjct: 2130 YTLKISNAKIEQTGTVKVTAQNSAGQDSKQADLKVEPNVKAPKFKSQLTDK--VADEGEPLRWNLELDGPSPGTEVSWLLNGQPLTKSD-TVQVVDHGDGTYHVTIAEAKPEMSGTLTAKAKNAAGECETSAKVTVNGGNKKPEFVQAPQNHETTLEESVKFSAIVTGKP-MPNVTWYLN------NKKLIQSEEVKV------KYVHETGKTSIRIQKPLMEHNGTIRVEAENVSG------KVQATAQLKVDKKTEVPKFTTNMDDRQVKE-GEDVKFTANVEGYPEPSVAWTLNGEPVSKHPNITVTDKDGEHTIEISAVTPEQAGELSCEATNPVGSKKRDVQLAVKKKTITQESITVESVEGVERVTITSSELSHQGKYTCIAENTEGTS--KTEAFL--TVQGEAPVFTKELQNKELSIGEKLVLSCSVKGSPQPHVDFYSFSETTKVETKITSSSRIAIEHDQTNTHWRMVISQITKEDIVSYKAIATNSIGTATSTSKI 2609          

HSP 13 Score: 60.4622 bits (145), Expect = 1.536e-8
Identity = 73/314 (23.25%), Postives = 123/314 (39.17%), Query Frame = 3
Query: 3891 RIELY-FDNVTTSDGGEYC----LRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKL-DKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRY---------SITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSN 4787
            +IE +  D+  T D  +Y      R EN+ G       + V A    + +K  PKF++ L DK     ++  V+   +V G P P + W   GEEL +SD ++IR+   + ++ IKN K  DAG   A A+N+ GS+ +K  L V             +KP +                                    P+F        V++G + V      G P P   WS N   + + +   +   DE  +   +I   D+  Y         S+ AEN+ G     A + ++   ++  +++    S+
Sbjct:  994 KIEAHNHDHKLTIDSAQYAGTVLCRAENAVGRFETKARLVVLA---PEKQKKPPKFVEILVDK--TETVDNTVVFEVRVEGEPKPTVTWYLKGEELKQSDRVEIREFDGSIKISIKNIKIEDAGEIRAVATNSEGSDETKAKLTV------------QKKPFA------------------------------------PEFDLRPVSLTVEKGSEAVFSAHAFGIPLPTYEWSVNGRKVRDGQEGARVTRDESTVDGASILTIDTATYYSEVNHLTISVVAENTLGAEETGAQLTIEPKKESVVVEKQDLSSS 1254          

HSP 14 Score: 57.7658 bits (138), Expect = 1.189e-7
Identity = 79/343 (23.03%), Postives = 148/343 (43.15%), Query Frame = 3
Query: 3279 DYTCQV-SNEFGEDVLKLQLSAAEALISSQTLIPV------SAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTI-VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSG-NPNPILKWMKNGEELSESDHLKIRKVGE-THELVIKNCKKSDAGIYEAQASNTNG 4277
            ++ C + +  FG   + +  S A   + ++T + V      + KP  + +L D  VT   GD++++DV   A  S    W ++   L      + I   EE+K SL I  A  +   T +A   E G ++++  + +NP    P++ D P+S+  K+  +      ++ +P+  ++ W+I          +V  +R     K  +  T       L   N      G   +  +NSAG  S    + V    +A      PKF  +L  ++     E +    ++ G +P   + W+ NG+ L++SD +++   G+ T+ + I   K   +G   A+A N  G
Sbjct: 1938 EFRCSIDTTMFGSGTVSVVASNAAGSVETKTELKVLETPKETKKPEFTDKLRDMEVTK--GDTVQMDV--IALHSPLYKWYQNGNLLEDGKNGVTIKN-EENKSSLIIPNAQDSGKITVEAS-NEVGSSESSAQLTVNPPSTTPIVVDGPKSVTIKETETAEFKATISGFPA-PTVKWTI-------NEKIVEESRTITTIKTEDVYT-------LKISNAKIEQTGTVKVTAQNSAGQDSKQADLKVEPNVKA------PKFKSQLTDKVADE-GEPLRWNLELDGPSPGTEVSWLLNGQPLTKSDTVQVVDHGDGTYHVTIAEAKPEMSGTLTAKAKNAAG 2252          

HSP 15 Score: 51.9878 bits (123), Expect = 5.879e-6
Identity = 30/100 (30.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query: 4464 SPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEP-LIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSH-NKNH 4757
            +PP FVT   D+  KEGD +  +C + G+PEP L+W   +     +  F ++ +     L +++ Q  D+G Y++  +N  G     A + V +  +KNH
Sbjct:  646 APPAFVTKLRDKECKEGDVIDFECEVEGWPEPELVWLVDDQPLRPSHDFRLQYDGQTAKLEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPDKNH 745          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Celegans
Match: unc-89 (Muscle M-line assembly protein unc-89 [Source:UniProtKB/Swiss-Prot;Acc:O01761])

HSP 1 Score: 125.561 bits (314), Expect = 3.492e-28
Identity = 169/772 (21.89%), Postives = 291/772 (37.69%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTF---AANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK-DVAKTHLEIG-----EKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA--------------------------VLKETGQTQ----------TTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGE-THELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            ++W+KD+  I    D   ++Q  +  G   + I++ R+ D G Y C  RN          +  + F   + ++ P+F++K         E L LK+ + G    P  +   ++ PIN+++S   ++K   +       +    +DVG Y  + +++   AKT   +      E P FV          G    + + ++   K  P+ + W K+  P+  +         +NG     I     A  G YTCQ +N+ G+D    +L   +     QT   V  KP+    L + +     GD++ L+ +   +    + + K++QP+      +Q+   E+    L I  A   D G Y+                           V  E+GQ +          T   + +  + AP   +  +S    +     + C V   P    I W+ +       + +  +AR +  +K    LT       L FDNVT +D GEY    EN  G +    PI V      +    +P F+Q +   +++ + E  ++  K+SG P P +KW KNGEEL  SD +KI  + + T  L + N K  D   Y  +ASN  G   S   L V +P                                                +  P F    +   VKE +    +C + G    + W+   T    + R   +   D    L++++ +  D G Y I   N +G+A     + V
Sbjct: 2369 VEWFKDDTPI--SIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRARN-----EAGEALTTANFGIIRDSIPPEFTQKLRPLEVREQETLDLKVTVIGTP-VPNVEWFKDDKPINIDNSHI-FAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAPLFVQGLKPYEVEQGKPAELVVRVEG--KPEPE-VKWFKDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEV--KPLFIEPLKETFAV--EGDTVVLECKVNKESHPQIKFFKNDQPVEIGQ-HMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPR-PKIKWTKE------GKEVEMSARVRAEHKDDGTLT-------LTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAVVT-VGETAVLEGKISGKPKPSVKWYKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEP-----------------------------------------------AQVAPGFFKELSAIQVKETETAKFECKVSGTKPDVKWFKDGTPLKEDKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTV 3061          

HSP 2 Score: 124.79 bits (312), Expect = 6.393e-28
Identity = 183/800 (22.88%), Postives = 306/800 (38.25%), Query Frame = 3
Query: 2481 VNAESSCPTRLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFS---EKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK--------DVAKTHLEIGE---KPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYIND--NGELVFEIPKFTQAHVGDYTCQVSNEFGED--VLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAV-LKETGQTQTT----------IVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGE-THELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTH-FINNPRFEMKRELDE--YFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYP 4781
            V+ E   P  L   +E +P++      I+WYK+ + + PD D     +   +SG+  + I + ++SD G Y   + N    +   S V +      + T    F    + T     + L+L+  + G    P  ++I+    + +        +V+ +       RS    D+GQY  RV++K        D   T  E GE   KP+FV       +L GD    ++ ++   K    T+ W  N  P+       +  ++D  +G     I    +   G   C   NE G D  V + Q  A     S   L      P  +  L D  +   VGD + ++    A+ +++V W KD + +       +I    +  C +KI     +D G Y  V + E GQ +T           + E    ++AP I    +         I + C V++ P   S+ W     DG P R    ++R  +  +     T       L  ++ T  D G Y     N+ G  +    + V    +   K+    F  K   ++ +   +   ++C V+G+P P +KW +NG+ L       I    + +  L +     SD GIY  +A N +G   ++    V   +G        EKP              D+                     PP+F+   +D  V  G+ + L+C + G P P + WS +    I + RFE   E  +  Y L +KN    D G Y   A N +G AT  + V +D    +  +  SQ P
Sbjct: 3931 VDVEEPQPVELKVKVEGIPKV------IKWYKNGQELKPDAD-GFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHVKSAKSSEPTSGANFLSPLKDTEVEEGDMLTLQCTIAG---EPFPEVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQY--RVTAKNEAGSATSDCKVTVTEQGEQPSKPKFVIPLKTGAALPGDKKEFNVKVRGLPK---PTLQWFLNGIPIKF---DDRITLDDMADGNYCLTIRDVREEDFGTLKCIAKNENGTDETVCEFQQGAGHDDGSRDDL---RYPPRFNVPLWDRRI--PVGDPMFIECHVDANPTAEVEWFKDGKKIE-HTAHTEIRNTVDGACRIKIIPFEESDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTVNGGQPIRLSCKVDAIPRA-SVVWY---KDGLPLRA---DSRTSIQYEEDGTAT-------LAINDSTEEDIGAYRCVATNAHGTINTSCSVNVKVPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHVQMALGKT------EKP------------KMDEG-------------------KPPKFILELSDMSVSLGNVIDLECKVTGLPNPSVKWSKDGGPLIEDSRFEWSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTASQPP 4655          

HSP 3 Score: 105.531 bits (262), Expect = 4.195e-22
Identity = 161/760 (21.18%), Postives = 288/760 (37.89%), Query Frame = 3
Query: 2559 DIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSS-KDVAKTHLEIGE-----KPEFVYH------QFKENSLLG---------------DSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQTQTTI-VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVM--IPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETH-ELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRELDEYF-LILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            D++W+KD++ +  D +    ++ N ++G   + +     +DAG+Y  +  N P+   +SS       S ++ T + +        N E  +L + + G    P  + + +  P+  + S    +KV  +       +   L+D G+Y  R ++    AKT            PEFV        + KE++ L                D   ISI   N H +  +T +                      G     I    Q  VG Y+C+  NE GE      L+ A   I   ++ P   + +   ++ +        +++ L V        +V W KD++P+N  +  I          +L I  A   D G Y      E G+ +TT  + +     AP+     +    +Q     +V  V   P    + W     DG P           + N+ + +  G      L   +   +D G+Y  +  N AG    +  + I   +  +   ++  P FI+ L KE  +   + V++ CKV+   +P +K+ KN + +    H+++  + + + +L I+N KK D G Y  +A N  G   +   L++            +E+ ++      E     +   D +S +           R  P+FV       V E    +LKC + G P P I W+     +  + R   + + D    L   N+ + D+G Y   AEN  G A     +IV
Sbjct: 2172 DVEWFKDDKPVSEDGNHE--MKKNPETGVFTLVVKQAATTDAGKYTAKASN-PAGTAESSAEAEVTQSLEKPTFVRELVTTEVKIN-ETATLSVTVKGVP-DPSVEWLKDGQPVQTDSSHV-IAKVEGSGSYSITIKDARLEDSGKYACRATNPAGEAKTEANFAVVKNLVPPEFVEKLSPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISI--DNVHVIQKQTAV----------------------GSFSLTINDARQGDVGIYSCRARNEAGE-----ALTTANFGIIRDSIPPEFTQKLRPLEVREQ-------ETLDLKVTVIGTPVPNVEWFKDDKPINIDNSHIFAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAPLFVQGLKPYEVEQGKPAELVVRVEGKPEPE-VKWF---KDGVP---------IAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEVKPLFIEPL-KETFAVEGDTVVLECKVNKESHPQIKFFKNDQPVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKI-------QFAAKVEEHVTDESGQLEEIGQFETVGDTASSK-------TDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIV 2861          

HSP 4 Score: 100.138 bits (248), Expect = 1.865e-20
Identity = 181/828 (21.86%), Postives = 298/828 (35.99%), Query Frame = 3
Query: 2559 DIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWC----EVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFS---EKTFAANTEPLSLKLVLDGFKYAPESDLIF--NNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYL-----------------FRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKN-------------FHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPV---SAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKC--SLKINGATVNDSGTYQAVLKETGQTQTT--------------IVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTT--------SDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTS-----------PKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLK-IRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLP 4802
            +++W+KD + I       I    N+  G  ++ I    ESD G Y C    E+    +       +L  V  +K+    PK +   E       +P+ L   +D     P + +++  + +P+  +  +    +      +  N  +   +D+G Y                   +V  ++V K     GE+P F        +  GDS  +   +                 +  P+T+I                   + +G     + + T +  G Y C+  N  G+   K Q +A   +   +T  P       P    +LSD  V  S+G+ I L+ +     +  V W KD  PL   D R + +  E SK    L+I  ATV+D GTY+ V      + TT              +    P +F   + D    +R  +   + + C V++ P    + +     DG+             I  P +++     +I L  D V T         D G Y +   N +G +      TV  L      + S           PK ++ L+  I  P  +   +RCK SG+P P +KW K+GE +     L+ I       ELV+ +  + DAG Y   A NT GS  + C + VI                          +P D +S I   +              P F T  T    K GD V  +C   G P P I W        ++ + +M+   D    LIL ++     G +   A N  G A+  A ++++        DR+     S+PLP
Sbjct: 4261 EVEWFKDGKKIEHTAHTEIR---NTVDGACRIKIIPFEESDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTVNGGQPIRLSCKVDAI---PRASVVWYKDGLPLRADSRTSIQYEEDGTATLAINDST--EEDIGAYRCVATNAHGTINTSCSVNVKVPKQEVKKE----GEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVI-----------------ETSPDGSCSLTVNESTMSDEGIYRCEAENAHGK--AKTQATAHVQMALGKTEKPKMDEGKPPKFILELSDMSV--SLGNVIDLECKVTGLPNPSVKWSKDGGPL-IEDSRFE-WSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTASQPPRFTLKMGD----VRTTEGQPLKLECKVDASPLPEMVWYK----DGA-------------IVTPSDRI-----QISLSPDGVATLLIPSCVYDDDGIYRVIATNPSGTAQDKGTATVKKLPRDSGARRSADRDVFDANKAPKLMEPLEN-IRIPEKQSFRLRCKFSGDPKPTIKWFKDGERVFPYGRLQLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVI----------------------RGDRKPRDIDSSIREGKA-------------PGFTTPLTIRRAKPGDSVTFECLPFGNPFPSIKWLKDGLELFSDEKIKMEAAADGTQRLILSDVTFLSEGYFRCVATNEHGTASTKAELVIEG-------DRT---IGSRPLP 4981          

HSP 5 Score: 90.8929 bits (224), Expect = 1.029e-17
Identity = 172/806 (21.34%), Postives = 306/806 (37.97%), Query Frame = 3
Query: 2490 ESSCPTRLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGT---VIPKFSE---KTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPI--------------------------NVNHSSCPWSKVS------SNEMIQFNHR--------SVSLKDVGQYLFRVSSKDVAKTHLEIGE-KPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFG----EDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQ--TQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGET-HELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDS 4742
            E   P  L   +E  P     + +++W+KD   I    D + +++   ++G   + I +   +D G+Y C+  N          + +  +S ++ T   V P F E   +TFA   + + L+  ++   + P+     N+ P+                          +V    C    V+      ++  IQF  +        S  L+++GQ+    +  D A +  + G   PEFV    +  ++     AI   +K   K  P+  I    +          +    D+G L       TQA  G+Y C+  NE+G    E  + + L  A  +       P   +P+  + +       +VG++  L+ +        V W K+ + L   D R++I   ++    L +  A ++D   Y+     E G   +  T+    P Q AP       +I+ K+  +    C V+   +   + W     DG+P   L  + R               QR  L  ++  T D G Y + V N AG ++  +P+TV      +        I+K   ++      K+++  +V G P  + KW K  E ++ S   KI +V E+ ++L I++ + SD G Y    S  + S         ++   +V  TK  EK IS                                    P F     D+ V +G  +VL+  + G P+ + W+  N   I + + E      +Y L + + Q+ D G YS+TA N +G     A V V +
Sbjct: 2546 EQGKPAELVVRVEGKP-----EPEVKWFKDGVPIA--IDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEVKPLFIEPLKETFAVEGDTVVLECKVNKESH-PQIKFFKNDQPVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFE---TVGDTASSKTDTGRGAPEFV-ELLRSCTVTEKQQAI---LKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGE---APDFLQPVKPAVV-------TVGETAVLEGKISGKPKPSVKWYKNGEELKPSD-RVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEPAQVAPGFFKELSAIQVKETETAKFECKVSG--TKPDVKWF---KDGTP---LKEDKRVH-----FESTDDGTQR--LVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTVVPSETLK--------IKKGLTDVNVTQGTKILLSVEVEGKPKTV-KWYKGTETVTSSQTTKIVQVTESEYKLEIESAEMSDTGAYRVVLSTDSFS---------VESSATVTVTKAAEK-ISL-----------------------------------PSFKKGLADQSVPKGTPLVLEVEIEGKPKDVKWYK-NGDEIKDGKVEDLGN-GKYRLTIPDFQEKDVGEYSVTAANEAGEIESKAKVNVSA 3254          

HSP 6 Score: 84.3445 bits (207), Expect = 1.122e-15
Identity = 118/484 (24.38%), Postives = 189/484 (39.05%), Query Frame = 3
Query: 3444 SIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSI---------------RAKQNGSINIVCV--VNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAA--------LAE--AQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGET-----HELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYN-THFINNPRFEMKR-ELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV-----DSHNKNHSIDRSQY 4778
            S +L  +F  D    + W KD + +     R+Q+    +  C L ++ AT  D+G Y+ V + T  +  T  ++N I+     +D   SI               RAK   S+   C+   N +P   SI W     DG     L ++ + KM            QR  L   +VT    G +     N  G +S    + +          L E   + ++  P+  + L    I   N   ++ C  +G P P +KW K+G+E+   D    ++V  T     H LVI N    D G Y  +A+N  GS  ++  L +I P                      R+    D       +R  M F       PP FV    ++ V      +  C ++G+P P + W +N    +   R +++      + LI+ +    D+G Y  TA+NS G A+ SA++ V     DS   N  ID + Y
Sbjct: 4785 SFRLRCKFSGDPKPTIKWFKDGERVFPYG-RLQLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVIRGDRKPRDIDSSIREGKAPGFTTPLTIRRAKPGDSVTFECLPFGNPFP---SIKWL---KDG---LELFSDEKIKM-----EAAADGTQR--LILSDVTFLSEGYFRCVATNEHGTASTKAELVIEGDRTIGSRPLPEVNGEPEECKPRIRRGLYNMSIHEGNVVEMIVC-ATGIPTPTVKWYKDGQEIV-GDGPDGKRVIFTDERGIHHLVIVNASPDDEGEYSLEATNKLGSAKTEGSLNIIRP----------------------RHIADAD-------ERGGMPF-------PPGFVRQLKNKHVFNHMPTIFDCLVVGHPAPEVEWFHNGKKIVPGGRIKIQSCGGGSHALIILDTTLEDAGEYVATAKNSHGSASSSAVLDVTVPFLDSIKFNGEIDVTPY 5213          

HSP 7 Score: 78.1814 bits (191), Expect = 6.738e-14
Identity = 161/764 (21.07%), Postives = 298/764 (39.01%), Query Frame = 3
Query: 2544 DKDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNN---MPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK-DVAKTHLEIGEKPEFVYHQ-FKENSLL-GDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDV----LKLQLSAAEALISSQTLIPVSAKPISS--SQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQN-----GSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLD--KEIISPINEKVIVRCKVSGNPNPILKWMKNGEELS-ESDHLKIRKVGETHE--LVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEP-LIWWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHS 4760
            +K   +I+WYK+ + I P    +     +    K ++ I +  + DA +Y   + +       SS  L      K+  +I    ++  +  + P+ L++   G   +P++   + N   +P      +    K+  N+ +     SV ++D G Y   V+++   A +  +I  +P+  + +  K+ S+  G++   S+         P+ + W             +   I  N   + E    T+     Y   + N   +D     + L+ +A EA  S+Q  +  +   +      L D  V  + G  +  +V+   +   DV WL+D   +++    I I   +++   L I  A + D+G Y   V+ E+G+ ++             + + P+ +R  +N     G  ++  V  S P    + W     +  P  +L      K I           ++ EL  +     DG +Y + + N+AG       +TV            P  ++ +D  K++     + V ++ KV G P  ++KW KNG+EL  ++D  K  +  E+ E  L I + KKSD G Y     N  G   S   + V     S  +++P                                        S   F++   D  V+EGD + L+C + G P P +IW         + R  M+  LD    L +++ +K D G+Y +TA+N +G AT    V V    +  S
Sbjct: 3469 NKKPKEIKWYKNGKEITPSDKAQ---PGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEPKIIKGLEDQVVSIGS-PIKLEIETSG---SPKTVKWYKNGKELP-GAAAKTIKIQKIDDNKYVLEIPSSV-VEDTGDYKVEVANEAGSANSSGKITVEPKITFLKPLKDQSITEGENAEFSVETNT----KPRIVKW-----------YKNGQEIKPNSRFIIEQKTDTK-----YQLVIKNAVRDDADTYKIVLENTAGEAESSAQLTVKKAKAGLCKIVKGLEDQVV--AKGAKMVFEVKIQGE-PEDVRWLRDANVISAGANAI-IEKIDDTTYRLIIPSADLKDAGEYTVEVINESGKAKS--------DAKGEVDEKPEIVRGLENIEIPEGDDDVFKVEVSAP-VRQVKWYKNDQEIKPNSHL----EAKKIGP---------KKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVV----------KPNVLKIVDGLKDVDVEEPQPVELKVKVEGIPK-VIKWYKNGQELKPDADGFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHV----KSAKSSEPT---------------------------------------SGANFLSPLKDTEVEEGDMLTLQCTIAGEPFPEVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVTVTEQGEQPS 4123          

HSP 8 Score: 76.6406 bits (187), Expect = 2.333e-13
Identity = 167/786 (21.25%), Postives = 295/786 (37.53%), Query Frame = 3
Query: 2559 DIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSS------KDVAKTHLEIGEK---PEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKL-DKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETH-ELVIKNCKKSDAGIYEAQASNTNGSEV-SKCHLQVIDPIGSVNTTKPLE-------KPISFTI-----------------IP-----TERYQPADDNS------------------DISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            D++W+KD   +  D   R+  + ++  G  ++ I++ +  D G Y  EV N   V   +S V L+V   +   +    ++      T+ L L + ++G    P++   +       +  +    +V+ +E  +    S  + D G Y   +S+           T  +  EK   P F      ++   G  L + + ++      PK + W KN   +       K     NG+    IP F +  VG+Y+   +NE GE             I S+  + VSAKP   S L    V    G++   +V+    V   V W K+ + +    P  +     +   SL+I  A V D+  Y+ V+        +   +  ++ A   +D     + K      ++          + N  +K     P + +      K I     K  G+     L   N    D  +Y + V N AG +     +TV     A         ++ L D E+  P  +K +++ + +  P  I KW KNG+E++ SD  +    G+   +LVI +    DA  Y+   ++ +G+   S C L V  P       K LE        PI   I                 +P     T + Q  DDN                   ++++   +        V     F+    D+ + EG++          P  + W+        N RF ++++ D +Y L++KN  + D+  Y I  EN++G A  SA + V
Sbjct: 3001 DVKWFKDGTPLKED--KRVHFE-STDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVA--NSKVPLTVVPSETLKIKKGLTDVNVTQGTKIL-LSVEVEG---KPKTVKWYKGTETVTSSQTTKIVQVTESEY-KLEIESAEMSDTGAYRVVLSTDSFSVESSATVTVTKAAEKISLPSFKKGLADQSVPKGTPLVLEVEIEG----KPKDVKWYKNGDEIK----DGKVEDLGNGKYRLTIPDFQEKDVGEYSVTAANEAGE-------------IESKAKVNVSAKPEIVSGLVPTTV--KQGETATFNVKVKGPVKG-VKWYKNGKEI----PDAKTKDNGDGSYSLEIPNAQVEDAADYKVVVSNDAGDADSSAALT-VKLADDGKD-----KVKPEIVSGLIPTTVKQGETATFNVKVK----GPVKQVKWYKNGKEIPNAKAKDNGDGS-YSLEIPNAQLDDTADYKVVVSNDAGDADSSAALTVKLPGIA--------IVKGLEDAEV--PKGKKAVLQVETNKKPKEI-KWYKNGKEITPSDKAQPGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEPKIIKGLEDQVVSIGSPIKLEIETSGSPKTVKWYKNGKELPGAAAKTIKIQKIDDNKYVLEIPSSVVEDTGDYKVEVANEAGSANSSGKITVEPKITFLKPLKDQSITEGENAEFSVETNTKPRIVKWYKNGQEIKPNSRFIIEQKTDTKYQLVIKNAVRDDADTYKIVLENTAGEAESSAQLTV 3726          

HSP 9 Score: 72.0182 bits (175), Expect = 6.104e-12
Identity = 127/583 (21.78%), Postives = 214/583 (36.71%), Query Frame = 3
Query: 3048 GEKPEFVYHQFKENSLLGDSLAISIPMK-------NFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQF--APVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPI----NEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRK---VGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVI-DPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN--NPRFEMKRE-LDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            GE P F      +   +G+ L +S  +K       +F+  S  T +  K  +         +T  N +  +V  I + T+  +  Y    +N  G        + + + I+++   PV  + +  + + +        + IK++V+     + DV W KD++P++          PE    +L +  A   D+G Y A       T  +  E    Q    P       +   K N +  +   V   P   S+ W     DG P +   ++   K+       +T    R+E         D G+Y  R  N AG +      T A  A  +N    P+F++KL     SP+     E   +  KV G P P ++W K+   +S  +   I+K   VG +  L I + ++ D GIY  +A N  G  ++  +  +I D I                                                 PP+F        V+E + + LK  +IG P P + W  +   IN  N     K E    + L +K  +  D G Y+  A N +G A  +A + V
Sbjct: 2038 GEAPVFTKELQNKELSIGEKLVLSCSVKGSPQPHVDFYSFSETTKVETKITSSSRIAIEHDQT--NTHWRMV--ISQITKEDIVSYKAIATNSIG-------TATSTSKITTKVEAPVFEQGLKKTSVKEK-------EEIKMEVKV-GGSAPDVEWFKDDKPVSEDGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEAEVTQSLEKPTFVRELVTTEVKINETATLSVTVKGVPD-PSVEWL---KDGQPVQTDSSHVIAKVEGSGSYSITIKDARLE---------DSGKYACRATNPAGEAK-----TEANFAVVKN-LVPPEFVEKL-----SPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISIDNVHVIQKQTAVG-SFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSI-------------------------------------------------PPEFTQKLRPLEVREQETLDLKVTVIGTPVPNVEWFKDDKPINIDNSHIFAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAV 2527          

HSP 10 Score: 67.0106 bits (162), Expect = 1.679e-10
Identity = 121/528 (22.92%), Postives = 207/528 (39.20%), Query Frame = 3
Query: 3207 HKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN-SRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK-ETGQTQTT---IVEINPIQ--FAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINK-PLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGET--HELVIKNCK--KSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN--NPRFEMKRELDEYFLILKNIQKGDSGRYSIT----AENSSGLATCSALVIV 4736
            H  Y +++G     I        G YTC  +NE+G+       ++  A      +   +A P   ++L D       GD I  + E       ++VWL D+QPL  S D R+Q Y  + +K  L+I  A  +D+G Y   ++ E G  ++     V+ +P +   AP  Q   + +   +   +    V+   P+   I W I   +G P   L  + + K I++  +  LT  ++ +  +FD + T  G    L   +  G   V +P               P F + L+ + +      V+    VSG P P L +   G+EL   +   +  VG    + + I N    K D  I  A+A N +G+  S+  L V                           +  ++ S                 RS P F+    D+ VK G+  V +  + G P P + W  N H ++  +P  +++    ++ L +      DS +Y+ T    AEN+ G     A ++V
Sbjct:  121 HTFYSDEDGFFAMTIDPVQVTDTGRYTCMATNEYGQ-------ASTSAFFRVLKVEKEAAPPAFVTKLRDKEC--KEGDVIDFECEVEGWPEPELVWLVDDQPLRPSHDFRLQ-YDGQTAK--LEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPDKNHVAPEFQATIEYVECDEGEEVRFKSVITGDPNPEII-WFI---NGKP---LSESEKVKFISEDGICILT--IKDVTRHFDGMVTCQGSNR-LGSASCDGRLKVRVP------------PAPPTFNKPLEDKTVQE-KSTVVFEVDVSGWPEPTLTFTLCGKELKNGEE-GVEIVGHDGFYRISIPNTSMDKHDGEIV-AKAQNEHGTAESRARLTV---------------------------EQEEEES-----------------RSAPTFLKDIEDQTVKTGEFAVFETTVRGNPNPEVTWFINGHKMDQGSPGVKIEAHNHDHKLTI------DSAQYAGTVLCRAENAVGRFETKARLVV 561          

HSP 11 Score: 66.2402 bits (160), Expect = 2.970e-10
Identity = 72/297 (24.24%), Postives = 119/297 (40.07%), Query Frame = 3
Query: 3486 DVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVL-KETGQTQTTIV--------EINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE 4349
            D+ W KD+  L+  D R   Y  E+   ++ I+   V D+G Y  +   E GQ  T+          E  P  F   ++D       K+   I+  C V  +P    + W +      P+ +               +L  + Q  +L   +    D G Y ++++N  G  S+     +   A+      +P+F Q   + +     E+V  +  ++G+PNP + W  NG+ LSES+ +K         L IK+  +   G+   Q SN  GS      L+V  P       KPLE
Sbjct:  105 DITWYKDDVQLH-EDERHTFYSDEDGFFAMTIDPVQVTDTGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRD----KECKEGDVIDFECEVEGWPEPELV-WLVDDQPLRPSHDF--------------RLQYDGQTAKLEIRDAQPDDTGVYTVKIQNEFG--SIESKAELFVQADPDKNHVAPEF-QATIEYVECDEGEEVRFKSVITGDPNPEIIWFINGKPLSESEKVKFISEDGICILTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPPAPPTFNKPLE 378          

HSP 12 Score: 64.3142 bits (155), Expect = 1.166e-9
Identity = 108/507 (21.30%), Postives = 197/507 (38.86%), Query Frame = 3
Query: 3282 YTCQVSNEFGEDVLKLQLSA--AEALISSQTLIPVS---AKPISSSQLSDNYVTGSVGDSIKLDVEFPA-DVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK-ETGQTQTTI-VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVN--TTKPLEKPISFTIIPTE-----RYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYN------THFINNPRFEMKREL--DEYFLILKNIQKGDSGRYSITAENSSGLATCSALV 4730
            YT ++SN   E    ++++A  +    S Q  + V      P   SQL+D       G+ ++ ++E       ++V WL + QPL   D  +Q+    +    + I  A    SGT  A  K   G+ +T+  V +N     P     PQ+       S+    +V   P   ++ W +        + L+ +   K+      K      +  +          G   +  EN +G       +   A  +   K   PKF   +D   +    E V     V G P P + W  NGE +S+  ++ +      H + I       AG    +A+N  GS+     L V     +    T + +E     TI  +E     +Y    +N++ +S  +T+     T+    P F     ++ +  G+ +VL C + G P+P + ++S++      T   ++ R  ++ +     + +++  I K D   Y   A NS G AT ++ +
Sbjct: 1657 YTLKISNAKIEQTGTVKVTAQNSAGQDSKQADLKVEPNVKAPKFKSQLTDK--VADEGEPLRWNLELDGPSPGTEVSWLLNGQPLTKSD-TVQVVDHGDGTYHVTIAEAKPEMSGTLTAKAKNAAGECETSAKVTVNGGNKKPEFVQAPQNHETTLEESVKFSAIVTGKP-MPNVTWYLN------NKKLIQSEEVKV------KYVHETGKTSIRIQKPLMEHNGTIRVEAENVSG------KVQATAQLKVDKKTEVPKFTTNMDDRQVKE-GEDVKFTANVEGYPEPSVAWTLNGEPVSKHPNITVTDKDGEHTIEISAVTPEQAGELSCEATNPVGSKKRDVQLAVKKKTITQESITVESVEGVERVTITSSELSHQGKYTCIAENTEGTS--KTEAFL--TVQGEAPVFTKELQNKELSIGEKLVLSCSVKGSPQPHVDFYSFSETTKVETKITSSSRIAIEHDQTNTHWRMVISQITKEDIVSYKAIATNSIGTATSTSKI 2136          

HSP 13 Score: 60.4622 bits (145), Expect = 1.938e-8
Identity = 73/314 (23.25%), Postives = 123/314 (39.17%), Query Frame = 3
Query: 3891 RIELY-FDNVTTSDGGEYC----LRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKL-DKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRY---------SITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSN 4787
            +IE +  D+  T D  +Y      R EN+ G       + V A    + +K  PKF++ L DK     ++  V+   +V G P P + W   GEEL +SD ++IR+   + ++ IKN K  DAG   A A+N+ GS+ +K  L V             +KP +                                    P+F        V++G + V      G P P   WS N   + + +   +   DE  +   +I   D+  Y         S+ AEN+ G     A + ++   ++  +++    S+
Sbjct:  521 KIEAHNHDHKLTIDSAQYAGTVLCRAENAVGRFETKARLVVLA---PEKQKKPPKFVEILVDK--TETVDNTVVFEVRVEGEPKPTVTWYLKGEELKQSDRVEIREFDGSIKISIKNIKIEDAGEIRAVATNSEGSDETKAKLTV------------QKKPFA------------------------------------PEFDLRPVSLTVEKGSEAVFSAHAFGIPLPTYEWSVNGRKVRDGQEGARVTRDESTVDGASILTIDTATYYSEVNHLTISVVAENTLGAEETGAQLTIEPKKESVVVEKQDLSSS 781          

HSP 14 Score: 57.3806 bits (137), Expect = 1.464e-7
Identity = 82/345 (23.77%), Postives = 150/345 (43.48%), Query Frame = 3
Query: 3279 DYTCQV-SNEFGEDVLKLQLSAAEALISSQTLIPV------SAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSG--TYQAVLKETGQTQTTI-VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSG-NPNPILKWMKNGEELSESDHLKIRKVGE-THELVIKNCKKSDAGIYEAQASNTNG 4277
            ++ C + +  FG   + +  S A   + ++T + V      + KP  + +L D  VT   GD++++DV   A  S    W ++   L      + I   EE+K SL I  A   DSG  T +A   E G ++++  + +NP    P++ D P+S+  K+  +      ++ +P+  ++ W+I          +V  +R     K  +  T       L   N      G   +  +NSAG  S    + V    +A      PKF  +L  ++     E +    ++ G +P   + W+ NG+ L++SD +++   G+ T+ + I   K   +G   A+A N  G
Sbjct: 1465 EFRCSIDTTMFGSGTVSVVASNAAGSVETKTELKVLETPKETKKPEFTDKLRDMEVTK--GDTVQMDV--IALHSPLYKWYQNGNLLEDGKNGVTIKN-EENKSSLIIPNA--QDSGKITVEAS-NEVGSSESSAQLTVNPPSTTPIVVDGPKSVTIKETETAEFKATISGFPA-PTVKWTI-------NEKIVEESRTITTIKTEDVYT-------LKISNAKIEQTGTVKVTAQNSAGQDSKQADLKVEPNVKA------PKFKSQLTDKVADE-GEPLRWNLELDGPSPGTEVSWLLNGQPLTKSDTVQVVDHGDGTYHVTIAEAKPEMSGTLTAKAKNAAG 1779          

HSP 15 Score: 51.9878 bits (123), Expect = 6.068e-6
Identity = 30/100 (30.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query: 4464 SPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEP-LIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSH-NKNH 4757
            +PP FVT   D+  KEGD +  +C + G+PEP L+W   +     +  F ++ +     L +++ Q  D+G Y++  +N  G     A + V +  +KNH
Sbjct:  173 APPAFVTKLRDKECKEGDVIDFECEVEGWPEPELVWLVDDQPLRPSHDFRLQYDGQTAKLEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPDKNH 272          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Celegans
Match: unc-89 (Muscle M-line assembly protein unc-89 [Source:UniProtKB/Swiss-Prot;Acc:O01761])

HSP 1 Score: 125.176 bits (313), Expect = 4.451e-28
Identity = 183/800 (22.88%), Postives = 306/800 (38.25%), Query Frame = 3
Query: 2481 VNAESSCPTRLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFS---EKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK--------DVAKTHLEIGE---KPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYIND--NGELVFEIPKFTQAHVGDYTCQVSNEFGED--VLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAV-LKETGQTQTT----------IVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGE-THELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTH-FINNPRFEMKRELDE--YFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYP 4781
            V+ E   P  L   +E +P++      I+WYK+ + + PD D     +   +SG+  + I + ++SD G Y   + N    +   S V +      + T    F    + T     + L+L+  + G    P  ++I+    + +        +V+ +       RS    D+GQY  RV++K        D   T  E GE   KP+FV       +L GD    ++ ++   K    T+ W  N  P+       +  ++D  +G     I    +   G   C   NE G D  V + Q  A     S   L      P  +  L D  +   VGD + ++    A+ +++V W KD + +       +I    +  C +KI     +D G Y  V + E GQ +T           + E    ++AP I    +         I + C V++ P   S+ W     DG P R    ++R  +  +     T       L  ++ T  D G Y     N+ G  +    + V    +   K+    F  K   ++ +   +   ++C V+G+P P +KW +NG+ L       I    + +  L +     SD GIY  +A N +G   ++    V   +G        EKP              D+                     PP+F+   +D  V  G+ + L+C + G P P + WS +    I + RFE   E  +  Y L +KN    D G Y   A N +G AT  + V +D    +  +  SQ P
Sbjct: 3864 VDVEEPQPVELKVKVEGIPKV------IKWYKNGQELKPDAD-GFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHVKSAKSSEPTSGANFLSPLKDTEVEEGDMLTLQCTIAG---EPFPEVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQY--RVTAKNEAGSATSDCKVTVTEQGEQPSKPKFVIPLKTGAALPGDKKEFNVKVRGLPK---PTLQWFLNGIPIKF---DDRITLDDMADGNYCLTIRDVREEDFGTLKCIAKNENGTDETVCEFQQGAGHDDGSRDDL---RYPPRFNVPLWDRRI--PVGDPMFIECHVDANPTAEVEWFKDGKKIE-HTAHTEIRNTVDGACRIKIIPFEESDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTVNGGQPIRLSCKVDAIPRA-SVVWY---KDGLPLRA---DSRTSIQYEEDGTAT-------LAINDSTEEDIGAYRCVATNAHGTINTSCSVNVKVPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHVQMALGKT------EKP------------KMDEG-------------------KPPKFILELSDMSVSLGNVIDLECKVTGLPNPSVKWSKDGGPLIEDSRFEWSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTASQPP 4588          

HSP 2 Score: 124.405 bits (311), Expect = 7.125e-28
Identity = 168/764 (21.99%), Postives = 289/764 (37.83%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTF---AANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK-DVAKTHLEIG-----EKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA--------------------------VLKETGQTQ----------TTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGE-THELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLA 4712
            ++W+KD+  I    D   ++Q  +  G   + I++ R+ D G Y C  RN          +  + F   + ++ P+F++K         E L LK+ + G    P  +   ++ PIN+++S   ++K   +       +    +DVG Y  + +++   AKT   +      E P FV          G    + + ++   K  P+ + W K+  P+  +         +NG     I     A  G YTCQ +N+ G+D    +L   +     QT   V  KP+    L + +     GD++ L+ +   +    + + K++QP+      +Q+   E+    L I  A   D G Y+                           V  E+GQ +          T   + +  + AP   +  +S    +     + C V   P    I W+ +       + +  +AR +  +K    LT       L FDNVT +D GEY    EN  G +    PI V      +    +P F+Q +   +++ + E  ++  K+SG P P +KW KNGEEL  SD +KI  + + T  L + N K  D   Y  +ASN  G   S   L V +P                                                +  P F    +   VKE +    +C + G    + W+   T    + R   +   D    L++++ +  D G Y I   N +G+A
Sbjct: 2302 VEWFKDDTPI--SIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRARN-----EAGEALTTANFGIIRDSIPPEFTQKLRPLEVREQETLDLKVTVIGTP-VPNVEWFKDDKPINIDNSHI-FAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAPLFVQGLKPYEVEQGKPAELVVRVEG--KPEPE-VKWFKDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEV--KPLFIEPLKETFAVE--GDTVVLECKVNKESHPQIKFFKNDQPVEIGQ-HMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPR-PKIKWTKE------GKEVEMSARVRAEHKDDGTLT-------LTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAVVT-VGETAVLEGKISGKPKPSVKWYKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEP-----------------------------------------------AQVAPGFFKELSAIQVKETETAKFECKVSGTKPDVKWFKDGTPLKEDKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVA 2986          

HSP 3 Score: 105.531 bits (262), Expect = 3.665e-22
Identity = 162/760 (21.32%), Postives = 289/760 (38.03%), Query Frame = 3
Query: 2559 DIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSS-KDVAKTHLEIGE-----KPEFVYH------QFKENSLLG---------------DSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQTQTTI-VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVM--IPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETH-ELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRELDEYF-LILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            D++W+KD++ +  D +    ++ N ++G   + +     +DAG+Y  +  N P+   +SS       S ++ T + +        N E  +L + + G    P  + + +  P+  + SS   +KV  +       +   L+D G+Y  R ++    AKT            PEFV        + KE++ L                D   ISI   N H +  +T +                      G     I    Q  VG Y+C+  NE GE      L+ A   I   ++ P   + +   ++ +        +++ L V        +V W KD++P+N  +  I          +L I  A   D G Y      E G+ +TT  + +     AP+     +    +Q     +V  V   P    + W     DG P           + N+ + +  G      L   +   +D G+Y  +  N AG    +  + I   +  +   ++  P FI+ L KE  +   + V++ CKV+   +P +K+ KN + +    H+++  + + + +L I+N KK D G Y  +A N  G   +   L++            +E+ ++      E     +   D +S +           R  P+FV       V E    +LKC + G P P I W+     +  + R   + + D    L   N+ + D+G Y   AEN  G A     +IV
Sbjct: 2105 DVEWFKDDKPVSEDGNHE--MKKNPETGVFTLVVKQAATTDAGKYTAKASN-PAGTAESSAEAEVTQSLEKPTFVRELVTTEVKIN-ETATLSVTVKGVP-DPSVEWLKDGQPVQTD-SSHVIAKVEGSGSYSITIKDARLEDSGKYACRATNPAGEAKTEANFAVVKNLVPPEFVEKLSPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISI--DNVHVIQKQTAV----------------------GSFSLTINDARQGDVGIYSCRARNEAGE-----ALTTANFGIIRDSIPPEFTQKLRPLEVREQ-------ETLDLKVTVIGTPVPNVEWFKDDKPINIDNSHIFAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAPLFVQGLKPYEVEQGKPAELVVRVEGKPEPE-VKWF---KDGVP---------IAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEVKPLFIEPL-KETFAVEGDTVVLECKVNKESHPQIKFFKNDQPVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKI-------QFAAKVEEHVTDESGQLEEIGQFETVGDTASSK-------TDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIV 2794          

HSP 4 Score: 100.138 bits (248), Expect = 1.630e-20
Identity = 181/828 (21.86%), Postives = 298/828 (35.99%), Query Frame = 3
Query: 2559 DIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWC----EVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFS---EKTFAANTEPLSLKLVLDGFKYAPESDLIF--NNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYL-----------------FRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKN-------------FHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPV---SAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKC--SLKINGATVNDSGTYQAVLKETGQTQTT--------------IVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTT--------SDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTS-----------PKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLK-IRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLP 4802
            +++W+KD + I       I    N+  G  ++ I    ESD G Y C    E+    +       +L  V  +K+    PK +   E       +P+ L   +D     P + +++  + +P+  +  +    +      +  N  +   +D+G Y                   +V  ++V K     GE+P F        +  GDS  +   +                 +  P+T+I                   + +G     + + T +  G Y C+  N  G+   K Q +A   +   +T  P       P    +LSD  V  S+G+ I L+ +     +  V W KD  PL   D R + +  E SK    L+I  ATV+D GTY+ V      + TT              +    P +F   + D    +R  +   + + C V++ P    + +     DG+             I  P +++     +I L  D V T         D G Y +   N +G +      TV  L      + S           PK ++ L+  I  P  +   +RCK SG+P P +KW K+GE +     L+ I       ELV+ +  + DAG Y   A NT GS  + C + VI                          +P D +S I   +              P F T  T    K GD V  +C   G P P I W        ++ + +M+   D    LIL ++     G +   A N  G A+  A ++++        DR+     S+PLP
Sbjct: 4194 EVEWFKDGKKIEHTAHTEIR---NTVDGACRIKIIPFEESDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTVNGGQPIRLSCKVDAI---PRASVVWYKDGLPLRADSRTSIQYEEDGTATLAINDSTE--EDIGAYRCVATNAHGTINTSCSVNVKVPKQEVKKE----GEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVI-----------------ETSPDGSCSLTVNESTMSDEGIYRCEAENAHGK--AKTQATAHVQMALGKTEKPKMDEGKPPKFILELSDMSV--SLGNVIDLECKVTGLPNPSVKWSKDGGPL-IEDSRFE-WSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTASQPPRFTLKMGD----VRTTEGQPLKLECKVDASPLPEMVWYK----DGA-------------IVTPSDRI-----QISLSPDGVATLLIPSCVYDDDGIYRVIATNPSGTAQDKGTATVKKLPRDSGARRSADRDVFDANKAPKLMEPLEN-IRIPEKQSFRLRCKFSGDPKPTIKWFKDGERVFPYGRLQLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVI----------------------RGDRKPRDIDSSIREGK-------------APGFTTPLTIRRAKPGDSVTFECLPFGNPFPSIKWLKDGLELFSDEKIKMEAAADGTQRLILSDVTFLSEGYFRCVATNEHGTASTKAELVIEG-------DRT---IGSRPLP 4914          

HSP 5 Score: 89.7373 bits (221), Expect = 2.567e-17
Identity = 168/787 (21.35%), Postives = 301/787 (38.25%), Query Frame = 3
Query: 2547 KDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGT---VIPKFSE---KTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPI--------------------------NVNHSSCPWSKVS------SNEMIQFNHR--------SVSLKDVGQYLFRVSSKDVAKTHLEIGE-KPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFG----EDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQ--TQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGET-HELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDS 4742
            K + +++W+KD   I    D + +++   ++G   + I +   +D G+Y C+  N          + +  +S ++ T   V P F E   +TFA   + + L+  ++   + P+     N+ P+                          +V    C    V+      ++  IQF  +        S  L+++GQ+    +  D A +  + G   PEFV    +  ++     AI   +K   K  P+  I    +          +    D+G L       TQA  G+Y C+  NE+G    E  + + L  A  +       P   +P+  + +       +VG++  L+ +        V W K+ + L   D R++I   ++    L +  A ++D   Y+     E G   +  T+    P Q AP       +I+ K+  +    C V+   +   + W     DG+P   L  + R               QR  L  ++  T D G Y + V N AG ++  +P+TV      +        I+K   ++      K+++  +V G P  + KW K  E ++ S   KI +V E+ ++L I++ + SD G Y    S  + S         ++   +V  TK  EK IS                                    P F     D+ V +G  +VL+  + G P+ + W+  N   I + + E      +Y L + + Q+ D G YS+TA N +G     A V V +
Sbjct: 2493 KPEPEVKWFKDGVPIA--IDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEVKPLFIEPLKETFAVEGDTVVLECKVNKESH-PQIKFFKNDQPVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFE---TVGDTASSKTDTGRGAPEFV-ELLRSCTVTEKQQAI---LKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEA---PDFLQPVKPAVV-------TVGETAVLEGKISGKPKPSVKWYKNGEELKPSD-RVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEPAQVAPGFFKELSAIQVKETETAKFECKVSG--TKPDVKWF---KDGTP---LKEDKRVH-----FESTDDGTQR--LVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTVVPSETLK--------IKKGLTDVNVTQGTKILLSVEVEGKPKTV-KWYKGTETVTSSQTTKIVQVTESEYKLEIESAEMSDTGAYRVVLSTDSFS---------VESSATVTVTKAAEK-ISL-----------------------------------PSFKKGLADQSVPKGTPLVLEVEIEGKPKDVKWYK-NGDEIKDGKVEDLGN-GKYRLTIPDFQEKDVGEYSVTAANEAGEIESKAKVNVSA 3187          

HSP 6 Score: 85.1149 bits (209), Expect = 6.076e-16
Identity = 117/484 (24.17%), Postives = 189/484 (39.05%), Query Frame = 3
Query: 3444 SIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSI---------------RAKQNGSINIVCV--VNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAA--------LAE--AQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGET-----HELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNT-HFINNPRFEMKR-ELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALV-----IVDSHNKNHSIDRSQY 4778
            S +L  +F  D    + W KD + +     R+Q+    +  C L ++ AT  D+G Y+ V + T  +  T  ++N I+     +D   SI               RAK   S+   C+   N +P   SI W     DG     L ++ + KM            QR  L   +VT    G +     N  G +S    + +          L E   + ++  P+  + L    I   N   ++ C  +G P P +KW K+G+E+   D    ++V  T     H LVI N    D G Y  +A+N  GS  ++  L +I P                      R+    D       +R  M F       PP FV    ++ V      +  C ++G+P P + W +N    +   R +++      + LI+ +    D+G Y  TA+NS G A+ SA++      +DS   N  ID + Y
Sbjct: 4718 SFRLRCKFSGDPKPTIKWFKDGERVFPYG-RLQLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVIRGDRKPRDIDSSIREGKAPGFTTPLTIRRAKPGDSVTFECLPFGNPFP---SIKWL---KDG---LELFSDEKIKM-----EAAADGTQR--LILSDVTFLSEGYFRCVATNEHGTASTKAELVIEGDRTIGSRPLPEVNGEPEECKPRIRRGLYNMSIHEGNVVEMIVC-ATGIPTPTVKWYKDGQEIV-GDGPDGKRVIFTDERGIHHLVIVNASPDDEGEYSLEATNKLGSAKTEGSLNIIRP----------------------RHIADAD-------ERGGMPF-------PPGFVRQLKNKHVFNHMPTIFDCLVVGHPAPEVEWFHNGKKIVPGGRIKIQSCGGGSHALIILDTTLEDAGEYVATAKNSHGSASSSAVLDVTVPFLDSIKFNGEIDVTPY 5146          

HSP 7 Score: 77.0258 bits (188), Expect = 1.520e-13
Identity = 162/758 (21.37%), Postives = 296/758 (39.05%), Query Frame = 3
Query: 2559 DIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNN---MPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK-DVAKTHLEIGEKPEFVYHQ-FKENSLL-GDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDV----LKLQLSAAEALISSQTLIPVSAKPISS--SQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQN-----GSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKL-DKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELS-ESDHLKIRKVGETHE--LVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEP-LIWWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHS 4760
            +I+WYK+ + I P    +     +    K ++ I +  + DA +Y   + +       SS  L      K+  +I    ++  +  + P+ L++   G   +P++   + N   +P      +    K+  N+ +     SV ++D G Y   V+++   A +  +I  +P+  + +  K+ S+  G++   S+         P+ + W             +   I  N   + E    T+     Y   + N   +D     + L+ +A EA  S+Q  +  +   +      L D  V  + G  +  +V+   +   DV WL+D   +++    I I   +++   L I  A + D+G Y   V+ E+G+ ++             + + P+ +R  +N     G  ++  V  S P    + W     +  P  +L      K I           ++ EL  +     DG +Y + + N+AG       +TV        K    K +  L D ++  P  + V ++ KV G P  ++KW KNG+EL  ++D  K  +  E+ E  L I + KKSD G Y     N  G   S   + V     S  +++P                                        S   F++   D  V+EGD + L+C + G P P +IW         + R  M+  LD    L +++ +K D G+Y +TA+N +G AT    V V    +  S
Sbjct: 3407 EIKWYKNGKEITPSDKAQ---PGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEPKIIKGLEDQVVSIGS-PIKLEIETSG---SPKTVKWYKNGKELP-GAAAKTIKIQKIDDNKYVLEIPSSV-VEDTGDYKVEVANEAGSANSSGKITVEPKITFLKPLKDQSITEGENAEFSVETNT----KPRIVKW-----------YKNGQEIKPNSRFIIEQKTDTK-----YQLVIKNAVRDDADTYKIVLENTAGEAESSAQLTVKKAKAGLCKIVKGLEDQVV--AKGAKMVFEVKIQGE-PEDVRWLRDANVISAGANAI-IEKIDDTTYRLIIPSADLKDAGEYTVEVINESGKAKS--------DAKGEVDEKPEIVRGLENIEIPEGDDDVFKVEVSAP-VRQVKWYKNDQEIKPNSHL----EAKKIGP---------KKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVV-------KPNVLKIVDGLKDVDVEEP--QPVELKVKVEGIPK-VIKWYKNGQELKPDADGFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHV----KSAKSSEPT---------------------------------------SGANFLSPLKDTEVEEGDMLTLQCTIAGEPFPEVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVTVTEQGEQPS 4056          

HSP 8 Score: 76.6406 bits (187), Expect = 2.473e-13
Identity = 167/756 (22.09%), Postives = 280/756 (37.04%), Query Frame = 3
Query: 2565 QWYKDNEAILPDCDPRILLQCNSQ-SGKM--KMHIDNCRESDAGQYWCEVRN--GPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYA---PESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQY-LFRVSSKDVAKTHLEI---GEKPEFVYHQFKENSLLGDSLAISIPMK-------NFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQF--APVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPI----NEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRK---VGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVI-DPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN--NPRFEMKRE-LDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +W KD + I  +   RI +Q  +   G +  ++ +DN    DAG+Y C V N  G      +  V+ S   +K     P+F        T   S K+VL+        P+   + +N  I     S     V   E +     S  L   G+Y     +++  +KT   +   GE P F      +   +G+ L +S  +K       +F+  S  T +  K  +         +T  N +  +V  I + T+  +  Y    +N  G        + + + I+++   PV  + +  + + +        + IK++V+     + DV W KD++P++          PE    +L +  A   D+G Y A       T  +  E    Q    P       +   K N +  +   V   P   S+ W     DG P +   ++   K+       +T    R+E         D G+Y  R  N AG +      T A  A  +N    P+F++KL     SP+     E   +  KV G P P ++W K+   +S  +   I+K   VG +  L I + ++ D GIY  +A N  G  ++  +  +I D I                                                 PP+F        V+E + + LK  +IG P P + W  +   IN  N     K E    + L +K  +  D G Y+  A N +G A  +A + V
Sbjct: 1806 KWLKDGKEI--ELIARIRVQTRTGPEGHITQELVLDNVTPEDAGKYTCIVENTAGKDTCEATLTVIES-LEKKSEKKAPEFI-VALQDKTTKTSEKVVLECKVIGEPKPKVSWLHDNKTIT--QESITVESVEGVERVTIT--SSELSHQGKYTCIAENTEGTSKTEAFLTVQGEAPVFTKELQNKELSIGEKLVLSCSVKGSPQPHVDFYSFSETTKVETKITSSSRIAIEHDQT--NTHWRMV--ISQITKEDIVSYKAIATNSIG-------TATSTSKITTKVEAPVFEQGLKKTSVKEK-------EEIKMEVKVGGS-APDVEWFKDDKPVSEDGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEAEVTQSLEKPTFVRELVTTEVKINETATLSVTVKGVPD-PSVEWL---KDGQPVQTDSSHVIAKVEGSGSYSITIKDARLE---------DSGKYACRATNPAGEAK-----TEANFAVVKN-LVPPEFVEKL-----SPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISIDNVHVIQKQTAVG-SFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSI-------------------------------------------------PPEFTQKLRPLEVREQETLDLKVTVIGTPVPNVEWFKDDKPINIDNSHIFAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAV 2460          

HSP 9 Score: 74.7146 bits (182), Expect = 8.781e-13
Identity = 167/786 (21.25%), Postives = 295/786 (37.53%), Query Frame = 3
Query: 2559 DIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSS------KDVAKTHLEIGEK---PEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKL-DKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETH-ELVIKNCKKSDAGIYEAQASNTNGSEV-SKCHLQVIDPIGSVNTTKPLE-------KPISFTI-----------------IP-----TERYQPADDNS------------------DISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            D++W+KD   +  D   R+  + ++  G  ++ I++ +  D G Y  EV N   V   +S V L+V   +   +    ++      T+ L L + ++G    P++   +       +  +    +V+ +E  +    S  + D G Y   +S+           T  +  EK   P F      ++   G  L + + ++      PK + W KN   +       K     NG+    IP F +  VG+Y+   +NE GE             I S+  + VSAKP   S L    V    G++   +V+    V   V W K+ + +    P  +     +   SL+I  A V D+  Y+ V+        +   +  ++ A   +D     + K      ++          + N  +K     P + +      K I     K  G+     L   N    D  +Y + V N AG +     +TV     A         ++ L D E+  P  +K +++ + +  P  I KW KNG+E++ SD  +    G+   +LVI +    DA  Y+   ++ +G+   S C L V  P       K LE        PI   I                 +P     T + Q  DDN                   ++++   +        V     F+    D+ + EG++          P  + W+        N RF ++++ D +Y L++KN  + D+  Y I  EN++G A  SA + V
Sbjct: 2934 DVKWFKDGTPLKED--KRVHFE-STDDGTQRLVIEDSKTDDQGNYRIEVSNDAGV--ANSKVPLTVVPSETLKIKKGLTDVNVTQGTKIL-LSVEVEG---KPKTVKWYKGTETVTSSQTTKIVQVTESEY-KLEIESAEMSDTGAYRVVLSTDSFSVESSATVTVTKAAEKISLPSFKKGLADQSVPKGTPLVLEVEIEG----KPKDVKWYKNGDEIK----DGKVEDLGNGKYRLTIPDFQEKDVGEYSVTAANEAGE-------------IESKAKVNVSAKPEIVSGLVPTTV--KQGETATFNVKVKGPVKG-VKWYKNGKEI----PDAKTKDNGDGSYSLEIPNAQVEDAADYKVVVSNDAGDADSSAALT-VKLADDGKD-----KVKPEIVSGLIPTTVKQGETATFNVKVK----GPVKQVKWYKNGKEIPNAKAKDNGDGS-YSLEIPNAQLDDTADYKVVVSNDAGDADSSAALTVKLPGIA--------IVKGLEDAEV--PKGKKAVLQVETNKKPKEI-KWYKNGKEITPSDKAQPGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEPKIIKGLEDQVVSIGSPIKLEIETSGSPKTVKWYKNGKELPGAAAKTIKIQKIDDNKYVLEIPSSVVEDTGDYKVEVANEAGSANSSGKITVEPKITFLKPLKDQSITEGENAEFSVETNTKPRIVKWYKNGQEIKPNSRFIIEQKTDTKYQLVIKNAVRDDADTYKIVLENTAGEAESSAQLTV 3659          

HSP 10 Score: 67.781 bits (164), Expect = 1.190e-10
Identity = 119/524 (22.71%), Postives = 205/524 (39.12%), Query Frame = 3
Query: 3207 HKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN-SRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK-ETGQTQTT---IVEINPIQ--FAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINK-PLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGET--HELVIKNCK--KSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN--NPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            H  Y +++G     I        G YTC  +NE+G+       ++  A      +   +A P   ++L D       GD I  + E       ++VWL D+QPL  S D R+Q Y  + +K  L+I  A  +D+G Y   ++ E G  ++     V+ +P +   AP  Q   + +   +   +    V+   P+   I W I   +G P   L  + + K I++  +  LT  ++ +  +FD + T  G    L   +  G   V +P               P F + L+ + +      V+    VSG P P L +   G+EL   +   +  VG    + + I N    K D  I  A+A N +G+  S+  L V                           +  ++ S                 RS P F+    D+ VK G+  V +  + G P P + W  N H ++  +P  +++    ++ L + + Q   +G     AEN+ G     A ++V
Sbjct:  121 HTFYSDEDGFFAMTIDPVQVTDTGRYTCMATNEYGQ-------ASTSAFFRVLKVEKEAAPPAFVTKLRDKEC--KEGDVIDFECEVEGWPEPELVWLVDDQPLRPSHDFRLQ-YDGQTAK--LEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPDKNHVAPEFQATIEYVECDEGEEVRFKSVITGDPNPEII-WFI---NGKP---LSESEKVKFISEDGICILT--IKDVTRHFDGMVTCQGSNR-LGSASCDGRLKVRVP------------PAPPTFNKPLEDKTVQE-KSTVVFEVDVSGWPEPTLTFTLCGKELKNGEE-GVEIVGHDGFYRISIPNTSMDKHDGEIV-AKAQNEHGTAESRARLTV---------------------------EQEEEES-----------------RSAPTFLKDIEDQTVKTGEFAVFETTVRGNPNPEVTWFINGHKMDQGSPGVKIEAHNHDHKLTIDSAQY--AGTVLCRAENAVGRFETKARLVV 561          

HSP 11 Score: 67.0106 bits (162), Expect = 1.765e-10
Identity = 72/297 (24.24%), Postives = 119/297 (40.07%), Query Frame = 3
Query: 3486 DVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK-ETGQTQTTIV--------EINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE 4349
            D+ W KD+  L+  D R   Y  E+   ++ I+   V D+G Y  +   E GQ  T+          E  P  F   ++D       K+   I+  C V  +P    + W +      P+ +               +L  + Q  +L   +    D G Y ++++N  G  S+     +   A+      +P+F Q   + +     E+V  +  ++G+PNP + W  NG+ LSES+ +K         L IK+  +   G+   Q SN  GS      L+V  P       KPLE
Sbjct:  105 DITWYKDDVQLH-EDERHTFYSDEDGFFAMTIDPVQVTDTGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRD----KECKEGDVIDFECEVEGWPEPELV-WLVDDQPLRPSHDF--------------RLQYDGQTAKLEIRDAQPDDTGVYTVKIQNEFG--SIESKAELFVQADPDKNHVAPEF-QATIEYVECDEGEEVRFKSVITGDPNPEIIWFINGKPLSESEKVKFISEDGICILTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPPAPPTFNKPLE 378          

HSP 12 Score: 65.4698 bits (158), Expect = 5.858e-10
Identity = 54/240 (22.50%), Postives = 94/240 (39.17%), Query Frame = 3
Query: 4032 SPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIR-KVGE----THELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +PKFI K+ K+  +      +  C V        KW+K+G+E+     ++++ + G     T ELV+ N    DAG Y     NT G +  +  L VI+          LEK                                    +  P+F+    D+  K  + VVL+C +IG P+P + W ++   I      ++       + + + +    G+Y+  AEN+ G +   A + V
Sbjct: 1773 APKFITKI-KDTKAKKGHSAVFECVVPDTKGVCCKWLKDGKEIELIARIRVQTRTGPEGHITQELVLDNVTPEDAGKYTCIVENTAGKDTCEATLTVIE---------SLEKKSE---------------------------------KKAPEFIVALQDKTTKTSEKVVLECKVIGEPKPKVSWLHDNKTITQESITVESVEGVERVTITSSELSHQGKYTCIAENTEGTSKTEAFLTV 1969          

HSP 13 Score: 64.6994 bits (156), Expect = 8.987e-10
Identity = 124/544 (22.79%), Postives = 218/544 (40.07%), Query Frame = 3
Query: 3279 DYTCQV-SNEFGEDVLKLQLSAAEALISSQTLIPV------SAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSG--TYQAVLKETGQTQTTI-VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSG-NPNPILKWMKNGEELSESDHLKIRKVGE-THELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKP------------LEKPISFTIIPTERYQP-----ADDNSDISSP-----------------QRTQMIFSNTI----------VRSPPQF-------VTTFT----DEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG 4706
            ++ C + +  FG   + +  S A   + ++T + V      + KP  + +L D  VT   GD++++DV   A  S    W ++   L      + I   EE+K SL I  A   DSG  T +A   E G ++++  + +NP    P++ D P+S+  K+  +      ++ +P+  ++ W+I          +V  +R     K  +  T       L   N      G   +  +NSAG  S    + V    +A      PKF  +L  ++     E +    ++ G +P   + W+ NG+ L++SD +++   G+ T+ + I   K   +G   A+A N  G    +C       +   N  KP            LE+ + F+ I T +  P      ++   I S                  Q+  M  + TI          V++  Q        V  FT    D  VKEG+DV     + GYPEP + W+ N   ++ +P   +  +  E+ + +  +    +G  S  A N  G
Sbjct:  825 EFRCSIDTTMFGSGTVSVVASNAAGSVETKTELKVLETPKETKKPEFTDKLRDMEVTK--GDTVQMDV--IALHSPLYKWYQNGNLLEDGKNGVTIKN-EENKSSLIIPNA--QDSGKITVEAS-NEVGSSESSAQLTVNPPSTTPIVVDGPKSVTIKETETAEFKATISGFPA-PTVKWTI-------NEKIVEESRTITTIKTEDVYT-------LKISNAKIEQTGTVKVTAQNSAGQDSKQADLKVEPNVKA------PKFKSQLTDKVADE-GEPLRWNLELDGPSPGTEVSWLLNGQPLTKSDTVQVVDHGDGTYHVTIAEAKPEMSGTLTAKAKNAAG----ECETSAKVTVNGGN-KKPEFVQAPQNHETTLEESVKFSAIVTGKPMPNVTWYLNNKKLIQSEEVKVKYVHETGKTSIRIQKPLMEHNGTIRVEAENVSGKVQATAQLKVDKKTEVPKFTTNMDDRQVKEGEDVKFTANVEGYPEPSVAWTLNGEPVSKHPNITVTDKDGEHTIEISAVTPEQAGELSCEATNPVG 1333          

HSP 14 Score: 59.3066 bits (142), Expect = 3.953e-8
Identity = 67/280 (23.93%), Postives = 107/280 (38.21%), Query Frame = 3
Query: 3930 GGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKL-DKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRY---------SITAENSSGLATCSALVIVD 4739
             G    R EN+ G       + V A    + +K  PKF++ L DK     ++  V+   +V G P P + W   GEEL +SD ++IR+   + ++ IKN K  DAG   A A+N+ GS+ +K  L V             +KP +                                    P+F        V++G + V      G P P   WS N   + + +   +   DE  +   +I   D+  Y         S+ AEN+ G     A + ++
Sbjct:  539 AGTVLCRAENAVGRFETKARLVVLA---PEKQKKPPKFVEILVDK--TETVDNTVVFEVRVEGEPKPTVTWYLKGEELKQSDRVEIREFDGSIKISIKNIKIEDAGEIRAVATNSEGSDETKAKLTV------------QKKPFA------------------------------------PEFDLRPVSLTVEKGSEAVFSAHAFGIPLPTYEWSVNGRKVRDGQEGARVTRDESTVDGASILTIDTATYYSEVNHLTISVVAENTLGAEETGAQLTIE 765          

HSP 15 Score: 56.9954 bits (136), Expect = 2.152e-7
Identity = 102/492 (20.73%), Postives = 171/492 (34.76%), Query Frame = 3
Query: 3282 YTCQVSNEFGEDVLKLQLSA--AEALISSQTLIPVS---AKPISSSQLSDNYVTGSVGDSIKLDVEFPA-DVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK-ETGQTQTTI-VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCL-IGYPEPLI-WWSYNTHFINNPRFEMKRELDEYF-LILKNIQKGDSGRYSITAENSSGLATCSA 4724
            YT ++SN   E    ++++A  +    S Q  + V      P   SQL+D       G+ ++ ++E       ++V WL + QPL   D  +Q+    +    + I  A    SGT  A  K   G+ +T+  V +N     P     PQ+       S+    +V   P   ++ W +        + L+ +   K+      K      +  +          G   +  EN +G       +   A  +   K   PKF   +D   +    E V     V G P P + W  NGE +S+  ++ +      H + I       AG    +A+N  GS+     L V                                                  V   P F     D ++ EG+  ++   L I  P+P I W        ++  +++  E D    L +   +  D GR +I AE+  G+A CSA
Sbjct: 1017 YTLKISNAKIEQTGTVKVTAQNSAGQDSKQADLKVEPNVKAPKFKSQLTDK--VADEGEPLRWNLELDGPSPGTEVSWLLNGQPLTKSD-TVQVVDHGDGTYHVTIAEAKPEMSGTLTAKAKNAAGECETSAKVTVNGGNKKPEFVQAPQNHETTLEESVKFSAIVTGKP-MPNVTWYLN------NKKLIQSEEVKV------KYVHETGKTSIRIQKPLMEHNGTIRVEAENVSG------KVQATAQLKVDKKTEVPKFTTNMDDRQVKE-GEDVKFTANVEGYPEPSVAWTLNGEPVSKHPNITVTDKDGEHTIEISAVTPEQAGELSCEATNPVGSKKRDVQLAV------------------------------------------------KKVGDAPTFAKNLEDRLITEGELTLMDAKLNIVKPKPKITWLKDGVEITSDGHYKIVEEEDGSLKLSILQTKLEDKGRITIKAESEFGVAECSA 1437          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Celegans
Match: unc-89 (Muscle M-line assembly protein unc-89 [Source:UniProtKB/Swiss-Prot;Acc:O01761])

HSP 1 Score: 124.79 bits (312), Expect = 5.152e-28
Identity = 169/772 (21.89%), Postives = 291/772 (37.69%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTF---AANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK-DVAKTHLEIG-----EKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA--------------------------VLKETGQTQ----------TTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGE-THELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            ++W+KD+  I    D   ++Q  +  G   + I++ R+ D G Y C  RN          +  + F   + ++ P+F++K         E L LK+ + G    P  +   ++ PIN+++S   ++K   +       +    +DVG Y  + +++   AKT   +      E P FV          G    + + ++   K  P+ + W K+  P+  +         +NG     I     A  G YTCQ +N+ G+D    +L   +     QT   V  KP+    L + +     GD++ L+ +   +    + + K++QP+      +Q+   E+    L I  A   D G Y+                           V  E+GQ +          T   + +  + AP   +  +S    +     + C V   P    I W+ +       + +  +AR +  +K    LT       L FDNVT +D GEY    EN  G +    PI V      +    +P F+Q +   +++ + E  ++  K+SG P P +KW KNGEEL  SD +KI  + + T  L + N K  D   Y  +ASN  G   S   L V +P                                                +  P F    +   VKE +    +C + G    + W+   T    + R   +   D    L++++ +  D G Y I   N +G+A     + V
Sbjct: 3393 VEWFKDDTPI--SIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRARN-----EAGEALTTANFGIIRDSIPPEFTQKLRPLEVREQETLDLKVTVIGTP-VPNVEWFKDDKPINIDNSHI-FAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAPLFVQGLKPYEVEQGKPAELVVRVEG--KPEPE-VKWFKDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEV--KPLFIEPLKETFAVE--GDTVVLECKVNKESHPQIKFFKNDQPVEIGQ-HMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPR-PKIKWTKE------GKEVEMSARVRAEHKDDGTLT-------LTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAVVT-VGETAVLEGKISGKPKPSVKWYKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEP-----------------------------------------------AQVAPGFFKELSAIQVKETETAKFECKVSGTKPDVKWFKDGTPLKEDKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTV 4085          

HSP 2 Score: 124.405 bits (311), Expect = 6.572e-28
Identity = 183/800 (22.88%), Postives = 306/800 (38.25%), Query Frame = 3
Query: 2481 VNAESSCPTRLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFS---EKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK--------DVAKTHLEIGE---KPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYIND--NGELVFEIPKFTQAHVGDYTCQVSNEFGED--VLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAV-LKETGQTQTT----------IVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGE-THELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTH-FINNPRFEMKRELDE--YFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYP 4781
            V+ E   P  L   +E +P++      I+WYK+ + + PD D     +   +SG+  + I + ++SD G Y   + N    +   S V +      + T    F    + T     + L+L+  + G    P  ++I+    + +        +V+ +       RS    D+GQY  RV++K        D   T  E GE   KP+FV       +L GD    ++ ++   K    T+ W  N  P+       +  ++D  +G     I    +   G   C   NE G D  V + Q  A     S   L      P  +  L D  +   VGD + ++    A+ +++V W KD + +       +I    +  C +KI     +D G Y  V + E GQ +T           + E    ++AP I    +         I + C V++ P   S+ W     DG P R    ++R  +  +     T       L  ++ T  D G Y     N+ G  +    + V    +   K+    F  K   ++ +   +   ++C V+G+P P +KW +NG+ L       I    + +  L +     SD GIY  +A N +G   ++    V   +G        EKP              D+                     PP+F+   +D  V  G+ + L+C + G P P + WS +    I + RFE   E  +  Y L +KN    D G Y   A N +G AT  + V +D    +  +  SQ P
Sbjct: 4955 VDVEEPQPVELKVKVEGIPKV------IKWYKNGQELKPDAD-GFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHVKSAKSSEPTSGANFLSPLKDTEVEEGDMLTLQCTIAG---EPFPEVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQY--RVTAKNEAGSATSDCKVTVTEQGEQPSKPKFVIPLKTGAALPGDKKEFNVKVRGLPK---PTLQWFLNGIPIKF---DDRITLDDMADGNYCLTIRDVREEDFGTLKCIAKNENGTDETVCEFQQGAGHDDGSRDDL---RYPPRFNVPLWDRRI--PVGDPMFIECHVDANPTAEVEWFKDGKKIE-HTAHTEIRNTVDGACRIKIIPFEESDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTVNGGQPIRLSCKVDAIPRA-SVVWY---KDGLPLRA---DSRTSIQYEEDGTAT-------LAINDSTEEDIGAYRCVATNAHGTINTSCSVNVKVPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHVQMALGKT------EKP------------KMDEG-------------------KPPKFILELSDMSVSLGNVIDLECKVTGLPNPSVKWSKDGGPLIEDSRFEWSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTASQPP 5679          

HSP 3 Score: 105.531 bits (262), Expect = 3.639e-22
Identity = 161/760 (21.18%), Postives = 288/760 (37.89%), Query Frame = 3
Query: 2559 DIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSS-KDVAKTHLEIGE-----KPEFVYH------QFKENSLLG---------------DSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQTQTTI-VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVM--IPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETH-ELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRELDEYF-LILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            D++W+KD++ +  D +    ++ N ++G   + +     +DAG+Y  +  N P+   +SS       S ++ T + +        N E  +L + + G    P  + + +  P+  + S    +KV  +       +   L+D G+Y  R ++    AKT            PEFV        + KE++ L                D   ISI   N H +  +T +                      G     I    Q  VG Y+C+  NE GE      L+ A   I   ++ P   + +   ++ +        +++ L V        +V W KD++P+N  +  I          +L I  A   D G Y      E G+ +TT  + +     AP+     +    +Q     +V  V   P    + W     DG P           + N+ + +  G      L   +   +D G+Y  +  N AG    +  + I   +  +   ++  P FI+ L KE  +   + V++ CKV+   +P +K+ KN + +    H+++  + + + +L I+N KK D G Y  +A N  G   +   L++            +E+ ++      E     +   D +S +           R  P+FV       V E    +LKC + G P P I W+     +  + R   + + D    L   N+ + D+G Y   AEN  G A     +IV
Sbjct: 3196 DVEWFKDDKPVSEDGNHE--MKKNPETGVFTLVVKQAATTDAGKYTAKASN-PAGTAESSAEAEVTQSLEKPTFVRELVTTEVKIN-ETATLSVTVKGVP-DPSVEWLKDGQPVQTDSSHV-IAKVEGSGSYSITIKDARLEDSGKYACRATNPAGEAKTEANFAVVKNLVPPEFVEKLSPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISI--DNVHVIQKQTAV----------------------GSFSLTINDARQGDVGIYSCRARNEAGE-----ALTTANFGIIRDSIPPEFTQKLRPLEVREQ-------ETLDLKVTVIGTPVPNVEWFKDDKPINIDNSHIFAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAPLFVQGLKPYEVEQGKPAELVVRVEGKPEPE-VKWF---KDGVP---------IAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEVKPLFIEPL-KETFAVEGDTVVLECKVNKESHPQIKFFKNDQPVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKI-------QFAAKVEEHVTDESGQLEEIGQFETVGDTASSK-------TDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIV 3885          

HSP 4 Score: 100.138 bits (248), Expect = 1.881e-20
Identity = 181/828 (21.86%), Postives = 298/828 (35.99%), Query Frame = 3
Query: 2559 DIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWC----EVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFS---EKTFAANTEPLSLKLVLDGFKYAPESDLIF--NNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYL-----------------FRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKN-------------FHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPV---SAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKC--SLKINGATVNDSGTYQAVLKETGQTQTT--------------IVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTT--------SDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTS-----------PKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLK-IRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLP 4802
            +++W+KD + I       I    N+  G  ++ I    ESD G Y C    E+    +       +L  V  +K+    PK +   E       +P+ L   +D     P + +++  + +P+  +  +    +      +  N  +   +D+G Y                   +V  ++V K     GE+P F        +  GDS  +   +                 +  P+T+I                   + +G     + + T +  G Y C+  N  G+   K Q +A   +   +T  P       P    +LSD  V  S+G+ I L+ +     +  V W KD  PL   D R + +  E SK    L+I  ATV+D GTY+ V      + TT              +    P +F   + D    +R  +   + + C V++ P    + +     DG+             I  P +++     +I L  D V T         D G Y +   N +G +      TV  L      + S           PK ++ L+  I  P  +   +RCK SG+P P +KW K+GE +     L+ I       ELV+ +  + DAG Y   A NT GS  + C + VI                          +P D +S I   +              P F T  T    K GD V  +C   G P P I W        ++ + +M+   D    LIL ++     G +   A N  G A+  A ++++        DR+     S+PLP
Sbjct: 5285 EVEWFKDGKKIEHTAHTEIR---NTVDGACRIKIIPFEESDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTVNGGQPIRLSCKVDAI---PRASVVWYKDGLPLRADSRTSIQYEEDGTATLAINDST--EEDIGAYRCVATNAHGTINTSCSVNVKVPKQEVKKE----GEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVI-----------------ETSPDGSCSLTVNESTMSDEGIYRCEAENAHGK--AKTQATAHVQMALGKTEKPKMDEGKPPKFILELSDMSV--SLGNVIDLECKVTGLPNPSVKWSKDGGPL-IEDSRFE-WSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTASQPPRFTLKMGD----VRTTEGQPLKLECKVDASPLPEMVWYK----DGA-------------IVTPSDRI-----QISLSPDGVATLLIPSCVYDDDGIYRVIATNPSGTAQDKGTATVKKLPRDSGARRSADRDVFDANKAPKLMEPLEN-IRIPEKQSFRLRCKFSGDPKPTIKWFKDGERVFPYGRLQLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVI----------------------RGDRKPRDIDSSIREGKA-------------PGFTTPLTIRRAKPGDSVTFECLPFGNPFPSIKWLKDGLELFSDEKIKMEAAADGTQRLILSDVTFLSEGYFRCVATNEHGTASTKAELVIEG-------DRT---IGSRPLP 6005          

HSP 5 Score: 90.5077 bits (223), Expect = 1.322e-17
Identity = 168/787 (21.35%), Postives = 301/787 (38.25%), Query Frame = 3
Query: 2547 KDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGT---VIPKFSE---KTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPI--------------------------NVNHSSCPWSKVS------SNEMIQFNHR--------SVSLKDVGQYLFRVSSKDVAKTHLEIGE-KPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFG----EDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQ--TQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGET-HELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDS 4742
            K + +++W+KD   I    D + +++   ++G   + I +   +D G+Y C+  N          + +  +S ++ T   V P F E   +TFA   + + L+  ++   + P+     N+ P+                          +V    C    V+      ++  IQF  +        S  L+++GQ+    +  D A +  + G   PEFV    +  ++     AI   +K   K  P+  I    +          +    D+G L       TQA  G+Y C+  NE+G    E  + + L  A  +       P   +P+  + +       +VG++  L+ +        V W K+ + L   D R++I   ++    L +  A ++D   Y+     E G   +  T+    P Q AP       +I+ K+  +    C V+   +   + W     DG+P   L  + R               QR  L  ++  T D G Y + V N AG ++  +P+TV      +        I+K   ++      K+++  +V G P  + KW K  E ++ S   KI +V E+ ++L I++ + SD G Y    S  + S         ++   +V  TK  EK IS                                    P F     D+ V +G  +VL+  + G P+ + W+  N   I + + E      +Y L + + Q+ D G YS+TA N +G     A V V +
Sbjct: 3584 KPEPEVKWFKDGVPIA--IDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEVKPLFIEPLKETFAVEGDTVVLECKVNKESH-PQIKFFKNDQPVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFE---TVGDTASSKTDTGRGAPEFV-ELLRSCTVTEKQQAI---LKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGE---APDFLQPVKPAVV-------TVGETAVLEGKISGKPKPSVKWYKNGEELKPSD-RVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEPAQVAPGFFKELSAIQVKETETAKFECKVSG--TKPDVKWF---KDGTP---LKEDKRVH-----FESTDDGTQR--LVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTVVPSETLK--------IKKGLTDVNVTQGTKILLSVEVEGKPKTV-KWYKGTETVTSSQTTKIVQVTESEYKLEIESAEMSDTGAYRVVLSTDSFS---------VESSATVTVTKAAEK-ISL-----------------------------------PSFKKGLADQSVPKGTPLVLEVEIEGKPKDVKWYK-NGDEIKDGKVEDLGN-GKYRLTIPDFQEKDVGEYSVTAANEAGEIESKAKVNVSA 4278          

HSP 6 Score: 84.7297 bits (208), Expect = 7.550e-16
Identity = 117/484 (24.17%), Postives = 189/484 (39.05%), Query Frame = 3
Query: 3444 SIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSI---------------RAKQNGSINIVCV--VNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAA--------LAE--AQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGET-----HELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYN-THFINNPRFEMKR-ELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALV-----IVDSHNKNHSIDRSQY 4778
            S +L  +F  D    + W KD + +     R+Q+    +  C L ++ AT  D+G Y+ V + T  +  T  ++N I+     +D   SI               RAK   S+   C+   N +P   SI W     DG     L ++ + KM            QR  L   +VT    G +     N  G +S    + +          L E   + ++  P+  + L    I   N   ++ C  +G P P +KW K+G+E+   D    ++V  T     H LVI N    D G Y  +A+N  GS  ++  L +I P                      R+    D       +R  M F       PP FV    ++ V      +  C ++G+P P + W +N    +   R +++      + LI+ +    D+G Y  TA+NS G A+ SA++      +DS   N  ID + Y
Sbjct: 5809 SFRLRCKFSGDPKPTIKWFKDGERVFPYG-RLQLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVIRGDRKPRDIDSSIREGKAPGFTTPLTIRRAKPGDSVTFECLPFGNPFP---SIKWL---KDG---LELFSDEKIKM-----EAAADGTQR--LILSDVTFLSEGYFRCVATNEHGTASTKAELVIEGDRTIGSRPLPEVNGEPEECKPRIRRGLYNMSIHEGNVVEMIVC-ATGIPTPTVKWYKDGQEIV-GDGPDGKRVIFTDERGIHHLVIVNASPDDEGEYSLEATNKLGSAKTEGSLNIIRP----------------------RHIADAD-------ERGGMPF-------PPGFVRQLKNKHVFNHMPTIFDCLVVGHPAPEVEWFHNGKKIVPGGRIKIQSCGGGSHALIILDTTLEDAGEYVATAKNSHGSASSSAVLDVTVPFLDSIKFNGEIDVTPY 6237          

HSP 7 Score: 77.411 bits (189), Expect = 1.419e-13
Identity = 162/758 (21.37%), Postives = 295/758 (38.92%), Query Frame = 3
Query: 2559 DIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNN---MPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK-DVAKTHLEIGEKPEFVYHQ-FKENSLL-GDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDV----LKLQLSAAEALISSQTLIPVSAKPISS--SQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQN-----GSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKL-DKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELS-ESDHLKIRKVGETHE--LVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEP-LIWWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHS 4760
            +I+WYK+ + I P    +     +    K ++ I +  + DA +Y   + +       SS  L      K+  +I    ++  +  + P+ L++   G   +P++   + N   +P      +    K+  N+ +     SV ++D G Y   V+++   A +  +I  +P+  + +  K+ S+  G++   S+         P+ + W             +   I  N   + E     Q     Y   + N   +D     + L+ +A EA  S+Q  +  +   +      L D  V  + G  +  +V+   +   DV WL+D   +++    I I   +++   L I  A + D+G Y   V+ E+G+ ++             + + P+ +R  +N     G  ++  V  S P    + W     +  P  +L      K I           ++ EL  +     DG +Y + + N+AG       +TV        K    K +  L D ++  P  + V ++ KV G P  ++KW KNG+EL  ++D  K  +  E+ E  L I + KKSD G Y     N  G   S   + V     S  +++P                                        S   F++   D  V+EGD + L+C + G P P +IW         + R  M+  LD    L +++ +K D G+Y +TA+N +G AT    V V    +  S
Sbjct: 4498 EIKWYKNGKEITPSDKAQ---PGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEPKIIKGLEDQVVSIGS-PIKLEIETSG---SPKTVKWYKNGKELP-GAAAKTIKIQKIDDNKYVLEIPSSV-VEDTGDYKVEVANEAGSANSSGKITVEPKITFLKPLKDQSITEGENAEFSVETNT----KPRIVKW-----------YKNGQEIKPNSRFIIE-----QKTDTKYQLVIKNAVRDDADTYKIVLENTAGEAESSAQLTVKKAKAGLCKIVKGLEDQVV--AKGAKMVFEVKIQGE-PEDVRWLRDANVISAGANAI-IEKIDDTTYRLIIPSADLKDAGEYTVEVINESGKAKS--------DAKGEVDEKPEIVRGLENIEIPEGDDDVFKVEVSAP-VRQVKWYKNDQEIKPNSHL----EAKKIGP---------KKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVV-------KPNVLKIVDGLKDVDVEEP--QPVELKVKVEGIPK-VIKWYKNGQELKPDADGFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHV----KSAKSSEPT---------------------------------------SGANFLSPLKDTEVEEGDMLTLQCTIAGEPFPEVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVTVTEQGEQPS 5147          

HSP 8 Score: 77.0258 bits (188), Expect = 1.765e-13
Identity = 166/756 (21.96%), Postives = 281/756 (37.17%), Query Frame = 3
Query: 2565 QWYKDNEAILPDCDPRILLQCNSQ-SGKM--KMHIDNCRESDAGQYWCEVRN--GPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDG---FKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQY-LFRVSSKDVAKTHLEI---GEKPEFVYHQFKENSLLGDSLAISIPMK-------NFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQF--APVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPI----NEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRK---VGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVI-DPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN--NPRFEMKRE-LDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +W KD + I  +   RI +Q  +   G +  ++ +DN    DAG+Y C V N  G      +  V+ S   +K     P+F        T   S K+VL+     +  P+   + +N    +   S     V   E +     S  L   G+Y     +++  +KT   +   GE P F      +   +G+ L +S  +K       +F+  S  T +  K  +         +T  N +  +V  I + T+  +  Y    +N  G        + + + I+++   PV  + +  + + +        + IK++V+     + DV W KD++P++          PE    +L +  A   D+G Y A       T  +  E    Q    P       +   K N +  +   V   P   S+ W     DG P +   ++   K+       +T    R+E         D G+Y  R  N AG +      T A  A  +N    P+F++KL     SP+     E   +  KV G P P ++W K+   +S  +   I+K   VG +  L I + ++ D GIY  +A N  G  ++  +  +I D I                                                 PP+F        V+E + + LK  +IG P P + W  +   IN  N     K E    + L +K  +  D G Y+  A N +G A  +A + V
Sbjct: 2897 KWLKDGKEI--ELIARIRVQTRTGPEGHITQELVLDNVTPEDAGKYTCIVENTAGKDTCEATLTVIES-LEKKSEKKAPEFI-VALQDKTTKTSEKVVLECKVIGEPKPKVSWLHDNK--TITQESITVESVEGVERVTIT--SSELSHQGKYTCIAENTEGTSKTEAFLTVQGEAPVFTKELQNKELSIGEKLVLSCSVKGSPQPHVDFYSFSETTKVETKITSSSRIAIEHDQT--NTHWRMV--ISQITKEDIVSYKAIATNSIG-------TATSTSKITTKVEAPVFEQGLKKTSVKEK-------EEIKMEVKV-GGSAPDVEWFKDDKPVSEDGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEAEVTQSLEKPTFVRELVTTEVKINETATLSVTVKGVPD-PSVEWL---KDGQPVQTDSSHVIAKVEGSGSYSITIKDARLE---------DSGKYACRATNPAGEAK-----TEANFAVVKN-LVPPEFVEKL-----SPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISIDNVHVIQKQTAVG-SFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSI-------------------------------------------------PPEFTQKLRPLEVREQETLDLKVTVIGTPVPNVEWFKDDKPINIDNSHIFAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAV 3551          

HSP 9 Score: 75.8702 bits (185), Expect = 3.883e-13
Identity = 167/786 (21.25%), Postives = 295/786 (37.53%), Query Frame = 3
Query: 2559 DIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSS------KDVAKTHLEIGEK---PEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKL-DKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETH-ELVIKNCKKSDAGIYEAQASNTNGSEV-SKCHLQVIDPIGSVNTTKPLE-------KPISFTI-----------------IP-----TERYQPADDNS------------------DISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            D++W+KD   +  D   R+  + ++  G  ++ I++ +  D G Y  EV N   V   +S V L+V   +   +    ++      T+ L L + ++G    P++   +       +  +    +V+ +E  +    S  + D G Y   +S+           T  +  EK   P F      ++   G  L + + ++      PK + W KN   +       K     NG+    IP F +  VG+Y+   +NE GE             I S+  + VSAKP   S L    V    G++   +V+    V   V W K+ + +    P  +     +   SL+I  A V D+  Y+ V+        +   +  ++ A   +D     + K      ++          + N  +K     P + +      K I     K  G+     L   N    D  +Y + V N AG +     +TV     A         ++ L D E+  P  +K +++ + +  P  I KW KNG+E++ SD  +    G+   +LVI +    DA  Y+   ++ +G+   S C L V  P       K LE        PI   I                 +P     T + Q  DDN                   ++++   +        V     F+    D+ + EG++          P  + W+        N RF ++++ D +Y L++KN  + D+  Y I  EN++G A  SA + V
Sbjct: 4025 DVKWFKDGTPLKED--KRVHFE-STDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVA--NSKVPLTVVPSETLKIKKGLTDVNVTQGTKIL-LSVEVEG---KPKTVKWYKGTETVTSSQTTKIVQVTESEY-KLEIESAEMSDTGAYRVVLSTDSFSVESSATVTVTKAAEKISLPSFKKGLADQSVPKGTPLVLEVEIEG----KPKDVKWYKNGDEIK----DGKVEDLGNGKYRLTIPDFQEKDVGEYSVTAANEAGE-------------IESKAKVNVSAKPEIVSGLVPTTV--KQGETATFNVKVKGPVKG-VKWYKNGKEI----PDAKTKDNGDGSYSLEIPNAQVEDAADYKVVVSNDAGDADSSAALT-VKLADDGKD-----KVKPEIVSGLIPTTVKQGETATFNVKVK----GPVKQVKWYKNGKEIPNAKAKDNGDGS-YSLEIPNAQLDDTADYKVVVSNDAGDADSSAALTVKLPGIA--------IVKGLEDAEV--PKGKKAVLQVETNKKPKEI-KWYKNGKEITPSDKAQPGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEPKIIKGLEDQVVSIGSPIKLEIETSGSPKTVKWYKNGKELPGAAAKTIKIQKIDDNKYVLEIPSSVVEDTGDYKVEVANEAGSANSSGKITVEPKITFLKPLKDQSITEGENAEFSVETNTKPRIVKWYKNGQEIKPNSRFIIEQKTDTKYQLVIKNAVRDDADTYKIVLENTAGEAESSAQLTV 4750          

HSP 10 Score: 67.3958 bits (163), Expect = 1.206e-10
Identity = 119/524 (22.71%), Postives = 205/524 (39.12%), Query Frame = 3
Query: 3207 HKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN-SRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK-ETGQTQTT---IVEINPIQ--FAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINK-PLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGET--HELVIKNCK--KSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN--NPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            H  Y +++G     I        G YTC  +NE+G+       ++  A      +   +A P   ++L D       GD I  + E       ++VWL D+QPL  S D R+Q Y  + +K  L+I  A  +D+G Y   ++ E G  ++     V+ +P +   AP  Q   + +   +   +    V+   P+   I W I   +G P   L  + + K I++  +  LT  ++ +  +FD + T  G    L   +  G   V +P               P F + L+ + +      V+    VSG P P L +   G+EL   +   +  VG    + + I N    K D  I  A+A N +G+  S+  L V                           +  ++ S                 RS P F+    D+ VK G+  V +  + G P P + W  N H ++  +P  +++    ++ L + + Q   +G     AEN+ G     A ++V
Sbjct:  594 HTFYSDEDGFFAMTIDPVQVTDTGRYTCMATNEYGQ-------ASTSAFFRVLKVEKEAAPPAFVTKLRDKEC--KEGDVIDFECEVEGWPEPELVWLVDDQPLRPSHDFRLQ-YDGQTAK--LEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPDKNHVAPEFQATIEYVECDEGEEVRFKSVITGDPNPEII-WFI---NGKP---LSESEKVKFISEDGICILT--IKDVTRHFDGMVTCQGSNR-LGSASCDGRLKVRVP------------PAPPTFNKPLEDKTVQE-KSTVVFEVDVSGWPEPTLTFTLCGKELKNGEE-GVEIVGHDGFYRISIPNTSMDKHDGEIV-AKAQNEHGTAESRARLTV---------------------------EQEEEES-----------------RSAPTFLKDIEDQTVKTGEFAVFETTVRGNPNPEVTWFINGHKMDQGSPGVKIEAHNHDHKLTIDSAQY--AGTVLCRAENAVGRFETKARLVV 1034          

HSP 11 Score: 66.6254 bits (161), Expect = 2.099e-10
Identity = 72/297 (24.24%), Postives = 119/297 (40.07%), Query Frame = 3
Query: 3486 DVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK-ETGQTQTTIV--------EINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE 4349
            D+ W KD+  L+  D R   Y  E+   ++ I+   V D+G Y  +   E GQ  T+          E  P  F   ++D       K+   I+  C V  +P    + W +      P+ +               +L  + Q  +L   +    D G Y ++++N  G  S+     +   A+      +P+F Q   + +     E+V  +  ++G+PNP + W  NG+ LSES+ +K         L IK+  +   G+   Q SN  GS      L+V  P       KPLE
Sbjct:  578 DITWYKDDVQLH-EDERHTFYSDEDGFFAMTIDPVQVTDTGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRD----KECKEGDVIDFECEVEGWPEPELV-WLVDDQPLRPSHDF--------------RLQYDGQTAKLEIRDAQPDDTGVYTVKIQNEFG--SIESKAELFVQADPDKNHVAPEF-QATIEYVECDEGEEVRFKSVITGDPNPEIIWFINGKPLSESEKVKFISEDGICILTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPPAPPTFNKPLE 851          

HSP 12 Score: 65.4698 bits (158), Expect = 5.890e-10
Identity = 54/240 (22.50%), Postives = 94/240 (39.17%), Query Frame = 3
Query: 4032 SPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIR-KVGE----THELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +PKFI K+ K+  +      +  C V        KW+K+G+E+     ++++ + G     T ELV+ N    DAG Y     NT G +  +  L VI+          LEK                                    +  P+F+    D+  K  + VVL+C +IG P+P + W ++   I      ++       + + + +    G+Y+  AEN+ G +   A + V
Sbjct: 2864 APKFITKI-KDTKAKKGHSAVFECVVPDTKGVCCKWLKDGKEIELIARIRVQTRTGPEGHITQELVLDNVTPEDAGKYTCIVENTAGKDTCEATLTVIE---------SLEKKSE---------------------------------KKAPEFIVALQDKTTKTSEKVVLECKVIGEPKPKVSWLHDNKTITQESITVESVEGVERVTITSSELSHQGKYTCIAENTEGTSKTEAFLTV 3060          

HSP 13 Score: 59.6918 bits (143), Expect = 2.888e-8
Identity = 67/280 (23.93%), Postives = 107/280 (38.21%), Query Frame = 3
Query: 3930 GGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKL-DKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRY---------SITAENSSGLATCSALVIVD 4739
             G    R EN+ G       + V A    + +K  PKF++ L DK     ++  V+   +V G P P + W   GEEL +SD ++IR+   + ++ IKN K  DAG   A A+N+ GS+ +K  L V             +KP +                                    P+F        V++G + V      G P P   WS N   + + +   +   DE  +   +I   D+  Y         S+ AEN+ G     A + ++
Sbjct: 1012 AGTVLCRAENAVGRFETKARLVVLA---PEKQKKPPKFVEILVDK--TETVDNTVVFEVRVEGEPKPTVTWYLKGEELKQSDRVEIREFDGSIKISIKNIKIEDAGEIRAVATNSEGSDETKAKLTV------------QKKPFA------------------------------------PEFDLRPVSLTVEKGSEAVFSAHAFGIPLPTYEWSVNGRKVRDGQEGARVTRDESTVDGASILTIDTATYYSEVNHLTISVVAENTLGAEETGAQLTIE 1238          

HSP 14 Score: 57.3806 bits (137), Expect = 1.398e-7
Identity = 82/345 (23.77%), Postives = 150/345 (43.48%), Query Frame = 3
Query: 3279 DYTCQV-SNEFGEDVLKLQLSAAEALISSQTLIPV------SAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSG--TYQAVLKETGQTQTTI-VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSG-NPNPILKWMKNGEELSESDHLKIRKVGE-THELVIKNCKKSDAGIYEAQASNTNG 4277
            ++ C + +  FG   + +  S A   + ++T + V      + KP  + +L D  VT   GD++++DV   A  S    W ++   L      + I   EE+K SL I  A   DSG  T +A   E G ++++  + +NP    P++ D P+S+  K+  +      ++ +P+  ++ W+I          +V  +R     K  +  T       L   N      G   +  +NSAG  S    + V    +A      PKF  +L  ++     E +    ++ G +P   + W+ NG+ L++SD +++   G+ T+ + I   K   +G   A+A N  G
Sbjct: 1916 EFRCSIDTTMFGSGTVSVVASNAAGSVETKTELKVLETPKETKKPEFTDKLRDMEVTK--GDTVQMDV--IALHSPLYKWYQNGNLLEDGKNGVTIKN-EENKSSLIIPNA--QDSGKITVEAS-NEVGSSESSAQLTVNPPSTTPIVVDGPKSVTIKETETAEFKATISGFPA-PTVKWTI-------NEKIVEESRTITTIKTEDVYT-------LKISNAKIEQTGTVKVTAQNSAGQDSKQADLKVEPNVKA------PKFKSQLTDKVADE-GEPLRWNLELDGPSPGTEVSWLLNGQPLTKSDTVQVVDHGDGTYHVTIAEAKPEMSGTLTAKAKNAAG 2230          

HSP 15 Score: 57.3806 bits (137), Expect = 1.421e-7
Identity = 103/496 (20.77%), Postives = 173/496 (34.88%), Query Frame = 3
Query: 3282 YTCQVSNEFGEDVLKLQLSA--AEALISSQTLIPVS---AKPISSSQLSDNYVTGSVGDSIKLDVEFPA-DVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK-ETGQTQTTI-VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCL-IGYPEPLI-WWSYNTHFINNPRFEMKRELDEYF-LILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            YT ++SN   E    ++++A  +    S Q  + V      P   SQL+D       G+ ++ ++E       ++V WL + QPL   D  +Q+    +    + I  A    SGT  A  K   G+ +T+  V +N     P     PQ+       S+    +V   P   ++ W +        + L+ +   K+      K      +  +          G   +  EN +G       +   A  +   K   PKF   +D   +    E V     V G P P + W  NGE +S+  ++ +      H + I       AG    +A+N  GS+     L V                                                  V   P F     D ++ EG+  ++   L I  P+P I W        ++  +++  E D    L +   +  D GR +I AE+  G+A CSA + V
Sbjct: 2108 YTLKISNAKIEQTGTVKVTAQNSAGQDSKQADLKVEPNVKAPKFKSQLTDK--VADEGEPLRWNLELDGPSPGTEVSWLLNGQPLTKSD-TVQVVDHGDGTYHVTIAEAKPEMSGTLTAKAKNAAGECETSAKVTVNGGNKKPEFVQAPQNHETTLEESVKFSAIVTGKP-MPNVTWYLN------NKKLIQSEEVKV------KYVHETGKTSIRIQKPLMEHNGTIRVEAENVSG------KVQATAQLKVDKKTEVPKFTTNMDDRQVKE-GEDVKFTANVEGYPEPSVAWTLNGEPVSKHPNITVTDKDGEHTIEISAVTPEQAGELSCEATNPVGSKKRDVQLAV------------------------------------------------KKVGDAPTFAKNLEDRLITEGELTLMDAKLNIVKPKPKITWLKDGVEITSDGHYKIVEEEDGSLKLSILQTKLEDKGRITIKAESEFGVAECSASLGV 2532          

HSP 16 Score: 51.6026 bits (122), Expect = 7.450e-6
Identity = 30/100 (30.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query: 4464 SPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEP-LIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSH-NKNH 4757
            +PP FVT   D+  KEGD +  +C + G+PEP L+W   +     +  F ++ +     L +++ Q  D+G Y++  +N  G     A + V +  +KNH
Sbjct:  646 APPAFVTKLRDKECKEGDVIDFECEVEGWPEPELVWLVDDQPLRPSHDFRLQYDGQTAKLEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPDKNH 745          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Celegans
Match: unc-89 (Muscle M-line assembly protein unc-89 [Source:UniProtKB/Swiss-Prot;Acc:O01761])

HSP 1 Score: 124.79 bits (312), Expect = 5.465e-28
Identity = 169/772 (21.89%), Postives = 291/772 (37.69%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTF---AANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK-DVAKTHLEIG-----EKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA--------------------------VLKETGQTQ----------TTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGE-THELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            ++W+KD+  I    D   ++Q  +  G   + I++ R+ D G Y C  RN          +  + F   + ++ P+F++K         E L LK+ + G    P  +   ++ PIN+++S   ++K   +       +    +DVG Y  + +++   AKT   +      E P FV          G    + + ++   K  P+ + W K+  P+  +         +NG     I     A  G YTCQ +N+ G+D    +L   +     QT   V  KP+    L + +     GD++ L+ +   +    + + K++QP+      +Q+   E+    L I  A   D G Y+                           V  E+GQ +          T   + +  + AP   +  +S    +     + C V   P    I W+ +       + +  +AR +  +K    LT       L FDNVT +D GEY    EN  G +    PI V      +    +P F+Q +   +++ + E  ++  K+SG P P +KW KNGEEL  SD +KI  + + T  L + N K  D   Y  +ASN  G   S   L V +P                                                +  P F    +   VKE +    +C + G    + W+   T    + R   +   D    L++++ +  D G Y I   N +G+A     + V
Sbjct: 3415 VEWFKDDTPI--SIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRARN-----EAGEALTTANFGIIRDSIPPEFTQKLRPLEVREQETLDLKVTVIGTP-VPNVEWFKDDKPINIDNSHI-FAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAPLFVQGLKPYEVEQGKPAELVVRVEG--KPEPE-VKWFKDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEV--KPLFIEPLKETFAVE--GDTVVLECKVNKESHPQIKFFKNDQPVEIGQ-HMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPR-PKIKWTKE------GKEVEMSARVRAEHKDDGTLT-------LTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAVVT-VGETAVLEGKISGKPKPSVKWYKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEP-----------------------------------------------AQVAPGFFKELSAIQVKETETAKFECKVSGTKPDVKWFKDGTPLKEDKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTV 4107          

HSP 2 Score: 124.405 bits (311), Expect = 7.456e-28
Identity = 183/800 (22.88%), Postives = 306/800 (38.25%), Query Frame = 3
Query: 2481 VNAESSCPTRLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFS---EKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK--------DVAKTHLEIGE---KPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYIND--NGELVFEIPKFTQAHVGDYTCQVSNEFGED--VLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAV-LKETGQTQTT----------IVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGE-THELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTH-FINNPRFEMKRELDE--YFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYP 4781
            V+ E   P  L   +E +P++      I+WYK+ + + PD D     +   +SG+  + I + ++SD G Y   + N    +   S V +      + T    F    + T     + L+L+  + G    P  ++I+    + +        +V+ +       RS    D+GQY  RV++K        D   T  E GE   KP+FV       +L GD    ++ ++   K    T+ W  N  P+       +  ++D  +G     I    +   G   C   NE G D  V + Q  A     S   L      P  +  L D  +   VGD + ++    A+ +++V W KD + +       +I    +  C +KI     +D G Y  V + E GQ +T           + E    ++AP I    +         I + C V++ P   S+ W     DG P R    ++R  +  +     T       L  ++ T  D G Y     N+ G  +    + V    +   K+    F  K   ++ +   +   ++C V+G+P P +KW +NG+ L       I    + +  L +     SD GIY  +A N +G   ++    V   +G        EKP              D+                     PP+F+   +D  V  G+ + L+C + G P P + WS +    I + RFE   E  +  Y L +KN    D G Y   A N +G AT  + V +D    +  +  SQ P
Sbjct: 4977 VDVEEPQPVELKVKVEGIPKV------IKWYKNGQELKPDAD-GFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHVKSAKSSEPTSGANFLSPLKDTEVEEGDMLTLQCTIAG---EPFPEVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQY--RVTAKNEAGSATSDCKVTVTEQGEQPSKPKFVIPLKTGAALPGDKKEFNVKVRGLPK---PTLQWFLNGIPIKF---DDRITLDDMADGNYCLTIRDVREEDFGTLKCIAKNENGTDETVCEFQQGAGHDDGSRDDL---RYPPRFNVPLWDRRI--PVGDPMFIECHVDANPTAEVEWFKDGKKIE-HTAHTEIRNTVDGACRIKIIPFEESDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTVNGGQPIRLSCKVDAIPRA-SVVWY---KDGLPLRA---DSRTSIQYEEDGTAT-------LAINDSTEEDIGAYRCVATNAHGTINTSCSVNVKVPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHVQMALGKT------EKP------------KMDEG-------------------KPPKFILELSDMSVSLGNVIDLECKVTGLPNPSVKWSKDGGPLIEDSRFEWSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTASQPP 5701          

HSP 3 Score: 105.531 bits (262), Expect = 3.958e-22
Identity = 161/760 (21.18%), Postives = 288/760 (37.89%), Query Frame = 3
Query: 2559 DIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSS-KDVAKTHLEIGE-----KPEFVYH------QFKENSLLG---------------DSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQTQTTI-VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVM--IPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETH-ELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRELDEYF-LILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            D++W+KD++ +  D +    ++ N ++G   + +     +DAG+Y  +  N P+   +SS       S ++ T + +        N E  +L + + G    P  + + +  P+  + S    +KV  +       +   L+D G+Y  R ++    AKT            PEFV        + KE++ L                D   ISI   N H +  +T +                      G     I    Q  VG Y+C+  NE GE      L+ A   I   ++ P   + +   ++ +        +++ L V        +V W KD++P+N  +  I          +L I  A   D G Y      E G+ +TT  + +     AP+     +    +Q     +V  V   P    + W     DG P           + N+ + +  G      L   +   +D G+Y  +  N AG    +  + I   +  +   ++  P FI+ L KE  +   + V++ CKV+   +P +K+ KN + +    H+++  + + + +L I+N KK D G Y  +A N  G   +   L++            +E+ ++      E     +   D +S +           R  P+FV       V E    +LKC + G P P I W+     +  + R   + + D    L   N+ + D+G Y   AEN  G A     +IV
Sbjct: 3218 DVEWFKDDKPVSEDGNHE--MKKNPETGVFTLVVKQAATTDAGKYTAKASN-PAGTAESSAEAEVTQSLEKPTFVRELVTTEVKIN-ETATLSVTVKGVP-DPSVEWLKDGQPVQTDSSHV-IAKVEGSGSYSITIKDARLEDSGKYACRATNPAGEAKTEANFAVVKNLVPPEFVEKLSPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISI--DNVHVIQKQTAV----------------------GSFSLTINDARQGDVGIYSCRARNEAGE-----ALTTANFGIIRDSIPPEFTQKLRPLEVREQ-------ETLDLKVTVIGTPVPNVEWFKDDKPINIDNSHIFAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAPLFVQGLKPYEVEQGKPAELVVRVEGKPEPE-VKWF---KDGVP---------IAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEVKPLFIEPL-KETFAVEGDTVVLECKVNKESHPQIKFFKNDQPVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKI-------QFAAKVEEHVTDESGQLEEIGQFETVGDTASSK-------TDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIV 3907          

HSP 4 Score: 99.7525 bits (247), Expect = 2.170e-20
Identity = 181/828 (21.86%), Postives = 298/828 (35.99%), Query Frame = 3
Query: 2559 DIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWC----EVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFS---EKTFAANTEPLSLKLVLDGFKYAPESDLIF--NNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYL-----------------FRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKN-------------FHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPV---SAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKC--SLKINGATVNDSGTYQAVLKETGQTQTT--------------IVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTT--------SDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTS-----------PKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLK-IRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLP 4802
            +++W+KD + I       I    N+  G  ++ I    ESD G Y C    E+    +       +L  V  +K+    PK +   E       +P+ L   +D     P + +++  + +P+  +  +    +      +  N  +   +D+G Y                   +V  ++V K     GE+P F        +  GDS  +   +                 +  P+T+I                   + +G     + + T +  G Y C+  N  G+   K Q +A   +   +T  P       P    +LSD  V  S+G+ I L+ +     +  V W KD  PL   D R + +  E SK    L+I  ATV+D GTY+ V      + TT              +    P +F   + D    +R  +   + + C V++ P    + +     DG+             I  P +++     +I L  D V T         D G Y +   N +G +      TV  L      + S           PK ++ L+  I  P  +   +RCK SG+P P +KW K+GE +     L+ I       ELV+ +  + DAG Y   A NT GS  + C + VI                          +P D +S I   +              P F T  T    K GD V  +C   G P P I W        ++ + +M+   D    LIL ++     G +   A N  G A+  A ++++        DR+     S+PLP
Sbjct: 5307 EVEWFKDGKKIEHTAHTEIR---NTVDGACRIKIIPFEESDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTVNGGQPIRLSCKVDAI---PRASVVWYKDGLPLRADSRTSIQYEEDGTATLAINDST--EEDIGAYRCVATNAHGTINTSCSVNVKVPKQEVKKE----GEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVI-----------------ETSPDGSCSLTVNESTMSDEGIYRCEAENAHGK--AKTQATAHVQMALGKTEKPKMDEGKPPKFILELSDMSV--SLGNVIDLECKVTGLPNPSVKWSKDGGPL-IEDSRFE-WSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTASQPPRFTLKMGD----VRTTEGQPLKLECKVDASPLPEMVWYK----DGA-------------IVTPSDRI-----QISLSPDGVATLLIPSCVYDDDGIYRVIATNPSGTAQDKGTATVKKLPRDSGARRSADRDVFDANKAPKLMEPLEN-IRIPEKQSFRLRCKFSGDPKPTIKWFKDGERVFPYGRLQLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVI----------------------RGDRKPRDIDSSIREGKA-------------PGFTTPLTIRRAKPGDSVTFECLPFGNPFPSIKWLKDGLELFSDEKIKMEAAADGTQRLILSDVTFLSEGYFRCVATNEHGTASTKAELVIEG-------DRT---IGSRPLP 6027          

HSP 5 Score: 90.5077 bits (223), Expect = 1.475e-17
Identity = 168/787 (21.35%), Postives = 301/787 (38.25%), Query Frame = 3
Query: 2547 KDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGT---VIPKFSE---KTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPI--------------------------NVNHSSCPWSKVS------SNEMIQFNHR--------SVSLKDVGQYLFRVSSKDVAKTHLEIGE-KPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFG----EDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQ--TQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGET-HELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDS 4742
            K + +++W+KD   I    D + +++   ++G   + I +   +D G+Y C+  N          + +  +S ++ T   V P F E   +TFA   + + L+  ++   + P+     N+ P+                          +V    C    V+      ++  IQF  +        S  L+++GQ+    +  D A +  + G   PEFV    +  ++     AI   +K   K  P+  I    +          +    D+G L       TQA  G+Y C+  NE+G    E  + + L  A  +       P   +P+  + +       +VG++  L+ +        V W K+ + L   D R++I   ++    L +  A ++D   Y+     E G   +  T+    P Q AP       +I+ K+  +    C V+   +   + W     DG+P   L  + R               QR  L  ++  T D G Y + V N AG ++  +P+TV      +        I+K   ++      K+++  +V G P  + KW K  E ++ S   KI +V E+ ++L I++ + SD G Y    S  + S         ++   +V  TK  EK IS                                    P F     D+ V +G  +VL+  + G P+ + W+  N   I + + E      +Y L + + Q+ D G YS+TA N +G     A V V +
Sbjct: 3606 KPEPEVKWFKDGVPIA--IDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEVKPLFIEPLKETFAVEGDTVVLECKVNKESH-PQIKFFKNDQPVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFE---TVGDTASSKTDTGRGAPEFV-ELLRSCTVTEKQQAI---LKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGE---APDFLQPVKPAVV-------TVGETAVLEGKISGKPKPSVKWYKNGEELKPSD-RVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEPAQVAPGFFKELSAIQVKETETAKFECKVSG--TKPDVKWF---KDGTP---LKEDKRVH-----FESTDDGTQR--LVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTVVPSETLK--------IKKGLTDVNVTQGTKILLSVEVEGKPKTV-KWYKGTETVTSSQTTKIVQVTESEYKLEIESAEMSDTGAYRVVLSTDSFS---------VESSATVTVTKAAEK-ISL-----------------------------------PSFKKGLADQSVPKGTPLVLEVEIEGKPKDVKWYK-NGDEIKDGKVEDLGN-GKYRLTIPDFQEKDVGEYSVTAANEAGEIESKAKVNVSA 4300          

HSP 6 Score: 84.7297 bits (208), Expect = 8.281e-16
Identity = 117/484 (24.17%), Postives = 189/484 (39.05%), Query Frame = 3
Query: 3444 SIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSI---------------RAKQNGSINIVCV--VNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAA--------LAE--AQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGET-----HELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYN-THFINNPRFEMKR-ELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALV-----IVDSHNKNHSIDRSQY 4778
            S +L  +F  D    + W KD + +     R+Q+    +  C L ++ AT  D+G Y+ V + T  +  T  ++N I+     +D   SI               RAK   S+   C+   N +P   SI W     DG     L ++ + KM            QR  L   +VT    G +     N  G +S    + +          L E   + ++  P+  + L    I   N   ++ C  +G P P +KW K+G+E+   D    ++V  T     H LVI N    D G Y  +A+N  GS  ++  L +I P                      R+    D       +R  M F       PP FV    ++ V      +  C ++G+P P + W +N    +   R +++      + LI+ +    D+G Y  TA+NS G A+ SA++      +DS   N  ID + Y
Sbjct: 5831 SFRLRCKFSGDPKPTIKWFKDGERVFPYG-RLQLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVIRGDRKPRDIDSSIREGKAPGFTTPLTIRRAKPGDSVTFECLPFGNPFP---SIKWL---KDG---LELFSDEKIKM-----EAAADGTQR--LILSDVTFLSEGYFRCVATNEHGTASTKAELVIEGDRTIGSRPLPEVNGEPEECKPRIRRGLYNMSIHEGNVVEMIVC-ATGIPTPTVKWYKDGQEIV-GDGPDGKRVIFTDERGIHHLVIVNASPDDEGEYSLEATNKLGSAKTEGSLNIIRP----------------------RHIADAD-------ERGGMPF-------PPGFVRQLKNKHVFNHMPTIFDCLVVGHPAPEVEWFHNGKKIVPGGRIKIQSCGGGSHALIILDTTLEDAGEYVATAKNSHGSASSSAVLDVTVPFLDSIKFNGEIDVTPY 6259          

HSP 7 Score: 77.0258 bits (188), Expect = 1.492e-13
Identity = 160/759 (21.08%), Postives = 296/759 (39.00%), Query Frame = 3
Query: 2559 DIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNN---MPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK-DVAKTHLEIGEKPEFVYHQ-FKENSLL-GDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDV----LKLQLSAAEALISSQTLIPVSAKPISS--SQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQN-----GSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLD--KEIISPINEKVIVRCKVSGNPNPILKWMKNGEELS-ESDHLKIRKVGETHE--LVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEP-LIWWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHS 4760
            +I+WYK+ + I P    +     +    K ++ I +  + DA +Y   + +       SS  L      K+  +I    ++  +  + P+ L++   G   +P++   + N   +P      +    K+  N+ +     SV ++D G Y   V+++   A +  +I  +P+  + +  K+ S+  G++   S+         P+ + W             +   I  N   + E    T+     Y   + N   +D     + L+ +A EA  S+Q  +  +   +      L D  V  + G  +  +V+   +   DV WL+D   +++    I I   +++   L I  A + D+G Y   V+ E+G+ ++             + + P+ +R  +N     G  ++  V  S P    + W     +  P  +L      K I           ++ EL  +     DG +Y + + N+AG       +TV            P  ++ +D  K++     + V ++ KV G P  ++KW KNG+EL  ++D  K  +  E+ E  L I + KKSD G Y     N  G   S   + V     S  +++P                                        S   F++   D  V+EGD + L+C + G P P +IW         + R  M+  LD    L +++ +K D G+Y +TA+N +G AT    V V    +  S
Sbjct: 4520 EIKWYKNGKEITPSDKAQ---PGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEPKIIKGLEDQVVSIGS-PIKLEIETSG---SPKTVKWYKNGKELP-GAAAKTIKIQKIDDNKYVLEIPSSV-VEDTGDYKVEVANEAGSANSSGKITVEPKITFLKPLKDQSITEGENAEFSVETNT----KPRIVKW-----------YKNGQEIKPNSRFIIEQKTDTK-----YQLVIKNAVRDDADTYKIVLENTAGEAESSAQLTVKKAKAGLCKIVKGLEDQVV--AKGAKMVFEVKIQGE-PEDVRWLRDANVISAGANAI-IEKIDDTTYRLIIPSADLKDAGEYTVEVINESGKAKS--------DAKGEVDEKPEIVRGLENIEIPEGDDDVFKVEVSAP-VRQVKWYKNDQEIKPNSHL----EAKKIGP---------KKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVV----------KPNVLKIVDGLKDVDVEEPQPVELKVKVEGIPK-VIKWYKNGQELKPDADGFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHV----KSAKSSEPT---------------------------------------SGANFLSPLKDTEVEEGDMLTLQCTIAGEPFPEVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVTVTEQGEQPS 5169          

HSP 8 Score: 77.0258 bits (188), Expect = 1.825e-13
Identity = 166/756 (21.96%), Postives = 281/756 (37.17%), Query Frame = 3
Query: 2565 QWYKDNEAILPDCDPRILLQCNSQ-SGKM--KMHIDNCRESDAGQYWCEVRN--GPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDG---FKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQY-LFRVSSKDVAKTHLEI---GEKPEFVYHQFKENSLLGDSLAISIPMK-------NFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQF--APVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPI----NEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRK---VGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVI-DPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN--NPRFEMKRE-LDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +W KD + I  +   RI +Q  +   G +  ++ +DN    DAG+Y C V N  G      +  V+ S   +K     P+F        T   S K+VL+     +  P+   + +N    +   S     V   E +     S  L   G+Y     +++  +KT   +   GE P F      +   +G+ L +S  +K       +F+  S  T +  K  +         +T  N +  +V  I + T+  +  Y    +N  G        + + + I+++   PV  + +  + + +        + IK++V+     + DV W KD++P++          PE    +L +  A   D+G Y A       T  +  E    Q    P       +   K N +  +   V   P   S+ W     DG P +   ++   K+       +T    R+E         D G+Y  R  N AG +      T A  A  +N    P+F++KL     SP+     E   +  KV G P P ++W K+   +S  +   I+K   VG +  L I + ++ D GIY  +A N  G  ++  +  +I D I                                                 PP+F        V+E + + LK  +IG P P + W  +   IN  N     K E    + L +K  +  D G Y+  A N +G A  +A + V
Sbjct: 2919 KWLKDGKEI--ELIARIRVQTRTGPEGHITQELVLDNVTPEDAGKYTCIVENTAGKDTCEATLTVIES-LEKKSEKKAPEFI-VALQDKTTKTSEKVVLECKVIGEPKPKVSWLHDNK--TITQESITVESVEGVERVTIT--SSELSHQGKYTCIAENTEGTSKTEAFLTVQGEAPVFTKELQNKELSIGEKLVLSCSVKGSPQPHVDFYSFSETTKVETKITSSSRIAIEHDQT--NTHWRMV--ISQITKEDIVSYKAIATNSIG-------TATSTSKITTKVEAPVFEQGLKKTSVKEK-------EEIKMEVKV-GGSAPDVEWFKDDKPVSEDGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEAEVTQSLEKPTFVRELVTTEVKINETATLSVTVKGVPD-PSVEWL---KDGQPVQTDSSHVIAKVEGSGSYSITIKDARLE---------DSGKYACRATNPAGEAK-----TEANFAVVKN-LVPPEFVEKL-----SPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISIDNVHVIQKQTAVG-SFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSI-------------------------------------------------PPEFTQKLRPLEVREQETLDLKVTVIGTPVPNVEWFKDDKPINIDNSHIFAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAV 3573          

HSP 9 Score: 75.485 bits (184), Expect = 4.594e-13
Identity = 167/786 (21.25%), Postives = 295/786 (37.53%), Query Frame = 3
Query: 2559 DIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSS------KDVAKTHLEIGEK---PEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKL-DKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETH-ELVIKNCKKSDAGIYEAQASNTNGSEV-SKCHLQVIDPIGSVNTTKPLE-------KPISFTI-----------------IP-----TERYQPADDNS------------------DISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            D++W+KD   +  D   R+  + ++  G  ++ I++ +  D G Y  EV N   V   +S V L+V   +   +    ++      T+ L L + ++G    P++   +       +  +    +V+ +E  +    S  + D G Y   +S+           T  +  EK   P F      ++   G  L + + ++      PK + W KN   +       K     NG+    IP F +  VG+Y+   +NE GE             I S+  + VSAKP   S L    V    G++   +V+    V   V W K+ + +    P  +     +   SL+I  A V D+  Y+ V+        +   +  ++ A   +D     + K      ++          + N  +K     P + +      K I     K  G+     L   N    D  +Y + V N AG +     +TV     A         ++ L D E+  P  +K +++ + +  P  I KW KNG+E++ SD  +    G+   +LVI +    DA  Y+   ++ +G+   S C L V  P       K LE        PI   I                 +P     T + Q  DDN                   ++++   +        V     F+    D+ + EG++          P  + W+        N RF ++++ D +Y L++KN  + D+  Y I  EN++G A  SA + V
Sbjct: 4047 DVKWFKDGTPLKED--KRVHFE-STDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVA--NSKVPLTVVPSETLKIKKGLTDVNVTQGTKIL-LSVEVEG---KPKTVKWYKGTETVTSSQTTKIVQVTESEY-KLEIESAEMSDTGAYRVVLSTDSFSVESSATVTVTKAAEKISLPSFKKGLADQSVPKGTPLVLEVEIEG----KPKDVKWYKNGDEIK----DGKVEDLGNGKYRLTIPDFQEKDVGEYSVTAANEAGE-------------IESKAKVNVSAKPEIVSGLVPTTV--KQGETATFNVKVKGPVKG-VKWYKNGKEI----PDAKTKDNGDGSYSLEIPNAQVEDAADYKVVVSNDAGDADSSAALT-VKLADDGKD-----KVKPEIVSGLIPTTVKQGETATFNVKVK----GPVKQVKWYKNGKEIPNAKAKDNGDGS-YSLEIPNAQLDDTADYKVVVSNDAGDADSSAALTVKLPGIA--------IVKGLEDAEV--PKGKKAVLQVETNKKPKEI-KWYKNGKEITPSDKAQPGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEPKIIKGLEDQVVSIGSPIKLEIETSGSPKTVKWYKNGKELPGAAAKTIKIQKIDDNKYVLEIPSSVVEDTGDYKVEVANEAGSANSSGKITVEPKITFLKPLKDQSITEGENAEFSVETNTKPRIVKWYKNGQEIKPNSRFIIEQKTDTKYQLVIKNAVRDDADTYKIVLENTAGEAESSAQLTV 4772          

HSP 10 Score: 67.3958 bits (163), Expect = 1.312e-10
Identity = 119/524 (22.71%), Postives = 205/524 (39.12%), Query Frame = 3
Query: 3207 HKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN-SRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK-ETGQTQTT---IVEINPIQ--FAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINK-PLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGET--HELVIKNCK--KSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN--NPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            H  Y +++G     I        G YTC  +NE+G+       ++  A      +   +A P   ++L D       GD I  + E       ++VWL D+QPL  S D R+Q Y  + +K  L+I  A  +D+G Y   ++ E G  ++     V+ +P +   AP  Q   + +   +   +    V+   P+   I W I   +G P   L  + + K I++  +  LT  ++ +  +FD + T  G    L   +  G   V +P               P F + L+ + +      V+    VSG P P L +   G+EL   +   +  VG    + + I N    K D  I  A+A N +G+  S+  L V                           +  ++ S                 RS P F+    D+ VK G+  V +  + G P P + W  N H ++  +P  +++    ++ L + + Q   +G     AEN+ G     A ++V
Sbjct:  594 HTFYSDEDGFFAMTIDPVQVTDTGRYTCMATNEYGQ-------ASTSAFFRVLKVEKEAAPPAFVTKLRDKEC--KEGDVIDFECEVEGWPEPELVWLVDDQPLRPSHDFRLQ-YDGQTAK--LEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPDKNHVAPEFQATIEYVECDEGEEVRFKSVITGDPNPEII-WFI---NGKP---LSESEKVKFISEDGICILT--IKDVTRHFDGMVTCQGSNR-LGSASCDGRLKVRVP------------PAPPTFNKPLEDKTVQE-KSTVVFEVDVSGWPEPTLTFTLCGKELKNGEE-GVEIVGHDGFYRISIPNTSMDKHDGEIV-AKAQNEHGTAESRARLTV---------------------------EQEEEES-----------------RSAPTFLKDIEDQTVKTGEFAVFETTVRGNPNPEVTWFINGHKMDQGSPGVKIEAHNHDHKLTIDSAQY--AGTVLCRAENAVGRFETKARLVV 1034          

HSP 11 Score: 66.6254 bits (161), Expect = 2.226e-10
Identity = 72/297 (24.24%), Postives = 119/297 (40.07%), Query Frame = 3
Query: 3486 DVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK-ETGQTQTTIV--------EINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE 4349
            D+ W KD+  L+  D R   Y  E+   ++ I+   V D+G Y  +   E GQ  T+          E  P  F   ++D       K+   I+  C V  +P    + W +      P+ +               +L  + Q  +L   +    D G Y ++++N  G  S+     +   A+      +P+F Q   + +     E+V  +  ++G+PNP + W  NG+ LSES+ +K         L IK+  +   G+   Q SN  GS      L+V  P       KPLE
Sbjct:  578 DITWYKDDVQLH-EDERHTFYSDEDGFFAMTIDPVQVTDTGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRD----KECKEGDVIDFECEVEGWPEPELV-WLVDDQPLRPSHDF--------------RLQYDGQTAKLEIRDAQPDDTGVYTVKIQNEFG--SIESKAELFVQADPDKNHVAPEF-QATIEYVECDEGEEVRFKSVITGDPNPEIIWFINGKPLSESEKVKFISEDGICILTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPPAPPTFNKPLE 851          

HSP 12 Score: 65.4698 bits (158), Expect = 5.990e-10
Identity = 54/240 (22.50%), Postives = 94/240 (39.17%), Query Frame = 3
Query: 4032 SPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIR-KVGE----THELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +PKFI K+ K+  +      +  C V        KW+K+G+E+     ++++ + G     T ELV+ N    DAG Y     NT G +  +  L VI+          LEK                                    +  P+F+    D+  K  + VVL+C +IG P+P + W ++   I      ++       + + + +    G+Y+  AEN+ G +   A + V
Sbjct: 2886 APKFITKI-KDTKAKKGHSAVFECVVPDTKGVCCKWLKDGKEIELIARIRVQTRTGPEGHITQELVLDNVTPEDAGKYTCIVENTAGKDTCEATLTVIE---------SLEKKSE---------------------------------KKAPEFIVALQDKTTKTSEKVVLECKVIGEPKPKVSWLHDNKTITQESITVESVEGVERVTITSSELSHQGKYTCIAENTEGTSKTEAFLTV 3082          

HSP 13 Score: 60.077 bits (144), Expect = 2.283e-8
Identity = 68/296 (22.97%), Postives = 114/296 (38.51%), Query Frame = 3
Query: 3930 GGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKL-DKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRY---------SITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSN 4787
             G    R EN+ G       + V A    + +K  PKF++ L DK     ++  V+   +V G P P + W   GEEL +SD ++IR+   + ++ IKN K  DAG   A A+N+ GS+ +K  L V             +KP +                                    P+F        V++G + V      G P P   WS N   + + +   +   DE  +   +I   D+  Y         S+ AEN+ G     A + ++   ++  +++    S+
Sbjct: 1012 AGTVLCRAENAVGRFETKARLVVLA---PEKQKKPPKFVEILVDK--TETVDNTVVFEVRVEGEPKPTVTWYLKGEELKQSDRVEIREFDGSIKISIKNIKIEDAGEIRAVATNSEGSDETKAKLTV------------QKKPFA------------------------------------PEFDLRPVSLTVEKGSEAVFSAHAFGIPLPTYEWSVNGRKVRDGQEGARVTRDESTVDGASILTIDTATYYSEVNHLTISVVAENTLGAEETGAQLTIEPKKESVVVEKQDLSSS 1254          

HSP 14 Score: 57.3806 bits (137), Expect = 1.495e-7
Identity = 82/345 (23.77%), Postives = 150/345 (43.48%), Query Frame = 3
Query: 3279 DYTCQV-SNEFGEDVLKLQLSAAEALISSQTLIPV------SAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSG--TYQAVLKETGQTQTTI-VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSG-NPNPILKWMKNGEELSESDHLKIRKVGE-THELVIKNCKKSDAGIYEAQASNTNG 4277
            ++ C + +  FG   + +  S A   + ++T + V      + KP  + +L D  VT   GD++++DV   A  S    W ++   L      + I   EE+K SL I  A   DSG  T +A   E G ++++  + +NP    P++ D P+S+  K+  +      ++ +P+  ++ W+I          +V  +R     K  +  T       L   N      G   +  +NSAG  S    + V    +A      PKF  +L  ++     E +    ++ G +P   + W+ NG+ L++SD +++   G+ T+ + I   K   +G   A+A N  G
Sbjct: 1938 EFRCSIDTTMFGSGTVSVVASNAAGSVETKTELKVLETPKETKKPEFTDKLRDMEVTK--GDTVQMDV--IALHSPLYKWYQNGNLLEDGKNGVTIKN-EENKSSLIIPNA--QDSGKITVEAS-NEVGSSESSAQLTVNPPSTTPIVVDGPKSVTIKETETAEFKATISGFPA-PTVKWTI-------NEKIVEESRTITTIKTEDVYT-------LKISNAKIEQTGTVKVTAQNSAGQDSKQADLKVEPNVKA------PKFKSQLTDKVADE-GEPLRWNLELDGPSPGTEVSWLLNGQPLTKSDTVQVVDHGDGTYHVTIAEAKPEMSGTLTAKAKNAAG 2252          

HSP 15 Score: 57.3806 bits (137), Expect = 1.520e-7
Identity = 103/496 (20.77%), Postives = 173/496 (34.88%), Query Frame = 3
Query: 3282 YTCQVSNEFGEDVLKLQLSA--AEALISSQTLIPVS---AKPISSSQLSDNYVTGSVGDSIKLDVEFPA-DVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK-ETGQTQTTI-VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCL-IGYPEPLI-WWSYNTHFINNPRFEMKRELDEYF-LILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            YT ++SN   E    ++++A  +    S Q  + V      P   SQL+D       G+ ++ ++E       ++V WL + QPL   D  +Q+    +    + I  A    SGT  A  K   G+ +T+  V +N     P     PQ+       S+    +V   P   ++ W +        + L+ +   K+      K      +  +          G   +  EN +G       +   A  +   K   PKF   +D   +    E V     V G P P + W  NGE +S+  ++ +      H + I       AG    +A+N  GS+     L V                                                  V   P F     D ++ EG+  ++   L I  P+P I W        ++  +++  E D    L +   +  D GR +I AE+  G+A CSA + V
Sbjct: 2130 YTLKISNAKIEQTGTVKVTAQNSAGQDSKQADLKVEPNVKAPKFKSQLTDK--VADEGEPLRWNLELDGPSPGTEVSWLLNGQPLTKSD-TVQVVDHGDGTYHVTIAEAKPEMSGTLTAKAKNAAGECETSAKVTVNGGNKKPEFVQAPQNHETTLEESVKFSAIVTGKP-MPNVTWYLN------NKKLIQSEEVKV------KYVHETGKTSIRIQKPLMEHNGTIRVEAENVSG------KVQATAQLKVDKKTEVPKFTTNMDDRQVKE-GEDVKFTANVEGYPEPSVAWTLNGEPVSKHPNITVTDKDGEHTIEISAVTPEQAGELSCEATNPVGSKKRDVQLAV------------------------------------------------KKVGDAPTFAKNLEDRLITEGELTLMDAKLNIVKPKPKITWLKDGVEITSDGHYKIVEEEDGSLKLSILQTKLEDKGRITIKAESEFGVAECSASLGV 2554          

HSP 16 Score: 51.6026 bits (122), Expect = 7.704e-6
Identity = 30/100 (30.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query: 4464 SPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEP-LIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSH-NKNH 4757
            +PP FVT   D+  KEGD +  +C + G+PEP L+W   +     +  F ++ +     L +++ Q  D+G Y++  +N  G     A + V +  +KNH
Sbjct:  646 APPAFVTKLRDKECKEGDVIDFECEVEGWPEPELVWLVDDQPLRPSHDFRLQYDGQTAKLEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPDKNH 745          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Fly
Match: Unc-89 (gene:FBgn0053519 transcript:FBtr0343285)

HSP 1 Score: 115.931 bits (289), Expect = 3.114e-25
Identity = 172/774 (22.22%), Postives = 303/774 (39.15%), Query Frame = 3
Query: 2562 IQWYKDN-----EAILPDCDPRILLQCNSQSGKMK----MHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAA----NTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNE--MIQFNHRSVSLKDVGQYLFRVSSKDVAKTHL-EIGEKPEFVYHQF-----KENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYIND-NGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK--ETGQTQTTIVEINPIQFAPVIQDFPQSIRA--------KQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKL-DKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYF-LILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQY 4778
            I+W+KD+     EAI      ++  + +++ G  +    + I + RE+D G Y C   N   V +  +P  L++ S     + P F +K   A      EPL L+  +DG    P    + +   +  + S     K+S+N   +++    S    D G Y   +S+    K  L  +  KPE +  +F      +  ++G+ L +   +  F   +P+ + W K+   L  +   +  +IN  NG++   I        G Y C ++N+ GE          E  +S   ++P  +KP+  ++L D   +   G  +K+D++   +    + W  +   +      I I    ++  SL I      DSG Y+ + +  E        + + P       ++ PQ + A         Q   ++   + N  P    + WS      +P   L+              +T + + I L       +D G Y   + N  G  S       A  A  +     P F QK+ D++ +   N K+ V   VSG P P L+W    + + +S+   I+  G+ H L++ NC+K D G+Y+  ASN  G ++++  L +++                                +I    R++          PP F+    D  + EG       C  GYPEP + W+  +     + RF +  E +    L +KN+ + D GRYS    N  G   C A +  DS +        QY
Sbjct: 1891 IEWFKDDKPINYEAINKPGKDKLYAKEDTKKGTDQIESVLDIKSFRENDVGAYTCVATNEIGVTK--APFKLAMLS-----LAPSFVKKLDNALDVLQGEPLVLECCVDGSPL-PTVQWLKDGDEVKPSESI----KISTNPDGLVKLEINSCQPNDSGAYKLIISNPHGEKVALCAVAVKPEEMQPKFLKPITSQTVVVGEPLKLEAQVTGFP--APE-VKWYKDGMLLRPSPEIN--FINSPNGQIGLIIDAAQPLDAGVYKCLIANKGGE---------IEG-VSKVEIVPKESKPVFVAELQD--ASSIEGFPVKMDIKVVGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKADETATEEAPQFVSALRDVNADEGQELVLSAPFISNPMPE---VIWSKDGVTLTPNERLL--------------MTCDGKHIGLTIKPAEAADSGNYTCLLANPLGEDSS------ACNANVRKVYKPPVFTQKISDQQQVFGNNAKIPV--TVSGVPYPDLEWYFQDKPIPKSEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIASNREGKDITQGRLDIVN--------------------------------EIKKHSRSE----------PPVFLKKIGDCDIYEGMVAKFTACATGYPEPEVEWFKNDQKLFPSDRFLIDIEPNGLLRLTIKNVTEYDVGRYSCRIFNPYGDDICHAELFYDSLDSQQKPLEDQY 2568          

HSP 2 Score: 97.0561 bits (240), Expect = 1.730e-19
Identity = 137/580 (23.62%), Postives = 213/580 (36.72%), Query Frame = 3
Query: 3222 NDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTI--VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKL-DKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELS-ESDHLKI-RKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHL---------------QVIDPIGSVNTTKPLE------------------------------------KPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRS---PPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI-NNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYP 4781
             D  E V +I  F +  VG YTC  +NE G       ++ A   ++  +L P   K +      DN +    G+ + L+          V WLKD   +   +  I+I    +    L+IN    NDSG Y+ ++      +  +  V + P +  P       S        + +   V  +P+   + W     DG   R    +     IN P      N Q I L  D     D G Y   + N  G       I   +  E   K++ P F+ +L D   I     K+ +  KV GNP P L+W  NG E+  ++ H+ I      +  L+I+     D+G+YE  A N  GS  SK  L               Q +  +  VN  +  E                                    K I  TI P E     +    +++P        N  VR    PP F    +D+    G++  +   + G P P + W +    I  + ++ +K + D + LI+ N +KGD G Y   A N  G       + + +  K HS  RS+ P
Sbjct: 1923 TDQIESVLDIKSFRENDVGAYTCVATNEIG-------VTKAPFKLAMLSLAPSFVKKL------DNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSE-SIKISTNPDGLVKLEINSCQPNDSGAYKLIISNPHGEKVALCAVAVKPEEMQPKFLKPITSQTVVVGEPLKLEAQVTGFPAPE-VKWY---KDGMLLRP---SPEINFINSP------NGQ-IGLIIDAAQPLDAGVYKCLIANKGG------EIEGVSKVEIVPKESKPVFVAELQDASSIEGFPVKMDI--KVVGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKADETATEEAPQFVSALRDVNADEGQELVLSAPFISNPMPEVIWSKDGVTLTPNERLLMTCDGKHIGLTIKPAEAADSGNYTCLLANPLGEDSSACNANVRKVYKPPVFTQKISDQQQVFGNNAKIPVTVSGVPYPDLEWYFQDKPIPKSEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIASNREGKDITQGRLDIVNEIKKHS--RSEPP 2464          

HSP 3 Score: 67.0106 bits (162), Expect = 2.379e-10
Identity = 152/753 (20.19%), Postives = 267/753 (35.46%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNE--MIQFNHRSVSLKD---VGQYLFRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKN-FHKMSPKTI--------IWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQ-AVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNAR----YKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESD-HLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGD-DVVLKCCLIGYPEPLIWWSYNTHFINNPR--FEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNK 4751
            + W KDN+ +      RI  Q  +     ++ I NC E+DAG Y        ++  +S+    +V +Q      P   E     NTEP  L  + D        + +F  M + +     P  K   +E  +++ N R   ++D   +G Y   ++  DV KT  + G       ++  E +   +++A ++  KN F  +S + +         WK+N       +     +  D   L            G YTC      G      +LS   A+   QTL     KP  +  +       S+G S  L+++        V W  D + +   D R +  Y +E   SL I      D+G Y    + E GQ +++I  +  ++  P I+     I      +I +   V  +P               PT  + NN +       +    + +  +++++ +    +  S  G Y ++  N    +S     TV         K+ P  ++  + E I    E V +  ++   P   L W  +  E+  +D    +   G  + L I    + DAG Y  +A+N +GS  S   L                                                   +++  P+F     +  V EGD +V L   +  YP P   W  +   I+  R  F    E +++ LI+  +     G Y+    N  G    + +V V+   K
Sbjct:  794 VTWLKDNKPLEDRLADRIT-QTAAPMNSYRLDIKNCSETDAGTY--------TIRAQSASETTTVSAQLAVGQAPGHDET--KTNTEPAFLVSLKDAEMI---ENTLFRFM-VKIIGDPKPRVKFYKDEKEILETNDRIQIIRDKDYLGFYELVIA--DVQKT--DAGTYSCKATNKHGEANC--EAIATTVEDKNPFGALSGQILPAGEKPVFQWKRNGEEFDPEERFKVLFGEDEDSLALVFQHVKPEDAGIYTCVAQTSTGNISCSAELSVQGAI---QTLNREPEKP--TLVIEHREANASIGGSAILELQCKGFPKPAVQWKHDGEVIQVDD-RHKFMYEDEESMSLVIKNVDTVDAGVYTIEAINELGQDESSINLV--VKAPPKIKKI-TDITCSAGETIKMEIEVEGFP--------------QPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIKATNDLSQTSEYWSCTV---------KSKPVIVKNFESEYIHGEKENVQMTVRIDAYPEAKLTWYHDETEIKITDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHGSATSSTQL---------------------------------------------------LIKCAPEFTHKLKNITVAEGDSNVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGNDFKLIMNQVATNMQGNYTCKIMNDYGKLEDNCVVTVNCKPK 1442          

HSP 4 Score: 63.929 bits (154), Expect = 1.785e-9
Identity = 131/619 (21.16%), Postives = 224/619 (36.19%), Query Frame = 3
Query: 3024 VAKTHLEIGEKPE------------FVYHQFKENSLLGDSLAISIPMKN---FHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQP-LNSRDPRIQIYYPE------ESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEII---SPINEKVIVRCKVSGNPNPILKWMK-----NGEELSESDHLKIRKVGETHE--------LVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEI-VKEGDDVVLKCCLIGYPEPLIWW---------SYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG--LATCSALV 4730
            V KT +   E+PE            F  H ++   L  + +A  IP      +H   P T                H     D      E+        G+Y   V N+ GE   + +LS +         I    KPI +       +  + GD +   V F AD + ++V LKD QP + + + ++++   +      +  C+L I  A + DSG Y+  +K       T   I+ +   P I       +     +I    +V + P    ++W+          NL N+   ++I         +  +  L F +V+  + G+Y +   NS G ++V     +A L E       P FI + + + I    P++ KV+V     G P P ++W K     N E +++    K+    +T +        L IK+ +++D G Y   A+N  G                                                   T+  F   ++   P FV    + + V +G+ +VL+CC+ G P P + W         S +     NP   +K E++       + Q  DSG Y +   N  G  +A C+  V
Sbjct: 1545 VTKTLIATTEEPEEGAVPEIVHVDVFQQHSYESVPLKYEVIATGIPKPEAIWYHDGKPIT-------------PDKHTAITVDGDHYKLEVQSLDLVDAGEYKVVVQNKVGEKSHQGELSLSG--------IAEYRKPILTQGPGLKDIKVNKGDKVCEPVVFTADPAPEIVLLKDGQPVVETNNVKLKVDKKDAENGLVQYTCTLNILEAEIKDSGRYELKVKNKYGELVTSGWID-VLAKPEISGL-NDTKCLPGDTICFEALVQANPK-PKVSWT------RGNENLCNHENCEVIADV------DADKYRLVFQSVSPCEDGKYTITATNSEGRAAV--DFNLAVLVE------KPTFIVQPESQSIHDYRPVSTKVLVH----GVPLPTIEWFKDDKPINYEAINKPGKDKLYAKEDTKKGTDQIESVLDIKSFRENDVGAYTCVATNEIGV--------------------------------------------------TKAPFKLAMLSLAPSFVKKLDNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSESIKISTNPDGLVKLEIN-------SCQPNDSGAYKLIISNPHGEKVALCAVAV 2058          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Fly
Match: Unc-89 (gene:FBgn0053519 transcript:FBtr0343287)

HSP 1 Score: 115.931 bits (289), Expect = 3.186e-25
Identity = 172/774 (22.22%), Postives = 303/774 (39.15%), Query Frame = 3
Query: 2562 IQWYKDN-----EAILPDCDPRILLQCNSQSGKMK----MHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAA----NTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSN--EMIQFNHRSVSLKDVGQYLFRVSSKDVAKTHL-EIGEKPEFVYHQF-----KENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYIND-NGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK--ETGQTQTTIVEINPIQFAPVIQDFPQSIRA--------KQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKL-DKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYF-LILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQY 4778
            I+W+KD+     EAI      ++  + +++ G  +    + I + RE+D G Y C   N   V +  +P  L++ S     + P F +K   A      EPL L+  +DG    P    + +   +  + S     K+S+N   +++    S    D G Y   +S+    K  L  +  KPE +  +F      +  ++G+ L +   +  F   +P+ + W K+   L  +   +  +IN  NG++   I        G Y C ++N+ GE          E  +S   ++P  +KP+  ++L D   +   G  +K+D++   +    + W  +   +      I I    ++  SL I      DSG Y+ + +  E        + + P       ++ PQ + A         Q   ++   + N  P    + WS      +P   L+              +T + + I L       +D G Y   + N  G  S       A  A  +     P F QK+ D++ +   N K+ V   VSG P P L+W    + + +S+   I+  G+ H L++ NC+K D G+Y+  ASN  G ++++  L +++                                +I    R++          PP F+    D  + EG       C  GYPEP + W+  +     + RF +  E +    L +KN+ + D GRYS    N  G   C A +  DS +        QY
Sbjct: 1829 IEWFKDDKPINYEAINKPGKDKLYAKEDTKKGTDQIESVLDIKSFRENDVGAYTCVATNEIGVTK--APFKLAMLS-----LAPSFVKKLDNALDVLQGEPLVLECCVDGSPL-PTVQWLKDGDEVKPSESI----KISTNPDGLVKLEINSCQPNDSGAYKLIISNPHGEKVALCAVAVKPEEMQPKFLKPITSQTVVVGEPLKLEAQVTGFP--APE-VKWYKDGMLLRPSPEIN--FINSPNGQIGLIIDAAQPLDAGVYKCLIANKGGE---------IEG-VSKVEIVPKESKPVFVAELQD--ASSIEGFPVKMDIKVVGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKADETATEEAPQFVSALRDVNADEGQELVLSAPFISNPMPE---VIWSKDGVTLTPNERLL--------------MTCDGKHIGLTIKPAEAADSGNYTCLLANPLGEDSS------ACNANVRKVYKPPVFTQKISDQQQVFGNNAKIPV--TVSGVPYPDLEWYFQDKPIPKSEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIASNREGKDITQGRLDIVN--------------------------------EIKKHSRSE----------PPVFLKKIGDCDIYEGMVAKFTACATGYPEPEVEWFKNDQKLFPSDRFLIDIEPNGLLRLTIKNVTEYDVGRYSCRIFNPYGDDICHAELFYDSLDSQQKPLEDQY 2506          

HSP 2 Score: 97.0561 bits (240), Expect = 1.535e-19
Identity = 137/579 (23.66%), Postives = 213/579 (36.79%), Query Frame = 3
Query: 3225 DNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTI--VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKL-DKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELS-ESDHLKI-RKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHL---------------QVIDPIGSVNTTKPLE------------------------------------KPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRS---PPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI-NNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYP 4781
            D  E V +I  F +  VG YTC  +NE G       ++ A   ++  +L P   K +      DN +    G+ + L+          V WLKD   +   +  I+I    +    L+IN    NDSG Y+ ++      +  +  V + P +  P       S        + +   V  +P+   + W     DG   R    +     IN P      N Q I L  D     D G Y   + N  G       I   +  E   K++ P F+ +L D   I     K+ +  KV GNP P L+W  NG E+  ++ H+ I      +  L+I+     D+G+YE  A N  GS  SK  L               Q +  +  VN  +  E                                    K I  TI P E     +    +++P        N  VR    PP F    +D+    G++  +   + G P P + W +    I  + ++ +K + D + LI+ N +KGD G Y   A N  G       + + +  K HS  RS+ P
Sbjct: 1862 DQIESVLDIKSFRENDVGAYTCVATNEIG-------VTKAPFKLAMLSLAPSFVKKL------DNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSE-SIKISTNPDGLVKLEINSCQPNDSGAYKLIISNPHGEKVALCAVAVKPEEMQPKFLKPITSQTVVVGEPLKLEAQVTGFPAPE-VKWY---KDGMLLRP---SPEINFINSP------NGQ-IGLIIDAAQPLDAGVYKCLIANKGG------EIEGVSKVEIVPKESKPVFVAELQDASSIEGFPVKMDI--KVVGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKADETATEEAPQFVSALRDVNADEGQELVLSAPFISNPMPEVIWSKDGVTLTPNERLLMTCDGKHIGLTIKPAEAADSGNYTCLLANPLGEDSSACNANVRKVYKPPVFTQKISDQQQVFGNNAKIPVTVSGVPYPDLEWYFQDKPIPKSEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIASNREGKDITQGRLDIVNEIKKHS--RSEPP 2402          

HSP 3 Score: 66.6254 bits (161), Expect = 2.907e-10
Identity = 152/753 (20.19%), Postives = 267/753 (35.46%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNE--MIQFNHRSVSLKD---VGQYLFRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKN-FHKMSPKTI--------IWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQ-AVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNAR----YKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESD-HLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGD-DVVLKCCLIGYPEPLIWWSYNTHFINNPR--FEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNK 4751
            + W KDN+ +      RI  Q  +     ++ I NC E+DAG Y        ++  +S+    +V +Q      P   E     NTEP  L  + D        + +F  M + +     P  K   +E  +++ N R   ++D   +G Y   ++  DV KT  + G       ++  E +   +++A ++  KN F  +S + +         WK+N       +     +  D   L            G YTC      G      +LS   A+   QTL     KP  +  +       S+G S  L+++        V W  D + +   D R +  Y +E   SL I      D+G Y    + E GQ +++I  +  ++  P I+     I      +I +   V  +P               PT  + NN +       +    + +  +++++ +    +  S  G Y ++  N    +S     TV         K+ P  ++  + E I    E V +  ++   P   L W  +  E+  +D    +   G  + L I    + DAG Y  +A+N +GS  S   L                                                   +++  P+F     +  V EGD +V L   +  YP P   W  +   I+  R  F    E +++ LI+  +     G Y+    N  G    + +V V+   K
Sbjct:  757 VTWLKDNKPLEDRLADRIT-QTAAPMNSYRLDIKNCSETDAGTY--------TIRAQSASETTTVSAQLAVGQAPGHDET--KTNTEPAFLVSLKDAEMI---ENTLFRFM-VKIIGDPKPRVKFYKDEKEILETNDRIQIIRDKDYLGFYELVIA--DVQKT--DAGTYSCKATNKHGEANC--EAIATTVEDKNPFGALSGQILPAGEKPVFQWKRNGEEFDPEERFKVLFGEDEDSLALVFQHVKPEDAGIYTCVAQTSTGNISCSAELSVQGAI---QTLNREPEKP--TLVIEHREANASIGGSAILELQCKGFPKPAVQWKHDGEVIQVDD-RHKFMYEDEESMSLVIKNVDTVDAGVYTIEAINELGQDESSINLV--VKAPPKIKKI-TDITCSAGETIKMEIEVEGFP--------------QPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIKATNDLSQTSEYWSCTV---------KSKPVIVKNFESEYIHGEKENVQMTVRIDAYPEAKLTWYHDETEIKITDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHGSATSSTQL---------------------------------------------------LIKCAPEFTHKLKNITVAEGDSNVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGNDFKLIMNQVATNMQGNYTCKIMNDYGKLEDNCVVTVNCKPK 1405          

HSP 4 Score: 63.929 bits (154), Expect = 1.923e-9
Identity = 116/543 (21.36%), Postives = 202/543 (37.20%), Query Frame = 3
Query: 3207 HKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQP-LNSRDPRIQIYYPE------ESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEII---SPINEKVIVRCKVSGNPNPILKWMK-----NGEELSESDHLKIRKVGETHE--------LVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEI-VKEGDDVVLKCCLIGYPEPLIWW---------SYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG--LATCSALV 4730
            H     D      E+        G+Y   V N+ GE   + +LS +         I    KPI +       +  + GD +   V F AD + ++V LKD QP + + + ++++   +      +  C+L I  A + DSG Y+  +K       T   I+ +   P I       +     +I    +V + P    ++W+          NL N+   ++I         +  +  L F +V+  + G+Y +   NS G ++V     +A L E       P FI + + + I    P++ KV+V     G P P ++W K     N E +++    K+    +T +        L IK+ +++D G Y   A+N  G                                                   T+  F   ++   P FV    + + V +G+ +VL+CC+ G P P + W         S +     NP   +K E++       + Q  DSG Y +   N  G  +A C+  V
Sbjct: 1546 HTAITVDGDHYKLEVQSLDLVDAGEYKVVVQNKVGEKSHQGELSLSG--------IAEYRKPILTQGPGLKDIKVNKGDKVCEPVVFTADPAPEIVLLKDGQPVVETNNVKLKVDKKDAENGLVQYTCTLNILEAEIKDSGRYELKVKNKYGELVTSGWID-VLAKPEISGL-NDTKCLPGDTICFEALVQANPK-PKVSWT------RGNENLCNHENCEVIADV------DADKYRLVFQSVSPCEDGKYTITATNSEGRAAV--DFNLAVLVE------KPTFIVQPESQSIHDYRPVSTKVLVH----GVPLPTIEWFKDDKPINYEAINKPGKDKLYAKEDTKKGTDQIESVLDIKSFRENDVGAYTCVATNEIGV--------------------------------------------------TKAPFKLAMLSLAPSFVKKLDNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSESIKISTNPDGLVKLEIN-------SCQPNDSGAYKLIISNPHGEKVALCAVAV 1996          

HSP 5 Score: 52.7582 bits (125), Expect = 4.939e-6
Identity = 125/595 (21.01%), Postives = 233/595 (39.16%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSN----EMIQFNHRSVSLKDVGQYLFRVSSKDVAKTH----LEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDS-IKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVT---TSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV 4307
            +QW  D E I  D   + + +       M + I N    DAG Y  E  N   + +  S + L V   K    I K ++ T +A  E + +++ ++GF   P+  +   N   +V   S      SS     E +    + + L   G Y  + ++ D+++T       +  KP  V   F+   + G+   + + ++      P+  +   +         S  T  +D      +I   T+   G YT + +NE G            A  S+Q LI  +  P  + +L +  +T + GDS ++L V   A       W  D   ++ +    + +  E +   L +N    N  G Y   ++ + G+ +   V    +   P ++   +++  ++  S  +   V S P    I W     DG     +  +AR K        ++ + QRIE Y+  +    T D G Y ++  N  G ++    + V  + E  +        Q+   E + P+  +VI     +G P P   W  +G+ ++   H  I   G+ ++L +++    DAG Y+    N  G +  +  L +
Sbjct: 1054 VQWKHDGEVIQVDDRHKFMYE---DEESMSLVIKNVDTVDAGVYTIEAIN--ELGQDESSINLVV---KAPPKIKKITDITCSAG-ETIKMEIEVEGF---PQPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIK-ATNDLSQTSEYWSCTVKSKPVIV-KNFESEYIHGEKENVQMTVRI--DAYPEAKLTWYHDETEIKITDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHGS-----------ATSSTQLLIKCA--PEFTHKLKN--ITVAEGDSNVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFR-HVEEGNDFKLIMNQVATNMQGNYTCKIMNDYGKLEDNCVVT--VNCKPKVKRGLKNVEVQEGKSFTLEVEVYSEPEA-KIKWF---KDG---HEIYEDARIK--------ISRDTQRIENYYLTLNLARTEDAGTYEMKATNFIGETTSTCKVAVLTVPEIVHVDV----FQQHSYESV-PLKYEVIA----TGIPKPEAIWYHDGKPITPDKHTAITVDGDHYKLEVQSLDLVDAGEYKVVVQNKVGEKSHQGELSL 1590          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Fly
Match: Unc-89 (gene:FBgn0053519 transcript:FBtr0343284)

HSP 1 Score: 115.546 bits (288), Expect = 3.841e-25
Identity = 172/774 (22.22%), Postives = 303/774 (39.15%), Query Frame = 3
Query: 2562 IQWYKDN-----EAILPDCDPRILLQCNSQSGKMK----MHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAA----NTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSN--EMIQFNHRSVSLKDVGQYLFRVSSKDVAKTHL-EIGEKPEFVYHQF-----KENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYIND-NGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK--ETGQTQTTIVEINPIQFAPVIQDFPQSIRA--------KQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKL-DKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYF-LILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQY 4778
            I+W+KD+     EAI      ++  + +++ G  +    + I + RE+D G Y C   N   V +  +P  L++ S     + P F +K   A      EPL L+  +DG    P    + +   +  + S     K+S+N   +++    S    D G Y   +S+    K  L  +  KPE +  +F      +  ++G+ L +   +  F   +P+ + W K+   L  +   +  +IN  NG++   I        G Y C ++N+ GE          E  +S   ++P  +KP+  ++L D   +   G  +K+D++   +    + W  +   +      I I    ++  SL I      DSG Y+ + +  E        + + P       ++ PQ + A         Q   ++   + N  P    + WS      +P   L+              +T + + I L       +D G Y   + N  G  S       A  A  +     P F QK+ D++ +   N K+ V   VSG P P L+W    + + +S+   I+  G+ H L++ NC+K D G+Y+  ASN  G ++++  L +++                                +I    R++          PP F+    D  + EG       C  GYPEP + W+  +     + RF +  E +    L +KN+ + D GRYS    N  G   C A +  DS +        QY
Sbjct: 2119 IEWFKDDKPINYEAINKPGKDKLYAKEDTKKGTDQIESVLDIKSFRENDVGAYTCVATNEIGVTK--APFKLAMLS-----LAPSFVKKLDNALDVLQGEPLVLECCVDGSPL-PTVQWLKDGDEVKPSESI----KISTNPDGLVKLEINSCQPNDSGAYKLIISNPHGEKVALCAVAVKPEEMQPKFLKPITSQTVVVGEPLKLEAQVTGFP--APE-VKWYKDGMLLRPSPEIN--FINSPNGQIGLIIDAAQPLDAGVYKCLIANKGGE---------IEG-VSKVEIVPKESKPVFVAELQD--ASSIEGFPVKMDIKVVGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKADETATEEAPQFVSALRDVNADEGQELVLSAPFISNPMPE---VIWSKDGVTLTPNERLL--------------MTCDGKHIGLTIKPAEAADSGNYTCLLANPLGEDSS------ACNANVRKVYKPPVFTQKISDQQQVFGNNAKIPV--TVSGVPYPDLEWYFQDKPIPKSEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIASNREGKDITQGRLDIVN--------------------------------EIKKHSRSE----------PPVFLKKIGDCDIYEGMVAKFTACATGYPEPEVEWFKNDQKLFPSDRFLIDIEPNGLLRLTIKNVTEYDVGRYSCRIFNPYGDDICHAELFYDSLDSQQKPLEDQY 2796          

HSP 2 Score: 97.0561 bits (240), Expect = 1.910e-19
Identity = 137/579 (23.66%), Postives = 213/579 (36.79%), Query Frame = 3
Query: 3225 DNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTI--VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKL-DKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELS-ESDHLKI-RKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHL---------------QVIDPIGSVNTTKPLE------------------------------------KPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRS---PPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI-NNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYP 4781
            D  E V +I  F +  VG YTC  +NE G       ++ A   ++  +L P   K +      DN +    G+ + L+          V WLKD   +   +  I+I    +    L+IN    NDSG Y+ ++      +  +  V + P +  P       S        + +   V  +P+   + W     DG   R    +     IN P      N Q I L  D     D G Y   + N  G       I   +  E   K++ P F+ +L D   I     K+ +  KV GNP P L+W  NG E+  ++ H+ I      +  L+I+     D+G+YE  A N  GS  SK  L               Q +  +  VN  +  E                                    K I  TI P E     +    +++P        N  VR    PP F    +D+    G++  +   + G P P + W +    I  + ++ +K + D + LI+ N +KGD G Y   A N  G       + + +  K HS  RS+ P
Sbjct: 2152 DQIESVLDIKSFRENDVGAYTCVATNEIG-------VTKAPFKLAMLSLAPSFVKKL------DNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSE-SIKISTNPDGLVKLEINSCQPNDSGAYKLIISNPHGEKVALCAVAVKPEEMQPKFLKPITSQTVVVGEPLKLEAQVTGFPAPE-VKWY---KDGMLLRP---SPEINFINSP------NGQ-IGLIIDAAQPLDAGVYKCLIANKGG------EIEGVSKVEIVPKESKPVFVAELQDASSIEGFPVKMDI--KVVGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKADETATEEAPQFVSALRDVNADEGQELVLSAPFISNPMPEVIWSKDGVTLTPNERLLMTCDGKHIGLTIKPAEAADSGNYTCLLANPLGEDSSACNANVRKVYKPPVFTQKISDQQQVFGNNAKIPVTVSGVPYPDLEWYFQDKPIPKSEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIASNREGKDITQGRLDIVNEIKKHS--RSEPP 2692          

HSP 3 Score: 66.6254 bits (161), Expect = 2.802e-10
Identity = 152/753 (20.19%), Postives = 267/753 (35.46%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNE--MIQFNHRSVSLKD---VGQYLFRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKN-FHKMSPKTI--------IWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQ-AVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNAR----YKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESD-HLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGD-DVVLKCCLIGYPEPLIWWSYNTHFINNPR--FEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNK 4751
            + W KDN+ +      RI  Q  +     ++ I NC E+DAG Y        ++  +S+    +V +Q      P   E     NTEP  L  + D        + +F  M + +     P  K   +E  +++ N R   ++D   +G Y   ++  DV KT  + G       ++  E +   +++A ++  KN F  +S + +         WK+N       +     +  D   L            G YTC      G      +LS   A+   QTL     KP  +  +       S+G S  L+++        V W  D + +   D R +  Y +E   SL I      D+G Y    + E GQ +++I  +  ++  P I+     I      +I +   V  +P               PT  + NN +       +    + +  +++++ +    +  S  G Y ++  N    +S     TV         K+ P  ++  + E I    E V +  ++   P   L W  +  E+  +D    +   G  + L I    + DAG Y  +A+N +GS  S   L                                                   +++  P+F     +  V EGD +V L   +  YP P   W  +   I+  R  F    E +++ LI+  +     G Y+    N  G    + +V V+   K
Sbjct: 1047 VTWLKDNKPLEDRLADRIT-QTAAPMNSYRLDIKNCSETDAGTY--------TIRAQSASETTTVSAQLAVGQAPGHDET--KTNTEPAFLVSLKDAEMI---ENTLFRFM-VKIIGDPKPRVKFYKDEKEILETNDRIQIIRDKDYLGFYELVIA--DVQKT--DAGTYSCKATNKHGEANC--EAIATTVEDKNPFGALSGQILPAGEKPVFQWKRNGEEFDPEERFKVLFGEDEDSLALVFQHVKPEDAGIYTCVAQTSTGNISCSAELSVQGAI---QTLNREPEKP--TLVIEHREANASIGGSAILELQCKGFPKPAVQWKHDGEVIQVDD-RHKFMYEDEESMSLVIKNVDTVDAGVYTIEAINELGQDESSINLV--VKAPPKIKKI-TDITCSAGETIKMEIEVEGFP--------------QPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIKATNDLSQTSEYWSCTV---------KSKPVIVKNFESEYIHGEKENVQMTVRIDAYPEAKLTWYHDETEIKITDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHGSATSSTQL---------------------------------------------------LIKCAPEFTHKLKNITVAEGDSNVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGNDFKLIMNQVATNMQGNYTCKIMNDYGKLEDNCVVTVNCKPK 1695          

HSP 4 Score: 63.5438 bits (153), Expect = 2.325e-9
Identity = 116/543 (21.36%), Postives = 202/543 (37.20%), Query Frame = 3
Query: 3207 HKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQP-LNSRDPRIQIYYPE------ESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEII---SPINEKVIVRCKVSGNPNPILKWMK-----NGEELSESDHLKIRKVGETHE--------LVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEI-VKEGDDVVLKCCLIGYPEPLIWW---------SYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG--LATCSALV 4730
            H     D      E+        G+Y   V N+ GE   + +LS +         I    KPI +       +  + GD +   V F AD + ++V LKD QP + + + ++++   +      +  C+L I  A + DSG Y+  +K       T   I+ +   P I       +     +I    +V + P    ++W+          NL N+   ++I         +  +  L F +V+  + G+Y +   NS G ++V     +A L E       P FI + + + I    P++ KV+V     G P P ++W K     N E +++    K+    +T +        L IK+ +++D G Y   A+N  G                                                   T+  F   ++   P FV    + + V +G+ +VL+CC+ G P P + W         S +     NP   +K E++       + Q  DSG Y +   N  G  +A C+  V
Sbjct: 1836 HTAITVDGDHYKLEVQSLDLVDAGEYKVVVQNKVGEKSHQGELSLSG--------IAEYRKPILTQGPGLKDIKVNKGDKVCEPVVFTADPAPEIVLLKDGQPVVETNNVKLKVDKKDAENGLVQYTCTLNILEAEIKDSGRYELKVKNKYGELVTSGWID-VLAKPEISGL-NDTKCLPGDTICFEALVQANPK-PKVSWT------RGNENLCNHENCEVIADV------DADKYRLVFQSVSPCEDGKYTITATNSEGRAAV--DFNLAVLVE------KPTFIVQPESQSIHDYRPVSTKVLVH----GVPLPTIEWFKDDKPINYEAINKPGKDKLYAKEDTKKGTDQIESVLDIKSFRENDVGAYTCVATNEIGV--------------------------------------------------TKAPFKLAMLSLAPSFVKKLDNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSESIKISTNPDGLVKLEIN-------SCQPNDSGAYKLIISNPHGEKVALCAVAV 2286          

HSP 5 Score: 52.373 bits (124), Expect = 5.392e-6
Identity = 125/595 (21.01%), Postives = 233/595 (39.16%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSN----EMIQFNHRSVSLKDVGQYLFRVSSKDVAKTH----LEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDS-IKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVT---TSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV 4307
            +QW  D E I  D   + + +       M + I N    DAG Y  E  N   + +  S + L V   K    I K ++ T +A  E + +++ ++GF   P+  +   N   +V   S      SS     E +    + + L   G Y  + ++ D+++T       +  KP  V   F+   + G+   + + ++      P+  +   +         S  T  +D      +I   T+   G YT + +NE G            A  S+Q LI  +  P  + +L +  +T + GDS ++L V   A       W  D   ++ +    + +  E +   L +N    N  G Y   ++ + G+ +   V    +   P ++   +++  ++  S  +   V S P    I W     DG     +  +AR K        ++ + QRIE Y+  +    T D G Y ++  N  G ++    + V  + E  +        Q+   E + P+  +VI     +G P P   W  +G+ ++   H  I   G+ ++L +++    DAG Y+    N  G +  +  L +
Sbjct: 1344 VQWKHDGEVIQVDDRHKFMYE---DEESMSLVIKNVDTVDAGVYTIEAIN--ELGQDESSINLVV---KAPPKIKKITDITCSAG-ETIKMEIEVEGF---PQPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIK-ATNDLSQTSEYWSCTVKSKPVIV-KNFESEYIHGEKENVQMTVRI--DAYPEAKLTWYHDETEIKITDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHGS-----------ATSSTQLLIKCA--PEFTHKLKN--ITVAEGDSNVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFR-HVEEGNDFKLIMNQVATNMQGNYTCKIMNDYGKLEDNCVVT--VNCKPKVKRGLKNVEVQEGKSFTLEVEVYSEPEA-KIKWF---KDG---HEIYEDARIK--------ISRDTQRIENYYLTLNLARTEDAGTYEMKATNFIGETTSTCKVAVLTVPEIVHVDV----FQQHSYESV-PLKYEVIA----TGIPKPEAIWYHDGKPITPDKHTAITVDGDHYKLEVQSLDLVDAGEYKVVVQNKVGEKSHQGELSL 1880          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Fly
Match: Unc-89 (gene:FBgn0053519 transcript:FBtr0343283)

HSP 1 Score: 115.546 bits (288), Expect = 3.874e-25
Identity = 172/774 (22.22%), Postives = 303/774 (39.15%), Query Frame = 3
Query: 2562 IQWYKDN-----EAILPDCDPRILLQCNSQSGKMK----MHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAA----NTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSN--EMIQFNHRSVSLKDVGQYLFRVSSKDVAKTHL-EIGEKPEFVYHQF-----KENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYIND-NGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK--ETGQTQTTIVEINPIQFAPVIQDFPQSIRA--------KQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKL-DKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYF-LILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQY 4778
            I+W+KD+     EAI      ++  + +++ G  +    + I + RE+D G Y C   N   V +  +P  L++ S     + P F +K   A      EPL L+  +DG    P    + +   +  + S     K+S+N   +++    S    D G Y   +S+    K  L  +  KPE +  +F      +  ++G+ L +   +  F   +P+ + W K+   L  +   +  +IN  NG++   I        G Y C ++N+ GE          E  +S   ++P  +KP+  ++L D   +   G  +K+D++   +    + W  +   +      I I    ++  SL I      DSG Y+ + +  E        + + P       ++ PQ + A         Q   ++   + N  P    + WS      +P   L+              +T + + I L       +D G Y   + N  G  S       A  A  +     P F QK+ D++ +   N K+ V   VSG P P L+W    + + +S+   I+  G+ H L++ NC+K D G+Y+  ASN  G ++++  L +++                                +I    R++          PP F+    D  + EG       C  GYPEP + W+  +     + RF +  E +    L +KN+ + D GRYS    N  G   C A +  DS +        QY
Sbjct: 2120 IEWFKDDKPINYEAINKPGKDKLYAKEDTKKGTDQIESVLDIKSFRENDVGAYTCVATNEIGVTK--APFKLAMLS-----LAPSFVKKLDNALDVLQGEPLVLECCVDGSPL-PTVQWLKDGDEVKPSESI----KISTNPDGLVKLEINSCQPNDSGAYKLIISNPHGEKVALCAVAVKPEEMQPKFLKPITSQTVVVGEPLKLEAQVTGFP--APE-VKWYKDGMLLRPSPEIN--FINSPNGQIGLIIDAAQPLDAGVYKCLIANKGGE---------IEG-VSKVEIVPKESKPVFVAELQD--ASSIEGFPVKMDIKVVGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKADETATEEAPQFVSALRDVNADEGQELVLSAPFISNPMPE---VIWSKDGVTLTPNERLL--------------MTCDGKHIGLTIKPAEAADSGNYTCLLANPLGEDSS------ACNANVRKVYKPPVFTQKISDQQQVFGNNAKIPV--TVSGVPYPDLEWYFQDKPIPKSEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIASNREGKDITQGRLDIVN--------------------------------EIKKHSRSE----------PPVFLKKIGDCDIYEGMVAKFTACATGYPEPEVEWFKNDQKLFPSDRFLIDIEPNGLLRLTIKNVTEYDVGRYSCRIFNPYGDDICHAELFYDSLDSQQKPLEDQY 2797          

HSP 2 Score: 97.0561 bits (240), Expect = 1.863e-19
Identity = 137/579 (23.66%), Postives = 213/579 (36.79%), Query Frame = 3
Query: 3225 DNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTI--VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKL-DKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELS-ESDHLKI-RKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHL---------------QVIDPIGSVNTTKPLE------------------------------------KPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRS---PPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI-NNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYP 4781
            D  E V +I  F +  VG YTC  +NE G       ++ A   ++  +L P   K +      DN +    G+ + L+          V WLKD   +   +  I+I    +    L+IN    NDSG Y+ ++      +  +  V + P +  P       S        + +   V  +P+   + W     DG   R    +     IN P      N Q I L  D     D G Y   + N  G       I   +  E   K++ P F+ +L D   I     K+ +  KV GNP P L+W  NG E+  ++ H+ I      +  L+I+     D+G+YE  A N  GS  SK  L               Q +  +  VN  +  E                                    K I  TI P E     +    +++P        N  VR    PP F    +D+    G++  +   + G P P + W +    I  + ++ +K + D + LI+ N +KGD G Y   A N  G       + + +  K HS  RS+ P
Sbjct: 2153 DQIESVLDIKSFRENDVGAYTCVATNEIG-------VTKAPFKLAMLSLAPSFVKKL------DNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSE-SIKISTNPDGLVKLEINSCQPNDSGAYKLIISNPHGEKVALCAVAVKPEEMQPKFLKPITSQTVVVGEPLKLEAQVTGFPAPE-VKWY---KDGMLLRP---SPEINFINSP------NGQ-IGLIIDAAQPLDAGVYKCLIANKGG------EIEGVSKVEIVPKESKPVFVAELQDASSIEGFPVKMDI--KVVGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKADETATEEAPQFVSALRDVNADEGQELVLSAPFISNPMPEVIWSKDGVTLTPNERLLMTCDGKHIGLTIKPAEAADSGNYTCLLANPLGEDSSACNANVRKVYKPPVFTQKISDQQQVFGNNAKIPVTVSGVPYPDLEWYFQDKPIPKSEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIASNREGKDITQGRLDIVNEIKKHS--RSEPP 2693          

HSP 3 Score: 66.6254 bits (161), Expect = 2.826e-10
Identity = 152/753 (20.19%), Postives = 267/753 (35.46%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNE--MIQFNHRSVSLKD---VGQYLFRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKN-FHKMSPKTI--------IWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQ-AVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNAR----YKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESD-HLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGD-DVVLKCCLIGYPEPLIWWSYNTHFINNPR--FEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNK 4751
            + W KDN+ +      RI  Q  +     ++ I NC E+DAG Y        ++  +S+    +V +Q      P   E     NTEP  L  + D        + +F  M + +     P  K   +E  +++ N R   ++D   +G Y   ++  DV KT  + G       ++  E +   +++A ++  KN F  +S + +         WK+N       +     +  D   L            G YTC      G      +LS   A+   QTL     KP  +  +       S+G S  L+++        V W  D + +   D R +  Y +E   SL I      D+G Y    + E GQ +++I  +  ++  P I+     I      +I +   V  +P               PT  + NN +       +    + +  +++++ +    +  S  G Y ++  N    +S     TV         K+ P  ++  + E I    E V +  ++   P   L W  +  E+  +D    +   G  + L I    + DAG Y  +A+N +GS  S   L                                                   +++  P+F     +  V EGD +V L   +  YP P   W  +   I+  R  F    E +++ LI+  +     G Y+    N  G    + +V V+   K
Sbjct: 1048 VTWLKDNKPLEDRLADRIT-QTAAPMNSYRLDIKNCSETDAGTY--------TIRAQSASETTTVSAQLAVGQAPGHDET--KTNTEPAFLVSLKDAEMI---ENTLFRFM-VKIIGDPKPRVKFYKDEKEILETNDRIQIIRDKDYLGFYELVIA--DVQKT--DAGTYSCKATNKHGEANC--EAIATTVEDKNPFGALSGQILPAGEKPVFQWKRNGEEFDPEERFKVLFGEDEDSLALVFQHVKPEDAGIYTCVAQTSTGNISCSAELSVQGAI---QTLNREPEKP--TLVIEHREANASIGGSAILELQCKGFPKPAVQWKHDGEVIQVDD-RHKFMYEDEESMSLVIKNVDTVDAGVYTIEAINELGQDESSINLV--VKAPPKIKKI-TDITCSAGETIKMEIEVEGFP--------------QPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIKATNDLSQTSEYWSCTV---------KSKPVIVKNFESEYIHGEKENVQMTVRIDAYPEAKLTWYHDETEIKITDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHGSATSSTQL---------------------------------------------------LIKCAPEFTHKLKNITVAEGDSNVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGNDFKLIMNQVATNMQGNYTCKIMNDYGKLEDNCVVTVNCKPK 1696          

HSP 4 Score: 63.5438 bits (153), Expect = 2.364e-9
Identity = 116/543 (21.36%), Postives = 202/543 (37.20%), Query Frame = 3
Query: 3207 HKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQP-LNSRDPRIQIYYPE------ESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEII---SPINEKVIVRCKVSGNPNPILKWMK-----NGEELSESDHLKIRKVGETHE--------LVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEI-VKEGDDVVLKCCLIGYPEPLIWW---------SYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG--LATCSALV 4730
            H     D      E+        G+Y   V N+ GE   + +LS +         I    KPI +       +  + GD +   V F AD + ++V LKD QP + + + ++++   +      +  C+L I  A + DSG Y+  +K       T   I+ +   P I       +     +I    +V + P    ++W+          NL N+   ++I         +  +  L F +V+  + G+Y +   NS G ++V     +A L E       P FI + + + I    P++ KV+V     G P P ++W K     N E +++    K+    +T +        L IK+ +++D G Y   A+N  G                                                   T+  F   ++   P FV    + + V +G+ +VL+CC+ G P P + W         S +     NP   +K E++       + Q  DSG Y +   N  G  +A C+  V
Sbjct: 1837 HTAITVDGDHYKLEVQSLDLVDAGEYKVVVQNKVGEKSHQGELSLSG--------IAEYRKPILTQGPGLKDIKVNKGDKVCEPVVFTADPAPEIVLLKDGQPVVETNNVKLKVDKKDAENGLVQYTCTLNILEAEIKDSGRYELKVKNKYGELVTSGWID-VLAKPEISGL-NDTKCLPGDTICFEALVQANPK-PKVSWT------RGNENLCNHENCEVIADV------DADKYRLVFQSVSPCEDGKYTITATNSEGRAAV--DFNLAVLVE------KPTFIVQPESQSIHDYRPVSTKVLVH----GVPLPTIEWFKDDKPINYEAINKPGKDKLYAKEDTKKGTDQIESVLDIKSFRENDVGAYTCVATNEIGV--------------------------------------------------TKAPFKLAMLSLAPSFVKKLDNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSESIKISTNPDGLVKLEIN-------SCQPNDSGAYKLIISNPHGEKVALCAVAV 2287          

HSP 5 Score: 52.373 bits (124), Expect = 5.347e-6
Identity = 125/595 (21.01%), Postives = 233/595 (39.16%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSN----EMIQFNHRSVSLKDVGQYLFRVSSKDVAKTH----LEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDS-IKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVT---TSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV 4307
            +QW  D E I  D   + + +       M + I N    DAG Y  E  N   + +  S + L V   K    I K ++ T +A  E + +++ ++GF   P+  +   N   +V   S      SS     E +    + + L   G Y  + ++ D+++T       +  KP  V   F+   + G+   + + ++      P+  +   +         S  T  +D      +I   T+   G YT + +NE G            A  S+Q LI  +  P  + +L +  +T + GDS ++L V   A       W  D   ++ +    + +  E +   L +N    N  G Y   ++ + G+ +   V    +   P ++   +++  ++  S  +   V S P    I W     DG     +  +AR K        ++ + QRIE Y+  +    T D G Y ++  N  G ++    + V  + E  +        Q+   E + P+  +VI     +G P P   W  +G+ ++   H  I   G+ ++L +++    DAG Y+    N  G +  +  L +
Sbjct: 1345 VQWKHDGEVIQVDDRHKFMYE---DEESMSLVIKNVDTVDAGVYTIEAIN--ELGQDESSINLVV---KAPPKIKKITDITCSAG-ETIKMEIEVEGF---PQPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIK-ATNDLSQTSEYWSCTVKSKPVIV-KNFESEYIHGEKENVQMTVRI--DAYPEAKLTWYHDETEIKITDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHGS-----------ATSSTQLLIKCA--PEFTHKLKN--ITVAEGDSNVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFR-HVEEGNDFKLIMNQVATNMQGNYTCKIMNDYGKLEDNCVVT--VNCKPKVKRGLKNVEVQEGKSFTLEVEVYSEPEA-KIKWF---KDG---HEIYEDARIK--------ISRDTQRIENYYLTLNLARTEDAGTYEMKATNFIGETTSTCKVAVLTVPEIVHVDV----FQQHSYESV-PLKYEVIA----TGIPKPEAIWYHDGKPITPDKHTAITVDGDHYKLEVQSLDLVDAGEYKVVVQNKVGEKSHQGELSL 1881          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Fly
Match: Unc-89 (gene:FBgn0053519 transcript:FBtr0113464)

HSP 1 Score: 115.161 bits (287), Expect = 5.073e-25
Identity = 172/774 (22.22%), Postives = 303/774 (39.15%), Query Frame = 3
Query: 2562 IQWYKDN-----EAILPDCDPRILLQCNSQSGKMK----MHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAA----NTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSN--EMIQFNHRSVSLKDVGQYLFRVSSKDVAKTHL-EIGEKPEFVYHQF-----KENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYIND-NGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK--ETGQTQTTIVEINPIQFAPVIQDFPQSIRA--------KQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKL-DKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYF-LILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQY 4778
            I+W+KD+     EAI      ++  + +++ G  +    + I + RE+D G Y C   N   V +  +P  L++ S     + P F +K   A      EPL L+  +DG    P    + +   +  + S     K+S+N   +++    S    D G Y   +S+    K  L  +  KPE +  +F      +  ++G+ L +   +  F   +P+ + W K+   L  +   +  +IN  NG++   I        G Y C ++N+ GE          E  +S   ++P  +KP+  ++L D   +   G  +K+D++   +    + W  +   +      I I    ++  SL I      DSG Y+ + +  E        + + P       ++ PQ + A         Q   ++   + N  P    + WS      +P   L+              +T + + I L       +D G Y   + N  G  S       A  A  +     P F QK+ D++ +   N K+ V   VSG P P L+W    + + +S+   I+  G+ H L++ NC+K D G+Y+  ASN  G ++++  L +++                                +I    R++          PP F+    D  + EG       C  GYPEP + W+  +     + RF +  E +    L +KN+ + D GRYS    N  G   C A +  DS +        QY
Sbjct: 2144 IEWFKDDKPINYEAINKPGKDKLYAKEDTKKGTDQIESVLDIKSFRENDVGAYTCVATNEIGVTK--APFKLAMLS-----LAPSFVKKLDNALDVLQGEPLVLECCVDGSPL-PTVQWLKDGDEVKPSESI----KISTNPDGLVKLEINSCQPNDSGAYKLIISNPHGEKVALCAVAVKPEEMQPKFLKPITSQTVVVGEPLKLEAQVTGFP--APE-VKWYKDGMLLRPSPEIN--FINSPNGQIGLIIDAAQPLDAGVYKCLIANKGGE---------IEG-VSKVEIVPKESKPVFVAELQD--ASSIEGFPVKMDIKVVGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKADETATEEAPQFVSALRDVNADEGQELVLSAPFISNPMPE---VIWSKDGVTLTPNERLL--------------MTCDGKHIGLTIKPAEAADSGNYTCLLANPLGEDSS------ACNANVRKVYKPPVFTQKISDQQQVFGNNAKIPV--TVSGVPYPDLEWYFQDKPIPKSEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIASNREGKDITQGRLDIVN--------------------------------EIKKHSRSE----------PPVFLKKIGDCDIYEGMVAKFTACATGYPEPEVEWFKNDQKLFPSDRFLIDIEPNGLLRLTIKNVTEYDVGRYSCRIFNPYGDDICHAELFYDSLDSQQKPLEDQY 2821          

HSP 2 Score: 96.6709 bits (239), Expect = 2.418e-19
Identity = 137/580 (23.62%), Postives = 213/580 (36.72%), Query Frame = 3
Query: 3222 NDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTI--VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKL-DKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELS-ESDHLKI-RKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHL---------------QVIDPIGSVNTTKPLE------------------------------------KPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRS---PPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI-NNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYP 4781
             D  E V +I  F +  VG YTC  +NE G       ++ A   ++  +L P   K +      DN +    G+ + L+          V WLKD   +   +  I+I    +    L+IN    NDSG Y+ ++      +  +  V + P +  P       S        + +   V  +P+   + W     DG   R    +     IN P      N Q I L  D     D G Y   + N  G       I   +  E   K++ P F+ +L D   I     K+ +  KV GNP P L+W  NG E+  ++ H+ I      +  L+I+     D+G+YE  A N  GS  SK  L               Q +  +  VN  +  E                                    K I  TI P E     +    +++P        N  VR    PP F    +D+    G++  +   + G P P + W +    I  + ++ +K + D + LI+ N +KGD G Y   A N  G       + + +  K HS  RS+ P
Sbjct: 2176 TDQIESVLDIKSFRENDVGAYTCVATNEIG-------VTKAPFKLAMLSLAPSFVKKL------DNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSE-SIKISTNPDGLVKLEINSCQPNDSGAYKLIISNPHGEKVALCAVAVKPEEMQPKFLKPITSQTVVVGEPLKLEAQVTGFPAPE-VKWY---KDGMLLRP---SPEINFINSP------NGQ-IGLIIDAAQPLDAGVYKCLIANKGG------EIEGVSKVEIVPKESKPVFVAELQDASSIEGFPVKMDI--KVVGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKADETATEEAPQFVSALRDVNADEGQELVLSAPFISNPMPEVIWSKDGVTLTPNERLLMTCDGKHIGLTIKPAEAADSGNYTCLLANPLGEDSSACNANVRKVYKPPVFTQKISDQQQVFGNNAKIPVTVSGVPYPDLEWYFQDKPIPKSEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIASNREGKDITQGRLDIVNEIKKHS--RSEPP 2717          

HSP 3 Score: 66.2402 bits (160), Expect = 3.372e-10
Identity = 152/753 (20.19%), Postives = 267/753 (35.46%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNE--MIQFNHRSVSLKD---VGQYLFRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKN-FHKMSPKTI--------IWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQ-AVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNAR----YKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESD-HLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGD-DVVLKCCLIGYPEPLIWWSYNTHFINNPR--FEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNK 4751
            + W KDN+ +      RI  Q  +     ++ I NC E+DAG Y        ++  +S+    +V +Q      P   E     NTEP  L  + D        + +F  M + +     P  K   +E  +++ N R   ++D   +G Y   ++  DV KT  + G       ++  E +   +++A ++  KN F  +S + +         WK+N       +     +  D   L            G YTC      G      +LS   A+   QTL     KP  +  +       S+G S  L+++        V W  D + +   D R +  Y +E   SL I      D+G Y    + E GQ +++I  +  ++  P I+     I      +I +   V  +P               PT  + NN +       +    + +  +++++ +    +  S  G Y ++  N    +S     TV         K+ P  ++  + E I    E V +  ++   P   L W  +  E+  +D    +   G  + L I    + DAG Y  +A+N +GS  S   L                                                   +++  P+F     +  V EGD +V L   +  YP P   W  +   I+  R  F    E +++ LI+  +     G Y+    N  G    + +V V+   K
Sbjct: 1047 VTWLKDNKPLEDRLADRIT-QTAAPMNSYRLDIKNCSETDAGTY--------TIRAQSASETTTVSAQLAVGQAPGHDET--KTNTEPAFLVSLKDAEMI---ENTLFRFM-VKIIGDPKPRVKFYKDEKEILETNDRIQIIRDKDYLGFYELVIA--DVQKT--DAGTYSCKATNKHGEANC--EAIATTVEDKNPFGALSGQILPAGEKPVFQWKRNGEEFDPEERFKVLFGEDEDSLALVFQHVKPEDAGIYTCVAQTSTGNISCSAELSVQGAI---QTLNREPEKP--TLVIEHREANASIGGSAILELQCKGFPKPAVQWKHDGEVIQVDD-RHKFMYEDEESMSLVIKNVDTVDAGVYTIEAINELGQDESSINLV--VKAPPKIKKI-TDITCSAGETIKMEIEVEGFP--------------QPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIKATNDLSQTSEYWSCTV---------KSKPVIVKNFESEYIHGEKENVQMTVRIDAYPEAKLTWYHDETEIKITDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHGSATSSTQL---------------------------------------------------LIKCAPEFTHKLKNITVAEGDSNVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGNDFKLIMNQVATNMQGNYTCKIMNDYGKLEDNCVVTVNCKPK 1695          

HSP 4 Score: 63.5438 bits (153), Expect = 2.385e-9
Identity = 131/619 (21.16%), Postives = 224/619 (36.19%), Query Frame = 3
Query: 3024 VAKTHLEIGEKPE------------FVYHQFKENSLLGDSLAISIPMKN---FHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQP-LNSRDPRIQIYYPE------ESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEII---SPINEKVIVRCKVSGNPNPILKWMK-----NGEELSESDHLKIRKVGETHE--------LVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEI-VKEGDDVVLKCCLIGYPEPLIWW---------SYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG--LATCSALV 4730
            V KT +   E+PE            F  H ++   L  + +A  IP      +H   P T                H     D      E+        G+Y   V N+ GE   + +LS +         I    KPI +       +  + GD +   V F AD + ++V LKD QP + + + ++++   +      +  C+L I  A + DSG Y+  +K       T   I+ +   P I       +     +I    +V + P    ++W+          NL N+   ++I         +  +  L F +V+  + G+Y +   NS G ++V     +A L E       P FI + + + I    P++ KV+V     G P P ++W K     N E +++    K+    +T +        L IK+ +++D G Y   A+N  G                                                   T+  F   ++   P FV    + + V +G+ +VL+CC+ G P P + W         S +     NP   +K E++       + Q  DSG Y +   N  G  +A C+  V
Sbjct: 1798 VTKTLIATTEEPEEGAVPEIVHVDVFQQHSYESVPLKYEVIATGIPKPEAIWYHDGKPIT-------------PDKHTAITVDGDHYKLEVQSLDLVDAGEYKVVVQNKVGEKSHQGELSLSG--------IAEYRKPILTQGPGLKDIKVNKGDKVCEPVVFTADPAPEIVLLKDGQPVVETNNVKLKVDKKDAENGLVQYTCTLNILEAEIKDSGRYELKVKNKYGELVTSGWID-VLAKPEISGL-NDTKCLPGDTICFEALVQANPK-PKVSWT------RGNENLCNHENCEVIADV------DADKYRLVFQSVSPCEDGKYTITATNSEGRAAV--DFNLAVLVE------KPTFIVQPESQSIHDYRPVSTKVLVH----GVPLPTIEWFKDDKPINYEAINKPGKDKLYAKEDTKKGTDQIESVLDIKSFRENDVGAYTCVATNEIGV--------------------------------------------------TKAPFKLAMLSLAPSFVKKLDNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSESIKISTNPDGLVKLEIN-------SCQPNDSGAYKLIISNPHGEKVALCAVAV 2311          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Zebrafish
Match: ttn.2 (titin, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-030113-2])

HSP 1 Score: 110.538 bits (275), Expect = 2.090e-23
Identity = 160/748 (21.39%), Postives = 290/748 (38.77%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNG-------PSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLK-------DVGQYLFRVSS-KDVAK--THLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFT--QAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            ++I W+KD + +      + +    S+     +HI     SDAG+Y C+  N         SV  +  P  +   S        +    T    ++P+++  V D        D I  +                 N  I F +  V+LK         G+Y  ++ +   VA+   +L + E    V      +   G++ A+   +    ++ PK   W K+   L+    S K Y     +++  +   +  ++  G+YT  + NE G D   +QL+  + ++           P+ S +L D      VG S++LD +        + W  +   + S  P  +I + E + C+LK+    ++DSGTY+   +   G  +T+   +  ++  P     PQ + A    ++     V       S    +K   GS  + +V+    ++       L G+   +EL+  N+  S  GEY  ++ N AG  +  + + V         K +  F++KL K +   + + +I+ C  +G+P  ++KW K+G+E+  S    I     +  L   N  K  AG Y  + SN  G ++ +  + +++P   + + +P+E                                                   V  GD V LKC + G PE  I W+  +    ++P  +M+       L L  + K D G Y+  AENS G AT S  + V
Sbjct: 6102 FEITWFKDKKQLKESRKYKFV----SEGCSATLHILGLEASDAGEYECKATNNVGSDLCQGSVKLREPPAFVKKLSNTTAISGEEVVLLTTVKGSQPMTVSWVQD-------KDHILRD---------------GENRKITFENNEVTLKVFKADSTTAGKYTCQLKNDAGVAECTANLTVLEPAAIVDKTDSISVTAGEAAALECTVSGTPELKPK---WFKDGVELS----SGKKYKITFSKMISSLKLLSTERSDTGEYTFSIKNEVGSDSCAMQLTVLDKIVP----------PLFSRKLKDT--QSIVGKSMELDCKASGSAPLTISWFHNEVEIMS-GPNYEITFTENT-CTLKVPTLKLSDSGTYKCKAVNSAGAAETSASLV--VKEPPSFVTTPQPVEALPGTTVTFTATVQG-----STPMKLKWFRGS--KEIVSGRSCEI------ALRGDTAILELH--NIDKSHAGEYTCQIINDAGKENCPVNLFV---------KEAAHFVKKL-KNLSVEMGKSLILECTYAGSPKILVKWHKDGQEIYSSYKYNITTTESSCILECLNSDKEAAGKYTCEVSNDAGHDICEAAVSILEPPFFIESLEPME---------------------------------------------------VTAGDAVCLKCQIGGTPEIKISWFKADGKVRSSPTCKMEFFKGIACLKLAKVAKSDIGEYTCKAENSIGSATSSCHLTV 6724          

HSP 2 Score: 95.5153 bits (236), Expect = 7.172e-19
Identity = 182/842 (21.62%), Postives = 296/842 (35.15%), Query Frame = 3
Query: 2505 TRLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVN--------HSSCPWSKVSSNEMIQFNHRSVSLKDVGQY-------LFRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPL-NSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQTQTTIVEINPIQ--FAPVIQDFPQSIRAKQNGSINIVC-VVNSYP------------------------------------------SCHSIN------------------WSIKPA--DGSPTRNLVNNARY--------KMINKPLNKLTGNMQRIE-------LYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +RL   ++  P +      + W+ +++ +      +I  + N  +    + I +  ESD+G Y CEV N       SS V +                K   A  + L L  V+ G     E ++     P  +          S   ++ VS         ++    DVG Y       + ++++K VAK    + + P FV       ++LG ++ +   +K     +P T+ W K+   +  +  +  T   +N   V  I      H G YTCQ  NE G+          EA ++ Q       KP          ++ + GDS  L+ +        V W KD + +   R  +I     +E+   LKI  A   DS  Y+  V    G+ Q +   IN +     P      + +      SI + C V  S P                                          +CH+ N                  +S+KP   D  P   +V  A +        K   +    LTG    I+       L    +  S   +Y  +V N AG  S    + V         K  PKF+ KLD   +        + CKV+G+P   ++W KN  E+   D  ++        L I +C   D+G Y  QAS+  GS+   C + V    G                    +YQ    N       +T   F  T+ + PP FV    +  V    DV L+C L G     I W  + H I  +   ++  E     + + ++Q    G+Y+  A+N +G   C+A++ V
Sbjct: 4391 SRLSCTVKGSPELH-----VTWFLNDKPLNSSEKHKITFKTNQAT----LEIIDLSESDSGNYTCEVMNEAGCESCSSQVTV----------------KEPPAFKKELRLVEVVKGCTAHLECEMT-GTAPFEITWFKDKNPVSSDTKYNIVSKETAAYLEIKTFESADVGDYQCCISNDVGKITTKAVAK----LKDPPSFVKKVENTTAVLGSAVKLQGTIKG---SAPITVQWFKDTEIVRDDDPNITTTF-ENIIAVLAISNVAINHGGKYTCQAENEAGKQ-------KCEATVTVQEPARFVEKP--------PCISVTAGDSATLECKVSGSPDLKVKWFKDGKEMAGGRKYKITF---KENVAVLKILSAERGDSSEYKVEVSNRVGKEQCS-CSINVLDKIIPPTFTKMLKKVDGNVGASIQMECKVSGSQPITISWFKEGKDITTGTKYQTEMQESTALLKITNLETSDAGVFTCHATNAAGHSETSGTISVKEPPVFSLKPQSQDVIPGTTVVLTAAFTGTAPFMIKWFREDKEMLTGGTCFIKKETNSSSLELHALKPSQSAKYTCQVSNDAGKVSCTAALFV---------KEPPKFVMKLDLTKLVLNGSLATLECKVAGSPEISIRWYKNETEIGSDDKYQMAFTDSVATLRISSCCIEDSGDYICQASSDAGSDRCSCLVTVKGDAG--------------------KYQCTVGN----EVGQTSCDFLVTM-KEPPSFVQKMDNTNVLLAKDVSLQCVLKGSMPMTISWMKDDHEIKESEHVQISFENQTAVIYISSVQLKHGGKYTCHAQNEAGSQKCTAVLTV 5145          

HSP 3 Score: 94.3597 bits (233), Expect = 1.806e-18
Identity = 124/545 (22.75%), Postives = 219/545 (40.18%), Query Frame = 3
Query: 3240 VFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSV-GDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK-ETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE------KPISFTIIPTERYQPA--DDNSDISSPQR-------------------------TQMIFSNTI----------VRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI-NNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            + +I    ++  G+YT +VSN+ G        S+ EA++   T++    KP  + +L +   T S+ G   +L+      +  +V W K+N+ + + +    I++  E+  SL+I+    +DSG Y  + K + G  Q +      ++  P I + P+S        +    +++  P   +INW     D     + ++ +  K               IEL+F     SD G+Y   V N  G  S    + V         K  PKF +K +K  +   ++ V+  C+++G P     W K+G ++S SD  K+  V     L I +    D+G+Y  +A N  GSE     L+V +P   V    PLE            +  T  ++     D+ DI S  +                          Q + +N +          ++ PP FV    + +   G  V  KC + G P   I W  +  +I  +P  +   E +   L +   +   SG+Y+  A N +G   C + ++V
Sbjct: 5205 ILKILSAEKSDAGEYTFEVSNDAGR-------SSCEAVV---TVLDQIIKPSFTRKLKE---TESIKGSFTQLECLVSGSLPINVTWFKENKEIEADEKHKCIFF--ENAASLEISRLDSSDSGNYTCIAKNQAGSDQCS--GTLKVKEPPSIIEKPESQDVIPGSKVQFNVLLSGTPPL-TINWF---KDKKEVSSGIDCSVQK---------NDTSSSIELFF--AKPSDSGQYVCEVSNDVGSDSCQATLFV---------KEPPKFTRKPEKITVVKPSQLVVFECQITGTPEIDTYWFKDGNDISPSDKYKMTFVDSLARLEIISSDIKDSGVYYCEARNEAGSESCSMDLRVKEPPVLVKPLSPLEVVNGSNAYFECLVKGTAPFEVTWQKDSKDIKSSLKHVILQKNDSIITLDVQKCDALDVGEYQCVVANEVGSCSSQSTLSIKEPPSFVERIENVVTVLGKMVEFKCVVRGSPPLSIQWQKDESWILEDPSIQRTFENNVATLTIPVCESIHSGKYTCQAMNEAGQEKCFSTLVV 5708          

HSP 4 Score: 88.9669 bits (219), Expect = 7.191e-17
Identity = 154/771 (19.97%), Postives = 286/771 (37.09%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVAK---THLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPAD--------DNSDISSPQRTQMIFS----------------------------------NTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI-NNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALV 4730
            + ++W+KD+  ++  C P         S  + +       S +G Y C++ N    ++K    L +    K G               EPL L+  + G   AP     + N  I  +  +   +  +S  +++ +  + S  D G Y     +    K   T L I E P F         L G   +++  +K     +P  I W K+K  L  ++     ++++       I     +  G+Y C+ +N  G D+ +  +   E         P   K +S++       T   G+ + L           V W++D   +       +I + E ++ +LK+  A    +G Y   LK           +  ++ A ++ D   SI      +  + C V+  P        +KP        L +  +YK+     +K+  +++ +     +   SD GEY   ++N  G  S  + +TV       +K   P F +KL K+  S + + + + CK SG+    + W  N  E+    + +I     T  L +   K SD+G Y+ +A N+ G+  +   L V +P   V T +P+E     T+  T   Q +          + +I S +  ++                                     N  V+    FV    +  V+ G  ++L+C   G P+ L+ W  +   I ++ ++ +        L   N  K  +G+Y+    N +G   C A V
Sbjct: 5930 FTVKWFKDDTELI--CGPSCFTGLEGLSCFLDLFAVGI--SHSGTYSCQISNDAEFVQK----LPAAKVVKMG---------------EPLQLECKVTG--TAPLRISWYKNDAILSDGGNLRMTFDNSVAVLEIS--TSSFDDNGVYTCEAQNDAGTKSCSTALTIKEPPSFYKLPTPVEGLKGKDASLNCELKG---SAPFEITWFKDKKQLKESRKYK--FVSEGCSATLHILGLEASDAGEYECKATNNVGSDLCQGSVKLREP--------PAFVKKLSNT-------TAISGEEVVLLTTVKGSQPMTVSWVQDKDHILRDGENRKITF-ENNEVTLKVFKADSTTAGKYTCQLKNDAGVAECTANLTVLEPAAIV-DKTDSISVTAGEAAALECTVSGTPE-------LKPKWFKDGVELSSGKKYKIT---FSKMISSLKLL-----STERSDTGEYTFSIKNEVGSDSCAMQLTVL------DKIVPPLFSRKL-KDTQSIVGKSMELDCKASGSAPLTISWFHNEVEIMSGPNYEITFTENTCTLKVPTLKLSDSGTYKCKAVNSAGAAETSASLVVKEPPSFVTTPQPVEALPGTTVTFTATVQGSTPMKLKWFRGSKEIVSGRSCEIALRGDTAILELHNIDKSHAGEYTCQIINDAGKENCPVNLFVKEAAHFVKKLKNLSVEMGKSLILECTYAGSPKILVKWHKDGQEIYSSYKYNITTTESSCILECLNSDKEAAGKYTCEVSNDAGHDICEAAV 6629          

HSP 5 Score: 86.6557 bits (213), Expect = 3.664e-16
Identity = 124/518 (23.94%), Postives = 199/518 (38.42%), Query Frame = 3
Query: 3225 DNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEAL---ISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSR-DPRIQIYYPEESKCSLKINGATVNDSGTYQA-----VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIV--CVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNT--HFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVD 4739
            D+   V  I K    H G+YTC  +N  G    + +L+  E     +  + L+PV                 SVGD+++L+      +   V W KD++ + +  + +I      E+   L I  A   DSG Y       V K++  T+ ++ E    +  P     P +      G +  +   V  S P   ++NW     DG   R +  +  Y +  K    +        L       SD G Y  +  N AG +S  + + + A      +K  P F   L K +     E + + C V G+P   ++WMK+  ELS S + KI  V  T  L +    K+D+G Y  +A+N  GSE  K  + + D  G+                P +  +  D+   I  P+   ++   T          TF   I K G D          P P + W         +  R  ++++  E  + +K + K DSG+Y   A N  G   CS  + VD
Sbjct: 6782 DDNSAVLNIAKGEMRHSGEYTCVATNSVGSASCRAKLTLQEPRYPPVFDKKLVPVDV---------------SVGDTVELECHMTGSMPIKVTWSKDHKDIRTGGNYKISCV---ENTPHLTILKADKADSGRYSCHASNDVGKDSCSTEVSVKER---KIPPSFTKKPSTTIEDIEGKVVKIEGRVAGSQP--LTVNWY---KDG---REIFTSDFYDVTFKSSLAV--------LCIKKSQLSDSGTYVCKATNEAGTASFEVSVHITA------QKVPPSFDLPL-KPVTVNEGETLTLSCHVRGSPPLKIQWMKDRRELSSSANTKITFVDGTATLEMTRVSKTDSGDYLCKATNEAGSEFCKSKVTIKDKPGAPAPA-------QAAPSPPQEVKKFDNLFFIEVPKSVHIVEKGT---------ATF---IAKVGGD----------PIPNVKWMKGKWRQMTHGGRISIEQKGQEAKMEIKEVTKSDSGQYRCVASNKHGEIECSTDLNVD 7226          

HSP 6 Score: 79.7221 bits (195), Expect = 4.802e-14
Identity = 133/645 (20.62%), Postives = 235/645 (36.43%), Query Frame = 3
Query: 2970 SVSLKDVGQYLFRVSSK---DVAKTHLEIGE--KPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPV-IQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLN-----KLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLD-KEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSV----NTTKPLEKPISF--TI-----IPTERYQPA----DDNSDISSP----------------------------QRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            S ++ D G+Y  + S++   D     L + E   PEFV         +G        +       P  ++W K+   ++ +   H    +D      EI     +  G Y C+ SN  G      +L   +         P   K   S+       T +VG+ ++L+ +   D    ++W++D + L++     ++ + E+  C L I  + + D+GTY         + +    +  +Q  PV ++     I  KQ  S  + C V   P  H + W +                    +KPLN     K+T    +  L   +++ SD G Y   V N AG  S    +TV         K  P F ++L   E++      +   C+++G     + W K+   +S      I        L IK  + +D G Y+   SN  G   +K   ++ DP   V    NTT  L   +    TI     I  + ++      DD+ +I++                                Q   +   V+ P +FV       V  GD   L+C + G P+  + W+          ++++  + +   L + + ++GDS  Y +   N  G   CS  + V
Sbjct: 4153 SPAVADSGEYTCKASNRHGSDSCSAKLTVTELFPPEFVSKPDSMTLFVGKQAKFQCVISGSE---PMNVVWHKDNIAISLD--DHYKESSDKNRYFLEILNLQHSDQGTYLCKASNSVGTATCCTELRVVDK--------PSFVKSFEST-------TVAVGNPLRLECQVDEDTGVSIIWMRDGKKLHT-TMDCKLAFEEKIAC-LDIQKSKLKDTGTYTCTAANEAGSSSCSSSVT-VQEPPVFVKRLEPKILWKQGMSSRLSCTVKGSPELH-VTWFLN-------------------DKPLNSSEKHKITFKTNQATLEIIDLSESDSGNYTCEVMNEAGCESCSSQVTV---------KEPPAFKKELRLVEVVKGCTAHL--ECEMTGTAPFEITWFKDKNPVSSDTKYNIVSKETAAYLEIKTFESADVGDYQCCISNDVGKITTKAVAKLKDPPSFVKKVENTTAVLGSAVKLQGTIKGSAPITVQWFKDTEIVRDDDPNITTTFENIIAVLAISNVAINHGGKYTCQAENEAGKQKCEATVTVQEPARFVEKPPCISVTAGDSATLECKVSGSPDLKVKWFKDGKEMAGGRKYKITFKENVAVLKILSAERGDSSEYKVEVSNRVGKEQCSCSINV 4743          

HSP 7 Score: 74.3294 bits (181), Expect = 1.728e-12
Identity = 168/774 (21.71%), Postives = 299/774 (38.63%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEK----TFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQTQ--TTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTR----NLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIP--TERYQPA-------------DDNSDISSPQ-RTQM--------IFSNTI---------VRSPPQFVTTF-TDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            I W+KD + +    D  +  Q N  S  +++     + SD+GQY CEV N       S     ++F ++     PKF+ K    T    ++ +  +  + G    PE D  +     +++ S   +     + + +    S  +KD G Y       +  +     L + E P  V        + G +      +K     +P  + W+K+   + ++   H     ++  +  ++ K     VG+Y C V+NE G               SSQ+ + +  +P S  +  +N VT  +G  ++            + W KD   +   DP IQ  + E +  +L I       SG Y    + E GQ +  +T+V    +Q  P I + P+ I       ++  C V+  P    + WS    +  P+R    + +NN                    +L   +V   D G Y   V N    S+    +T+  L +       P FI+ L  E+   I + V + CK+SG+    ++W K+G +LS     KI +   +  L I+  +K+D G Y  + +N  GS      L+V +P   V        P S  +IP  T R++ +             DD   I  P   T +        +F+  I         + +  +FV      ++VK G+ + L+C + G  P  + W+  +    +     M  +     L +      D+G Y+  A+N +G  +CS  + +
Sbjct: 5369 INWFKDKKEVSSGIDCSV--QKNDTSSSIELFF--AKPSDSGQYVCEVSNDVG----SDSCQATLFVKEP----PKFTRKPEKITVVKPSQLVVFECQITG---TPEIDTYWFKDGNDISPSD-KYKMTFVDSLARLEIISSDIKDSGVYYCEARNEAGSESCSMDLRVKEPPVLVKPLSPLEVVNGSNAYFECLVKG---TAPFEVTWQKDSKDIKSSL-KHVILQKNDSIITLDVQKCDALDVGEYQCVVANEVGS-------------CSSQSTLSIK-EPPSFVERIENVVT-VLGKMVEFKCVVRGSPPLSIQWQKDESWI-LEDPSIQRTF-ENNVATLTIPVCESIHSGKYTCQAMNEAGQEKCFSTLV----VQEPPQIIEKPEVINVTAGDPVSFECKVSGTPELK-VKWSKDGKEVIPSRQHSLSYINNVS------------------QLKLQSVQLEDKGTYVFEVSNHI--SACQCKVTLNVLEQI----IPPSFIKPL-MEMEEIIGKNVQIGCKISGSLPITVEWEKDGTKLSGRTKHKILQDENSMSLDIECLEKADTGTYTCKLANKAGSCECSGTLRVKEPPSFVLV------PESQAVIPNTTVRFKGSFKGTPPFTVKWFKDDTELICGPSCFTGLEGLSCFLDLFAVGISHSGTYSCQISNDAEFVQKLPAAKVVKMGEPLQLECKVTGTAPLRISWYKNDAILSDGGNLRMTFDNSVAVLEISTSSFDDNGVYTCEAQNDAGTKSCSTALTI 6069          

HSP 8 Score: 67.781 bits (164), Expect = 1.551e-10
Identity = 81/312 (25.96%), Postives = 124/312 (39.74%), Query Frame = 3
Query: 3927 DGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELS--ESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPAD------------------DNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCL--IGYPEPLIWWSYNTHFINNP-RFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSK 4793
            D GE+ +  +N AG ++V + +TV    EA+     P+FI+KL K I       V +  K  GNP P + W+KN + +S  +  H+KI          I     SD+  Y A A N  G + ++C + V      V  T+P+  P    IIP   Y+  D                  +  D+   ++ Q           P F    T   +K    V  +C L  IG P  ++ W ++   +    R  M  E     L  +     DSG  +  A N  G    SA +IV   ++   ++ SQ P   K
Sbjct:  903 DSGEWTVVAQNRAGKTTVSMTLTV----EAKENLVRPQFIEKL-KNISVKEGSLVELAVKAIGNPLPDIVWLKNSDIISPHKYPHIKIEGAKGQAHFQIPQTSGSDSAWYTATAINKAGRDTTRCRVNV-----EVEYTEPV--PERRLIIPKGTYKAKDVAPPEIEPLHLRYGQEQWEEGDLYDKEKQQ----------KPHFKKKLTSVRMKRFGPVHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYEVAYSRDSGVITCRATNKFGADQTSATLIV--KDEKSLVEDSQLPEGRK 1190          

HSP 9 Score: 65.855 bits (159), Expect = 6.677e-10
Identity = 73/296 (24.66%), Postives = 122/296 (41.22%), Query Frame = 3
Query: 4059 KEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPIS--------------------------------------FTIIP-------TERYQP-ADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNP-RFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLPP 4805
            K+I     +K +  C++S  PN  + WMK+G+EL  S+  K+      H L+I+  + SDAG Y   A    GS VSK +L V      V  ++P EK I+                                      + II        TE Y+  A + + I+   R+ ++  +  +  PPQ +       V+ G        + G P+P + W  N+  +++  + +  RE +E+ L+L  +   D+ +Y+  A+N  G+AT SA +       N  +     P    PL P
Sbjct: 2445 KDIKVTEKKKAVFECELS-EPNVQVTWMKDGQELELSERYKVSTERHVHRLMIQTVRMSDAGEYSVVA----GSSVSKANLTVEGK--DVRISEPAEKEITVLEKQRSTFEFEVNEDDIEGRWLRNGVEIQFSVDQRFNYAIIRKIHRLTITETYRSDAGEYTFIAGKNRS-IVTLHVNIPEPPQIIRHMQPLSVEAGKPARFSVEVTGIPQPQVSWYKNSQALSSGFKCKFLREGNEHTLLLIEVFPEDAAQYNCEAKNDYGVATSSASL-------NVEVPEVVSPDTGAPLSP 2725          

HSP 10 Score: 63.929 bits (154), Expect = 2.410e-9
Identity = 158/801 (19.73%), Postives = 302/801 (37.70%), Query Frame = 3
Query: 2565 QWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQY-LFRVSSKD------VAKTH---------LEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXS--HKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSC-------HSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHL--------QVIDPIGSVNTTKPLEKPISFTI----IPTERYQPADDNSDISSPQRTQMIFSNTIVRS-------------------------------------PPQFVTTF--TDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +W KD   +      +I  Q +  S  +K  I +  +SDAG+Y  EV N     R S   +++V  Q    + P F+ K      E  S+K      +      L+  ++PINV      W K +        H+ +  ++     + R+ S D      +AK           L++ E P  +     ++ + G  +  ++ +       P TI W K+K  +++       K   + + EL F  P    +  G Y C+VSN+ G D  +  L   E      T  P     +  SQL            +  + +       D  W KD   ++  D     +   +S   L+I  + + DSG Y    +    +++  +++  ++  PV+   P S     NGS       N+Y  C         + W         ++++ ++ ++ ++ K  + +T ++Q+ +         D GEY   V N  G  S    +++         K  P F+++++  +++ + + V  +C V G+P   ++W K+   + E   ++         L I  C+   +G Y  QA N  G E  KC          Q+I+    +N T     P+SF       P  + + + D  ++   ++  + + N + +                                      PP F+      +EI+  G +V + C + G  P  + W    T      + ++ ++ +   L ++ ++K D+G Y+    N +G   CS  + V
Sbjct: 5181 KWLKDGNELTSGRKYKI--QSSDTSSILK--ILSAEKSDAGEYTFEVSNDAG--RSSCEAVVTVLDQ---IIKPSFTRKL----KETESIKGSFTQLEC-----LVSGSLPINVT-----WFKENKEIEADEKHKCIFFENAASLEISRLDSSDSGNYTCIAKNQAGSDQCSGTLKVKEPPSIIEKPESQDVIPGSKVQFNVLLSG---TPPLTINWFKDKKEVSSGIDCSVQKNDTSSSIELFFAKP----SDSGQYVCEVSNDVGSDSCQATLFVKEP--PKFTRKPEKITVVKPSQL------------VVFECQITGTPEIDTYWFKDGNDISPSDKYKMTFV--DSLARLEIISSDIKDSGVYYCEARNEAGSESCSMDLR-VKEPPVLVK-PLSPLEVVNGS-------NAYFECLVKGTAPFEVTWQ------KDSKDIKSSLKHVILQKNDSIITLDVQKCDAL-------DVGEYQCVVANEVGSCSSQSTLSI---------KEPPSFVERIEN-VVTVLGKMVEFKCVVRGSPPLSIQWQKDESWILEDPSIQRTFENNVATLTIPVCESIHSGKYTCQAMNEAGQE--KCFSTLVVQEPPQIIEKPEVINVTAG--DPVSFECKVSGTPELKVKWSKDGKEVIPSRQHSLSYINNVSQLKLQSVQLEDKGTYVFEVSNHISACQCKVTLNVLEQIIPPSFIKPLMEMEEII--GKNVQIGCKISGSLPITVEWEKDGTKLSGRTKHKILQDENSMSLDIECLEKADTGTYTCKLANKAGSCECSGTLRV 5897          

HSP 11 Score: 63.929 bits (154), Expect = 2.513e-9
Identity = 55/227 (24.23%), Postives = 95/227 (41.85%), Query Frame = 3
Query: 4098 RCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNG----SEVSKCHLQVIDPIGSVNTTKPLEKPISFTI--------IPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPR-FEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVD 4739
            +C+VSG  +  + W    +E+ +SD  ++ +  E  +L I      D G Y   A N+ G    S + K  +  +         + +++  S T+          T  + P    +    P++ +   S    R  P F +  T   V  G+ V     + G+P+P + W +N   I +   +    E DEY LI+  ++K   G YS TA N  G  TC  ++ V+
Sbjct: 2746 QCRVSGE-DLTITWYCKDKEIKQSDIFRVSQFDENCQLEITRVYPEDEGEYTCVARNSAGMVSCSALLKVDVTRVREEIEAKIEEEVKEFSSLTVKTEEEEETYSTSLHLPEKSKTLELKPEQKRFSSSLERKREKPVFESKLTPAEVTIGESVRFTVTVSGFPKPKVQWFHNGKAITSSSIYTFVEERDEYSLIITKVKKDYEGEYSCTASNRFGQTTCKTILKVE 2971          

HSP 12 Score: 63.1586 bits (152), Expect = 4.522e-9
Identity = 158/795 (19.87%), Postives = 293/795 (36.86%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLL----SVFSQKQGTVIPKFSEKTFAANTE---PLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTII-WXXXXXXXXXXXXSHKTYINDN-GELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQ---SIRAKQNGSINIVC-VVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMI----NKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV----------------IDPI--------GSVNTTKPLE-------KPI------------SFTIIPTERYQPADDNSDI------SSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            I W+ +   I+   +  I    N+ +    + +   + SD+G Y C+  N       S+ +++    S  +  Q       +  TF A  +   P+ LK               F      V+  SC  +      +++ ++  +     G+Y  ++   + K+    +L + E   FV    K+   L   +  S+ ++  +  SPK ++ W K+   + +   S+K  I       + E     +   G YTC+VSN+ G D+ +  +S  E     ++L P+                 + GD++ L  +        + W K +  + S  P  ++ + +   C LK+     +D G Y    + +  + T+   +  +Q       FP+   SI   +   +   C V  S P    ++W     DG   R+   ++ Y M     +  LN   G M+              GEY     NS G +S    +T+      Q  +  P F +KL    +S + + V + C ++G+    + W K+ +++    + KI  V  T  L I    K+D+G Y   ASN  G +     + V                I+ I        G V  ++PL        + I            S  ++  ++ Q +D  + +      +     ++    T  + PP F        V EG+ + L C + G P   I W  +   +++        +D    L +  + K DSG Y   A N +G   C + V +
Sbjct: 6387 ISWFHNEVEIMSGPNYEITFTENTCT----LKVPTLKLSDSGTYKCKAVNSAGAAETSASLVVKEPPSFVTTPQPVEALPGTTVTFTATVQGSTPMKLKW--------------FRGSKEIVSGRSCEIALRGDTAILELHN--IDKSHAGEYTCQIINDAGKENCPVNLFVKEAAHFV----KKLKNLSVEMGKSLILECTYAGSPKILVKWHKDGQEIYS---SYKYNITTTESSCILECLNSDKEAAGKYTCEVSNDAGHDICEAAVSILEPPFFIESLEPMEV---------------TAGDAVCLKCQIGGTPEIKISWFKADGKVRS-SPTCKMEFFKGIAC-LKLAKVAKSDIGEYTCKAENSIGSATSSCHLT-VQDVKTPPSFPKKITSIMQIEGQPVQFECRVAGSSP--MEVSWL---KDGEALRS---DSEYTMSFDDNSAVLNIAKGEMRH------------SGEYTCVATNSVGSASCRAKLTL------QEPRYPPVFDKKLVPVDVS-VGDTVELECHMTGSMPIKVTWSKDHKDIRTGGNYKISCVENTPHLTILKADKADSGRYSCHASNDVGKDSCSTEVSVKERKIPPSFTKKPSTTIEDIEGKVVKIEGRVAGSQPLTVNWYKDGREIFTSDFYDVTFKSSLAVLCIKKSQLSDSGTYVCKATNEAGTASFEVSVHITAQKVPPSFDLPLKPVTVNEGETLTLSCHVRGSPPLKIQWMKDRRELSSSANTKITFVDGTATLEMTRVSKTDSGDYLCKATNEAGSEFCKSKVTI 7109          

HSP 13 Score: 62.7734 bits (151), Expect = 5.438e-9
Identity = 86/396 (21.72%), Postives = 157/396 (39.65%), Query Frame = 3
Query: 3243 FEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTY--QA--------------VLKETGQTQTTI---VEINPIQFAPVIQDFPQSIRAKQNGSI------NIVCVV-NSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEK 4352
             E+     +    YTCQVSN+ G      ++S   AL      +    K +    L+   + GS+     L+ +        + W K+   + S D + Q+ + + S  +L+I+   + DSG Y  QA              V  + G+ Q T+   V      F   +++ P  ++   N ++      ++ CV+  S P   +I+W     +   + ++              +++   Q   +Y  +V    GG+Y    +N AG       +TV            P  I +  K +   + +   + C+ SG      KW+K+G EL+     KI+    +  L I + +KSDAG Y  + SN  G    +  + V+D I   + T+ L++
Sbjct: 4900 LELHALKPSQSAKYTCQVSNDAG------KVSCTAAL-----FVKEPPKFVMKLDLTKLVLNGSLAT---LECKVAGSPEISIRWYKNETEIGS-DDKYQMAFTD-SVATLRISSCCIEDSGDYICQASSDAGSDRCSCLVTVKGDAGKYQCTVGNEVGQTSCDFLVTMKEPPSFVQKMDNTNVLLAKDVSLQCVLKGSMP--MTISWMKDDHEIKESEHV--------------QISFENQTAVIYISSVQLKHGGKYTCHAQNEAGSQKCTAVLTVK----------EPANITEQAKSVSVTVRDPATLECRYSGTKVLKAKWLKDGNELTSGRKYKIQSSDTSSILKILSAEKSDAGEYTFEVSNDAGRSSCEAVVTVLDQIIKPSFTRKLKE 5253          

HSP 14 Score: 62.3882 bits (150), Expect = 6.764e-9
Identity = 66/282 (23.40%), Postives = 102/282 (36.17%), Query Frame = 3
Query: 3900 LYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLAT-CSALVIVD 4739
            L    V     GEY       AG +S    +TV         +  P F Q++    ++ +       C++   P    KW K+G EL  S+  +I     T  L I +   +D+G Y  +ASN +GS+     L V                       TE +                          PP+FV+      +  G     +C + G  P  ++W   N     +  ++   + + YFL + N+Q  D G Y   A NS G AT C+ L +VD
Sbjct: 4054 LVITKVMKDHEGEYTCEAVGEAGKTSTSSHLTVIP-------RVPPVFRQRIQNLEVN-VGSSAKFECEIEEAPGVTFKWFKSGTELRHSEKCRIISRHHTSSLEIFSPAVADSGEYTCKASNRHGSDSCSAKLTV-----------------------TELF--------------------------PPEFVSKPDSMTLFVGKQAKFQCVISGSEPMNVVWHKDNIAISLDDHYKESSDKNRYFLEILNLQHSDQGTYLCKASNSVGTATCCTELRVVD 4278          

HSP 15 Score: 61.6178 bits (148), Expect = 1.237e-8
Identity = 175/780 (22.44%), Postives = 290/780 (37.18%), Query Frame = 3
Query: 2676 SDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPL---SLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLK-------DVGQYLFR-VSSKDVAKTH--LEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQ--TQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV------------IDPIG-SVNTTKPLE------KPISFTIIPTERYQPADDNSDISSPQRTQMI----------------FSNTIVRS-------------PPQFV---TTFTDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLPPET 4811
            SD G+Y   ++N   V   S  + L+V  +    V P FS K    +T+ +   S++L       AP +   F+N    V   S P      N  I F   + +LK       D G Y  + V+S   A+T   L + E P FV       +L G ++  +  ++     +P  + W +    + + +        D    + E+    ++H G+YTCQ+ N+ G++   + L   EA    + L  +S +               +G S+ L+  +       V W KD Q + S   +  I   E S C L+   +    +G Y   V  + G    +  +  + P  F   ++  P  + A    ++ + C +   P    I+W    ADG            K+ + P  K+        L    V  SD GEY  + ENS G ++    +TV      Q+ KT P F +K+   I+    + V   C+V+G+    + W+K+GE L       +     +  L I   +   +G Y   A+N+ GS   +  L +            + P+  SV  T  LE       PI  T     +      N  IS  + T  +                 SN + +              PP F    +T  ++I  EG  V ++  + G  P  + W+        +  +++  +     L +K  Q  DSG Y   A N +G A+    V        H   +   PS   PL P T
Sbjct: 6325 SDTGEYTFSIKN--EVGSDSCAMQLTVLDK---IVPPLFSRK--LKDTQSIVGKSMELDCKASGSAPLTISWFHN---EVEIMSGP------NYEITFTENTCTLKVPTLKLSDSGTYKCKAVNSAGAAETSASLVVKEPPSFVTTPQPVEALPGTTVTFTATVQG---STPMKLKWFRGSKEIVSGRSCEIALRGDTA--ILELHNIDKSHAGEYTCQIINDAGKENCPVNLFVKEAAHFVKKLKNLSVE---------------MGKSLILECTYAGSPKILVKWHKDGQEIYS-SYKYNITTTE-SSCILECLNSDKEAAGKYTCEVSNDAGHDICEAAVSILEPPFFIESLE--PMEVTA--GDAVCLKCQIGGTPEIK-ISWF--KADG------------KVRSSPTCKMEFFKGIACLKLAKVAKSDIGEYTCKAENSIGSATSSCHLTV------QDVKTPPSFPKKITS-IMQIEGQPVQFECRVAGSSPMEVSWLKDGEALRSDSEYTMSFDDNSAVLNIAKGEMRHSGEYTCVATNSVGSASCRAKLTLQEPRYPPVFDKKLVPVDVSVGDTVELECHMTGSMPIKVTWSKDHKDIRTGGNYKISCVENTPHLTILKADKADSGRYSCHASNDVGKDSCSTEVSVKERKIPPSFTKKPSTTIEDI--EGKVVKIEGRVAGSQPLTVNWYKDGREIFTSDFYDVTFKSSLAVLCIKKSQLSDSGTYVCKATNEAGTASFEVSV--------HITAQKVPPSFDLPLKPVT 7030          

HSP 16 Score: 61.6178 bits (148), Expect = 1.334e-8
Identity = 39/139 (28.06%), Postives = 65/139 (46.76%), Query Frame = 3
Query: 3891 RIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV 4307
            R  L    VT +  G + +R  N AG ++    + V A      +   P FIQ+L    +     +V +  +V+G P P++K+ + G E+  S   +I + G+ + L+I      D+G Y   ASN++G   S   L V
Sbjct:   62 RAVLMIPAVTAAHSGRFSVRATNGAGQATSTAELLVTA------ETAPPNFIQRLQSLTVRQ-GSQVRLDVRVTGIPAPVVKFYREGAEIQSSADFQIVQDGDLYSLLIAEAFPEDSGTYSVSASNSSGRATSTAELLV 193          

HSP 17 Score: 61.6178 bits (148), Expect = 1.415e-8
Identity = 51/213 (23.94%), Postives = 79/213 (37.09%), Query Frame = 3
Query: 4104 KVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDP-IGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVD 4739
            +V+G P P + W KN + LS     K  + G  H L++      DA  Y  +A N  G   S   L V  P + S +T  PL                                       SPP  +T   +    EG     +C + G    + W+  +     +  F + +  +   L +  +   D G Y+  A NS+G+ +CSAL+ VD
Sbjct: 2642 EVTGIPQPQVSWYKNSQALSSGFKCKFLREGNEHTLLLIEVFPEDAAQYNCEAKNDYGVATSSASLNVEVPEVVSPDTGAPL---------------------------------------SPPVVLTPIQNTSANEGQSARFQCRVSGEDLTITWYCKDKEIKQSDIFRVSQFDENCQLEITRVYPEDEGEYTCVARNSAGMVSCSALLKVD 2815          

HSP 18 Score: 60.8474 bits (146), Expect = 2.207e-8
Identity = 105/507 (20.71%), Postives = 181/507 (35.70%), Query Frame = 3
Query: 3249 IPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPL-NSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK-----ETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLV---NNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIV-KEGDDVVLKCCLIGYPEPLIWWSYNTHFINNP-RFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            I K  + H G+YTC+   E G+      L          T+IP    P+   ++ +  V  +VG S K + E          W K    L +S   RI          SL+I    V DSG Y          ++   + T+ E+ P +F       P S+           CV++                GS   N+V   +N    + +    K + +  R  L   N+  SD G Y  +  NS G ++    + V            P F++  +   ++ +   + + C+V  +    + WM++G++L  +   K+    +   L I+  K  D G Y   A+N  GS      + V +P                                                   P FV     +I+ K+G    L C + G PE  + W  N   +N+  + ++  + ++  L + ++ + DSG Y+    N +G  +CS+ V V
Sbjct: 4056 ITKVMKDHEGEYTCEAVGEAGKTSTSSHL----------TVIP-RVPPVFRQRIQNLEV--NVGSSAKFECEIEEAPGVTFKWFKSGTELRHSEKCRI---ISRHHTSSLEIFSPAVADSGEYTCKASNRHGSDSCSAKLTVTELFPPEFV----SKPDSMTLFVGKQAKFQCVIS----------------GSEPMNVVWHKDNIAISLDDH--YKESSDKNRYFLEILNLQHSDQGTYLCKASNSVGTATCCTELRVV---------DKPSFVKSFESTTVA-VGNPLRLECQVDEDTGVSIIWMRDGKKLHTTMDCKLAFEEKIACLDIQKSKLKDTGTYTCTAANEAGSSSCSSSVTVQEP---------------------------------------------------PVFVKRLEPKILWKQGMSSRLSCTVKGSPELHVTWFLNDKPLNSSEKHKITFKTNQATLEIIDLSESDSGNYTCEVMNEAGCESCSSQVTV 4463          

HSP 19 Score: 56.9954 bits (136), Expect = 3.154e-7
Identity = 52/238 (21.85%), Postives = 93/238 (39.08%), Query Frame = 3
Query: 4032 SPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESD--HLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +P F Q L + +++          +VSGNP P + W ++G+ L+ +     +I        L+I     + +G +  +A+N  G   S   L V                                                T   +PP F+       V++G  V L   + G P P++ ++       ++  F++ ++ D Y L++      DSG YS++A NSSG AT +A ++V
Sbjct:    5 APTFTQPL-QSVVALEGSAATFEAQVSGNPVPEVSWFRDGQVLTAAALPGAQISFSDGRAVLMIPAVTAAHSGRFSVRATNGAGQATSTAELLV------------------------------------------------TAETAPPNFIQRLQSLTVRQGSQVRLDVRVTGIPAPVVKFYREGAEIQSSADFQIVQDGDLYSLLIAEAFPEDSGTYSVSASNSSGRATSTAELLV 193          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Zebrafish
Match: hmcn2 (hemicentin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-9765])

HSP 1 Score: 105.531 bits (262), Expect = 6.244e-22
Identity = 151/614 (24.59%), Postives = 242/614 (39.41%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQG-TVIPKFS---EKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSN-EMIQFNHRSVSLKDVGQYLFRVS---SKDVAKTHLEIGEKPEFVYHQF---------------------------KENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNY---VTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAP-VIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKL--DKEIISP-INEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNG 4277
            I W KDN+ I+         Q     G   + +   R  DAG Y C   N      +   + + V  Q +G + I  F    EK     T  L+L  +  GF   P +    +   +N N  S     +S N  M+  ++  +S +  GQY   VS    +D    HL I   P  V+H+                            +   LLG S+++S      + + P  + W +    LT    S    +   G  + +IP+      G YTCQ  NE GED +   L         + L+P    P+ S Q +D +   V   V  ++ L  +     S  V W+KD  PL S D R  I   E+ K  L+I    V+D  +YQ V +        +  ++ IQ  P ++    + +   +   I+++C V +YP          PAD   T+    + +       ++ L G      L        D G+Y     NSAG     I +T+ AL         P  + +L  + E+ +P +   +I+RC+ +G P P + W +NG +L+  + L+I    E  +L I   + +D G+Y  + SN  G
Sbjct: 1560 ITWLKDNQPIVSS------PQLTYTQGGQSLRVAAARGEDAGAYTCRATNPAGTAHRHYTLRIMVPPQIEGDSTILSFGRREEKVRINGT--LTLSCLAKGFP-EPVTQWFKDGQLLNGNTHS----GLSVNSHMLHVDNAMLSHE--GQYTCVVSNSAGEDKRDFHLTIQVPP--VFHRVINGAADFTLGEREGDEEDPDSPDGMVERREVLLGHSISLSC---ESNAIPPPRLSWYRQGRQLT----SSDGVVLAPGGHILQIPRVQLEDAGKYTCQAVNEAGEDKMHYDL---------EVLVP----PVISGQ-TDEFMQDVDTVVNSTVSLRCDVSGHPSPSVSWIKDGLPLYS-DSRHNIL--EDGKL-LEIVNVQVSDGASYQCVAENKAGAVERLYSLS-IQVPPRIVGRREEEMSVVEGHMISLLCDVQAYP----------PADIIWTK----DGQMLEFTTGIHILPGGQM---LQIPRAGQQDAGQYVCTATNSAGQDQKSILLTIYAL---------PALVPRLESESEVRTPLVGSTLILRCEANGIPKPEVTWYRNGLQLAAGNGLRI----ERQQLEIVGVQVADGGVYTCKVSNIAG 2100          

HSP 2 Score: 84.3445 bits (207), Expect = 1.606e-15
Identity = 171/791 (21.62%), Postives = 287/791 (36.28%), Query Frame = 3
Query: 2559 DIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRN--GPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIF--NNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGED------------VLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINW---SIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNG--------------------SEVSKCH-LQVIDPIGSVNTTKPL----EKPISFTIIP------------TERYQPADDN------SDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +I+WYKDN  +      ++  +  S +    + I + R  D+GQY C V N  G + +  +  +LL         VI + S    A   +   L   ++G   AP S +++  +  P+ ++++   ++ +S   +      +V L DVG+Y   VS++   D     L++   P      F    + G    +S          P   +  +      +   S    +  +G LV   P  T    G + C V+NE GE+            V+K  +S+  A+  S  ++P  A             TG            P  V S   W K+   L +R    ++        +L+I  AT + +G Y    +         V +  +Q  P I+   + ++   + S+ + C V  +P   +I W    +  A G     L N A                    L F  VT  D G Y    +N AG           ALA+ Q     P  +     E +  + + V + C   G P P + W ++   + +S HL++   G  H   I   ++ DAGIY   A N+ G                    SE+S    L+V+ P  +    +P     +K +S + +P             ER +  D        ++ +   R  +  +   V   P F     D  + +G  + L C   G P P I W+ N         +   E     +I  N+   D G Y+  AEN+ GL    + V V
Sbjct: 2612 EIEWYKDNVKV------QLGGRIQSIASGQFLEIQDVRMHDSGQYSCVVTNIAGSTSLFFTVEILLP-------PVIREGSSLIIAHVGQDAVLPCEVEG---APSSSVMWRKDGGPVPLHNNR--FTLLSEGSL---RISTVQLSDVGRYYCSVSNQAGSDHRGMDLKVYVGPSISPGPFNVTVVTGQRAVLSCESTGI----PAPQVSWRRNGSPISVDQSSAYRLMSSGSLVITSP--TAEDEGYFECTVTNEVGEERRVIEVILQVPPVIKDDVSSVTAVKMSPVVLPCHA-------------TGR-----------PEPVIS---WNKNWMQLGARGGSYRVL----PTGALEILAATPSHAGKYTCSARNPVGVAYKHVTLT-VQEPPEIRPMAEEVQVVLHHSVVLPCEVQGFPR-PTITWQREGVPVATGHRLAVLSNGA--------------------LKFSRVTLGDAGTYQCLAQNEAG----------TALAQTQLILQVPPVLSVPRLEYVVVLGQPVSLDCVADGQPKPEVTWHRDRRPVVDSSHLRLFSNGSLH---ITATQRGDAGIYTCSARNSVGRASHDVRLILHTPPQIFVGQSEISVMQGLRVMLPCAAQGVPEPRMSWEKKGVSVSNMPGKFTLRESGGLIIERAEAGDAGLFTCVATNTAGSARWDIRLT---VNMRPAFKELPGDVTLNKGQSLSLSCHAEGTPTPTITWTANNRPYTGASVD---ETGRSSVIFDNVTVSDGGTYACIAENTVGLIRALSFVRV 3303          

HSP 3 Score: 78.1814 bits (191), Expect = 1.116e-13
Identity = 136/612 (22.22%), Postives = 228/612 (37.25%), Query Frame = 3
Query: 3039 LEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDP-RIQIYYPEESKCSLKINGATVNDSGTYQA----VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLD-KEIISPINEKVIVRCKVSGNPNPILKWMKNGEEL--SESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHL-QVIDPIGSVNTTKPLEKPIS---------------------------FTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRS---------------PPQFVTTFTDE--IVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLAT 4715
            L I   P  V  + +E S++ +   IS+ + +     P  IIW K+   L      H   I   G++  +IP+  Q   G Y C  +N  G+D    Q S    + +   L+P   +  S S++     T  VG ++ L  E       +V W ++   L + +  RI+       +  L+I G  V D G Y      +  +  +T    V + P+   P+ +   Q++ +     I ++C  +  P   +I W     DGSP  + +        N+             L    +  S  G Y    +N+ G +     +T+ A          P  I      E+ +P+ E++ + C+  G+P P + W++NG+ L    ++H+ I   G T  L   + K  D+G Y   A ++ G E     L  ++ P  S  T+ P E   +                             + P  R   AD    IS    +       + RS               PP    T   E   V +G  V L C   G P P + W  +   ++  R  +    +  FL L ++   D+G YS  A N +G +T
Sbjct: 1923 LSIQVPPRIVGRREEEMSVV-EGHMISL-LCDVQAYPPADIIWTKDGQMLEFTTGIH---ILPGGQM-LQIPRAGQQDAGQYVCTATNSAGQD----QKSILLTIYALPALVP---RLESESEVR----TPLVGSTLILRCEANGIPKPEVTWYRNGLQLAAGNGLRIE-------RQQLEIVGVQVADGGVYTCKVSNIAGQVDRTFRVTVHVPPVMEGPLHETLTQNLGSH----ITLICEASGIP-VPNIAWL---KDGSPIESSLQWNWSTRANR-------------LELGPLQLSHAGTYTCIAKNTEGQTQKDYSLTIYA---------PPSIIDSGHPSEVSAPVGEELALECRAMGSPAPKVSWLRNGKTLVNGNTEHINISPDGST--LTFLSVKPEDSGTYTCLAVSSAGQETKIYTLFALVPPSISGETSVPREVHTTQHSVVTLECKAKGTPQPQISWLRDGHPLLLSPRIRLLSADSTLRISPVHLSDSGIYTCVARSRAGLAELNFDLQVQAPPAVERTEPTEQVAVVQGSSVTLTCEARGVPPPTLSWLKDGQPLSLHRNLLLDGQETRFL-LSDVGPSDAGLYSCVASNQAGSST 2477          

HSP 4 Score: 74.7146 bits (182), Expect = 1.521e-12
Identity = 109/506 (21.54%), Postives = 184/506 (36.36%), Query Frame = 3
Query: 3228 NGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN-SRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV-IDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSP----QRTQMIFSNTIVRS-------PPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG 4706
            NG+ + +I +    H G ++C   N  GE                +  I V A P+ S       VT   G  + +           V W  D + L+ + DP ++     E    L++      D G YQ V      TQT    +  IQ AP+I+D         +G  + V VV  +P+         P    PT   + + +  +++ P  +LT       L        D G Y  R  N AG +     + +    + +   T   F ++ +K     IN  + + C   G P P+ +W K+G+ L+ + H  +     +H L + N   S  G Y    SN+ G +    HL + + P+      + +     FT+   E      D  D  SP    +R +++  ++I  S       PP+         +   D VVL              +   H +  PR +++                D+G+Y+  A N +G
Sbjct: 1391 NGKRLLKIYRVQHDHAGRFSCTAQNSAGE-------------AKREYTIEVQAPPVISGTSGVQEVTIMAGQEVDMQCRVSGRPLPSVEWTHDGEVLSPNGDPHVEFL---EKGQVLRVKSVRPRDRGLYQCVATNNAGTQTRQFRLT-IQAAPLIRD---------SGEDSEVTVVLGFPAVLHCEVEGIPL---PTITWLKDNQ-PIVSSP--QLTYTQGGQSLRVAAARGEDAGAYTCRATNPAGTAHRHYTLRIMVPPQIEGDSTILSFGRREEK---VRINGTLTLSCLAKGFPEPVTQWFKDGQLLNGNTHSGLSV--NSHMLHVDNAMLSHEGQYTCVVSNSAGEDKRDFHLTIQVPPV----FHRVINGAADFTLGERE-----GDEEDPDSPDGMVERREVLLGHSISLSCESNAIPPPRLSWYRQGRQLTSSDGVVL--------------APGGHILQIPRVQLE----------------DAGKYTCQAVNEAG 1820          

HSP 5 Score: 73.1738 bits (178), Expect = 4.131e-12
Identity = 156/734 (21.25%), Postives = 265/734 (36.10%), Query Frame = 3
Query: 2559 DIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKF---SEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVS--SKDVAKTHLEIGEKPEFVYHQFKENSL--LGDSLAI-----SIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKP--ISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPL-NSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQD---FPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG 4706
            DI W KD + +       IL       G   + I    + DAGQY C   N     +KS  +LL++++     ++P+    SE         L L+   +G    PE     N + +   +           E  Q     V + D G Y  +VS  +  V +T       P  +     E     LG  + +      IP+ N   +   + I        ++ + +  T  N       E+     +H G YTC   N  G+      L+             + A P  I S   S+  V+  VG+ + L+       +  V WL++ + L N     I I  P+ S  +L        DSGTY  +   +   +T I  +  +   P I      P+ +   Q+  + + C     P    I+W     DG P   L+ + R ++++              L    V  SD G Y     + AG + +   + V A    +  +T P       +++       V + C+  G P P L W+K+G+ LS   +L +   G+    ++ +   SDAG+Y   ASN  GS     +L V++P             I+ ++ P E                 Q+I  ++++                      L+C   G P P + W  +   I +    ++R  D   L +  +Q  D+G Y+  A + +G
Sbjct: 1960 DIIWTKDGQMLEFTTGIHIL------PGGQMLQIPRAGQQDAGQYVCTATNSAGQDQKS--ILLTIYALP--ALVPRLESESEVRTPLVGSTLILRCEANGIP-KPEVTWYRNGLQLAAGNGL-------RIERQQLEIVGVQVADGGVYTCKVSNIAGQVDRTFRVTVHVPPVMEGPLHETLTQNLGSHITLICEASGIPVPNIAWLKDGSPI-------ESSLQWNWSTRANR-----LELGPLQLSHAGTYTCIAKNTEGQTQKDYSLT-------------IYAPPSIIDSGHPSE--VSAPVGEELALECRAMGSPAPKVSWLRNGKTLVNGNTEHINIS-PDGS--TLTFLSVKPEDSGTYTCLAVSSAGQETKIYTLFAL-VPPSISGETSVPREVHTTQHSVVTLECKAKGTPQ-PQISWL---RDGHP---LLLSPRIRLLSADST----------LRISPVHLSDSGIYTCVARSRAGLAELNFDLQVQAPPAVE--RTEPT------EQVAVVQGSSVTLTCEARGVPPPTLSWLKDGQPLSLHRNLLLD--GQETRFLLSDVGPSDAGLYSCVASNQAGSSTKTFNLTVLEP-----------PKITGSLSPEE-----------------QLIAVDSLLE---------------------LECIATGLPPPTLSWLKDGRPIQDNMAIIER--DGQLLRINKVQVEDAGLYTCLASSPAG 2566          

HSP 6 Score: 71.2478 bits (173), Expect = 1.506e-11
Identity = 116/555 (20.90%), Postives = 206/555 (37.12%), Query Frame = 3
Query: 3207 HKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK----ETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELS-ESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV-IDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRT----------------QMIFSNTIVRSPPQ------FVTTFTDEIVKE--------------GDD-----------VVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLA 4712
            H+  + D  E  F +     +  G Y+C  SN+ G       L+  E              P  +  LS      +V   ++L+          + WLKD +P+      I     E     L+IN   V D+G Y  +      E G+     V++ P        +  +++     G + + C  +S P    I W              +N + ++  +  +  +G    I+    +V   D G+Y   V N AG +S+   + +            P  I++    II+ + +  ++ C+V G P+  + W K+G  +   ++   +   G    L I   + SD G Y    SN  GS+     L+V + P     +  P   P + T++  +R   + +++ I +PQ +                +++ S ++V + P       F  T T+E+ +E               DD           VVL C   G PEP+I W+ N   +   R    R L    L +       +G+Y+ +A N  G+A
Sbjct: 2440 HRNLLLDGQETRFLLSDVGPSDAGLYSCVASNQAGSSTKTFNLTVLE-------------PPKITGSLSPEEQLIAVDSLLELECIATGLPPPTLSWLKDGRPIQDNMAII-----ERDGQLLRINKVQVEDAGLYTCLASSPAGEDGRNHWVRVQLPPTLLG---SNDIRTVSVPAKGHLTLECQTDSDPP-PEIEW------------YKDNVKVQLGGRIQSIASGQFLEIQ----DVRMHDSGQYSCVVTNIAGSTSLFFTVEILL----------PPVIREGSSLIIAHVGQDAVLPCEVEGAPSSSVMWRKDGGPVPLHNNRFTLLSEGS---LRISTVQLSDVGRYYCSVSNQAGSDHRGMDLKVYVGP-----SISP--GPFNVTVVTGQRAVLSCESTGIPAPQVSWRRNGSPISVDQSSAYRLMSSGSLVITSPTAEDEGYFECTVTNEVGEERRVIEVILQVPPVIKDDVSSVTAVKMSPVVLPCHATGRPEPVISWNKNWMQLGA-RGGSYRVLPTGALEILAATPSHAGKYTCSARNPVGVA 2935          

HSP 7 Score: 69.3218 bits (168), Expect = 5.217e-11
Identity = 118/532 (22.18%), Postives = 201/532 (37.78%), Query Frame = 3
Query: 3276 GDYTCQVSNEFGEDVLKLQLSA-AEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEIN---PIQFAPVIQ--DFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPT---RNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLD-KEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDP---IGSVNTTKPLEKPISFTII--------PTERYQPADDNSDISSPQRTQMIFSN---------------------TIVRSPPQFVTT--FTDEIVKEGD---------DVVLKCCLIGYPEPLIWWSYNTHFI--NNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG 4706
            G YTC   +  G++     L A     IS +T +P   + + ++Q S           + L+ +        + WL+D  PL    PRI++     +  +L+I+   ++DSG Y  V +    ++  + E+N    +Q  P ++  +  + +   Q  S+ + C     P   +++W     DG P    RNL+ +                 Q       +V  SD G Y     N AG S+    +TV            PK    L  +E +  ++  + + C  +G P P L W+K+G  + ++  + I + G+   L I   +  DAG+Y   AS+  G +     ++V  P   +GS N  + +  P    +         P    +   DN  +    R Q I S                       I  S   F T       +++EG          D VL C + G P   + W  +   +  +N RF +   L E  L +  +Q  D GRY  +  N +G
Sbjct: 2276 GTYTCLAVSSAGQETKIYTLFALVPPSISGETSVP---REVHTTQHS----------VVTLECKAKGTPQPQISWLRDGHPL-LLSPRIRLL---SADSTLRISPVHLSDSGIYTCVAR----SRAGLAELNFDLQVQAPPAVERTEPTEQVAVVQGSSVTLTCEARGVPP-PTLSWL---KDGQPLSLHRNLLLDG----------------QETRFLLSDVGPSDAGLYSCVASNQAGSSTKTFNLTVLE---------PPKITGSLSPEEQLIAVDSLLELECIATGLPPPTLSWLKDGRPIQDNMAI-IERDGQL--LRINKVQVEDAGLYTCLASSPAGEDGRNHWVRVQLPPTLLGS-NDIRTVSVPAKGHLTLECQTDSDPPPEIEWYKDNVKVQLGGRIQSIASGQFLEIQDVRMHDSGQYSCVVTNIAGSTSLFFTVEILLPPVIREGSSLIIAHVGQDAVLPCEVEGAPSSSVMWRKDGGPVPLHNNRFTL---LSEGSLRISTVQLSDVGRYYCSVSNQAG 2750          

HSP 8 Score: 64.3142 bits (155), Expect = 1.866e-9
Identity = 137/629 (21.78%), Postives = 231/629 (36.72%), Query Frame = 3
Query: 2511 LDFVLESLPRIDKDQYDIQWYKDNEAILPDC------DPRI-----LLQCNSQSGKMK------MHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGN-MQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKK-TSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVN 4331
            ++ +L+  P I  D   +   K +  +LP C      +P I      +Q  ++ G  +      + I     S AG+Y C  RN   V  K   V L+V    +   I   +E+        + L   + GF   P        +P+   H       V SN  ++F+   V+L D G Y       +   +A+T L +   P     + +   +LG  +++        K     + W +++ P+     S    +  NG L   I    +   G YTC   N  G     ++L     ++ +   I V    IS  Q          G  + L           + W K    +++   +  +    ES   L I  A   D+G +  V   T  +    + +  +   P  ++ P  +   +  S+++        SCH        A+G+PT  +   A     N+P    + +   R  + FDNVT SDGG Y    EN+ G    +  + V      + +  TS   IQ           +  ++ C VSG+P P L+W K+G+ L  S      + G    L + +    D+G Y   A +  G+      L+V  P G  N
Sbjct: 2848 IEVILQVPPVIKDDVSSVTAVKMSPVVLP-CHATGRPEPVISWNKNWMQLGARGGSYRVLPTGALEILAATPSHAGKYTCSARNPVGVAYKH--VTLTVQEPPE---IRPMAEEVQVVLHHSVVLPCEVQGFPR-PTITWQREGVPVATGHRL----AVLSNGALKFSR--VTLGDAGTYQCLAQNEAGTALAQTQLILQVPPVLSVPRLEYVVVLGQPVSLDCVADGQPK---PEVTWHRDRRPVVD---SSHLRLFSNGSL--HITATQRGDAGIYTCSARNSVGRASHDVRL-----ILHTPPQIFVGQSEISVMQ----------GLRVMLPCAAQGVPEPRMSWEKKGVSVSNMPGKFTL---RESG-GLIIERAEAGDAGLFTCVATNTAGSARWDIRLT-VNMRPAFKELPGDVTLNKGQSLSL--------SCH--------AEGTPTPTITWTAN----NRPYTGASVDETGRSSVIFDNVTVSDGGTYACIAENTVGLIRALSFVRVREPPVLRGEAHTSQTVIQ----------GKSAMLDCAVSGDPVPSLRWHKDGQPLLGSLRFHPLRNG---SLALYSAIIGDSGEYRCVAESEAGAAERTISLKVQVPGGYSN 3402          

HSP 9 Score: 62.7734 bits (151), Expect = 4.942e-9
Identity = 119/598 (19.90%), Postives = 225/598 (37.63%), Query Frame = 3
Query: 2934 VSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKP--ISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFP--QSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG 4706
            V+S+ M++   ++V   D G Y       + +D  +  L++ E P F  +       + +S  + IP       +P+ + W KN   +   +  H   + ++G LV  I   + +H GD+ C  +NE G              +  +T + V+  P      QL +  VT  +   + L  +     +  + W KDN+P+    P +   Y +  K  LKI     + +G +    + +         I  +Q  PVI      Q +       +++ C V+  P   S+ W+      SP      +   + + K      G + R++    +V   D G Y     N+AG  +    +T+ A    ++           D E+   +    ++ C+V G P P + W+K+ + +  S  L   + G++  L +   +  DAG Y  +A+N  G+      L+++ P                        Q   D++ +S  +R                     +E V+    + L C   G+PEP+  W  +   +N         ++ + L + N      G+Y+    NS+G
Sbjct: 1203 VASDRMLKI--QAVQHSDSGTYRCVARNSAGEDTIQIVLDVLEGPYFETNGETVIESVANS-KVLIPCPARGSPAPQ-VRWFKNGLEVHMERSEHGVSLAEDGALV--IGSASASHSGDFKCVATNEAGS-------------VERKTRLKVNVPPEIQDDGQLLNLTVT--LKQPLTLGCDAFGIPTPTISWTKDNRPV-LETPGV---YLQNGKRLLKIYRVQHDHAGRFSCTAQNSAGEAKREYTIE-VQAPPVISGTSGVQEVTIMAGQEVDMQCRVSGRP-LPSVEWTHDGEVLSPN----GDPHVEFLEK------GQVLRVK----SVRPRDRGLYQCVATNNAGTQTRQFRLTIQAAPLIRDSGE--------DSEVTVVLGFPAVLHCEVEGIPLPTITWLKDNQPIVSSPQLTYTQGGQS--LRVAAARGEDAGAYTCRATNPAGTAHRHYTLRIMVP-----------------------PQIEGDSTILSFGRR---------------------EEKVRINGTLTLSCLAKGFPEPVTQWFKDGQLLNG-NTHSGLSVNSHMLHVDNAMLSHEGQYTCVVSNSAG 1704          

HSP 10 Score: 60.4622 bits (145), Expect = 2.605e-8
Identity = 108/515 (20.97%), Postives = 176/515 (34.17%), Query Frame = 3
Query: 3210 KTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKET-GQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHE--LVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEP-LIWWSYNTH--FINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +TY   +G+  +EIP  +    G Y C   +  G      QL+  E         PV   P++        VT S G    L  +    V  ++ W +    L SR  R+++     +  SL+I+     D+G YQ       G++Q  +  +  +  AP +   PQ+        ++I C  +  P    + WS          N+  +  ++M       LT                D G Y     N  G +S  + +  A           P  I  + + ++    E   + C+ SG P+PI+KW K   +L  +   +     + H   L I+  ++ D+G Y   ASN  GS  +   LQV                                                    + P F  +  D     GD++ L C   G+P P LIW   +    F  +       +L    L ++++   D G Y   A+N  G     A V V
Sbjct:  470 RTY-EASGKASWEIPYASGDDEGAYECVARSTAGMGRALTQLTVREP-------PPVLRPPVN--------VTSSPGTVAVLSCQIQGSVRHNLTWYRTGSALPSRSGRVRVL----ANSSLEISWVRSQDAGPYQCRASNAHGESQAVVWLV--VLEAPSVVVSPQTQSFSLGAEVHISCSASGSPP-PKVFWS--------HGNIFLSNHHRMSISESGMLT---------IRGAAPEDSGNYTCLATNEVGTASQSVNVNYA----------EPPSISVVQQMVMVVAGEDASLECQASGTPSPIVKWQKGDLDLGTAPFAE----QDVHRGTLQIRGVQELDSGDYTCVASNIAGSSSAVVVLQV---------------------------------------------------GAAPTFSESPVDITASVGDNITLPCIARGFPTPSLIWRRQDGRPIFGKSSGHVGTSQLPSGALQIQSVWVDDEGVYLCEAKNQFGSIKALARVTV 879          

HSP 11 Score: 56.9954 bits (136), Expect = 3.344e-7
Identity = 126/574 (21.95%), Postives = 210/574 (36.59%), Query Frame = 3
Query: 2643 KMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTF---AANTEPLSLKLVLDGFKYAPESDLIF---NNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV-----SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIP--VSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYP-EESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNG-SINIVCVVNSYPSCHSINWSIKPAD--GSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVID 4313
            +  + I   +E D+G Y C   N   +   SS V++      Q    P FSE      A+  + ++L  +  GF   P   LI+   +  PI    S    +    +  +Q   +SV + D G YL        S K +A+  +   E P  V       +++   L  ++P +    +     IW  N   +       + ++  +G L   + +      G Y C   N  G         +A   ++ +   P  + A P+        + T S G  I L  E        + W K   PLN       +  P E +  SL I+  T  D+G Y         T T+ V     +   ++   P+ + A  +  ++ +   V S          I P +  GSPT  LV  +R      P+      +    L   +V   D   Y     N AG  S+   + V A         +P  ++ L       I + V++ C V G P+P + W+ NG  ++    LKI+ V           + SD+G Y   A N+ G +  +  L V++
Sbjct:  749 RGTLQIRGVQELDSGDYTCVASN---IAGSSSAVVV-----LQVGAAPTFSESPVDITASVGDNITLPCIARGF---PTPSLIWRRQDGRPIFGKSSGHVGTSQLPSGALQI--QSVWVDDEGVYLCEAKNQFGSIKALARVTVTGLEPPLLVQGAPSITTMIAQPL--NLPCRLLDGIPLPERIWTHNGKQVRV---GGRVFLRSDGSL--HVDRAVPEDAGTYVCTAVNVAG---------SANITVTVEVHAPPDIKAGPL--------HYTASEGTPISLSCEARGVPKPTISWSKGRDPLNR-----PVSAPFEAADGSLYISSPTEEDAGVYIC-------TATSAVGYTSREMHLIVNSKPRIVGADGSQVTVKMAAEVGSE--------VILPCEVQGSPT-PLVTWSRNGQTIPPVTAWFTMLPSGSLKISDVRVVDSKLYTCSAVNPAGNVSLTYNLQVQAKPRIH---PAPSTLKAL-------IGQTVVLPCVVQGEPSPQVSWLHNGLPVASDRMLKIQAV-----------QHSDSGTYRCVARNSAGEDTIQIVLDVLE 1243          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Zebrafish
Match: spegb (striated muscle enriched protein kinase b [Source:ZFIN;Acc:ZDB-GENE-081104-517])

HSP 1 Score: 91.6633 bits (226), Expect = 1.025e-17
Identity = 63/234 (26.92%), Postives = 112/234 (47.86%), Query Frame = 3
Query: 4059 KEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISS---PQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDE--YFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSH 4745
            ++ ++    +V+++C +SG P P + W K+  E+  S    ++  GE H L+IK  K SDAG Y   A N  G   S   L +          KP + PI+      E   P +++ D SS   P+  +++  +T  + PP F+    D+ V EG +V +   + G P+P+++W  +   I      + +E +E  + +I+K+ Q+ D+G Y+    N  G   C   + V + 
Sbjct:  472 QDTVASTGTEVLLKCIISGTPLPEVIWKKDNTEVKNSPTHVVKIEGERHSLLIKWTKPSDAGTYTVTAVNEVGEVSSSATLFI----------KPGDSPITSD---EEYLSPLEESMDFSSYRGPEPRKIV--DTRFKEPPAFLAVIGDQSVIEGQEVTMSVLVTGQPKPMLYWLRDRVTIKTGTRHIVQETEEGNFEMIIKSAQRSDTGVYTCKIINEYGTKQCEGKLEVKAR 690          

HSP 2 Score: 90.1225 bits (222), Expect = 2.541e-17
Identity = 107/441 (24.26%), Postives = 177/441 (40.14%), Query Frame = 3
Query: 3438 GDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQTQTT---IVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLD-KEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPR-FEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATC-SALVIVD 4739
            G  + + V         + WL+D   + +    I +   EE    + I  A  +D+G Y   ++ E G  Q      V+  P++    I    + +  K   +    C V   P    ++W    +DG     L+  A   ++N    K+  + +R  L  ++V   D G Y  ++  +    +    + V A  E       P F +KLD  E+I   N +    CKVSG P P + W      L E++ ++I K G  H L+I +    D G+Y   A N++G +     L V +P       +P    IS  I   E+     +  ++   +  +           P FV    D  V EG + VL+C + G P P I W +N   I++    +M +  D + L+++ +     G Y     N  G ATC S L + D
Sbjct:  611 GQEVTMSVLVTGQPKPMLYWLRDRVTIKTGTRHI-VQETEEGNFEMIIKSAQRSDTGVYTCKIINEYGTKQCEGKLEVKARPVEPGLAIIRPVRDVMVKAGETALFECHVIG-PQDTDVDWL---SDG----KLIQPA---LLN---CKMHFDGKRCRLLLNSVHEDDSGTYTCKLSTAKEELTSSAKLKVIASIE-------PLFTRKLDVLEVIEGRNARF--DCKVSGTPPPQVIWSHFDRPLEENEDIRILKEGGRHSLIISHVSNEDEGLYTVAARNSHGEDECAAELYVQEP-------RPA---ISSQIAKLEKMPSIPEEPEVPENEIERFTM--------PDFVKPLYDMDVVEGREAVLRCKVAGLPYPTITWFHNGKRIDSTEDRKMTQFRDVHSLVVRCVCHAHGGVYKCVISNKVGKATCYSHLYVTD 1009          

HSP 3 Score: 73.9442 bits (180), Expect = 1.979e-12
Identity = 92/454 (20.26%), Postives = 169/454 (37.22%), Query Frame = 3
Query: 3051 EKPEFVYHQFKEN----SLLGDSLAIS---IPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPI-QFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMI--------PITVAALAEAQN----------------KKTSPKFIQKL-DKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVID 4313
            E  + V  +FKE     +++GD   I    + M       PK +++             H     + G     I    ++  G YTC++ NE+G    + +L      +     I    +P+         V    G++   +        +DV WL D + +       ++++ +  +C L +N    +DSGTY   L    +  T+  ++  I    P+       +   +  +    C V+  P    I WS         R L  N   +++ +      G   R  L   +V+  D G Y +   NS G              P   + +A+ +                 + T P F++ L D +++     + ++RCKV+G P P + W  NG+ +  ++  K+ +  + H LV++    +  G+Y+   SN  G      HL V D
Sbjct:  584 EPRKIVDTRFKEPPAFLAVIGDQSVIEGQEVTMSVLVTGQPKPMLYWLRDRVTIKTGTRHIVQETEEGNFEMIIKSAQRSDTGVYTCKIINEYGTKQCEGKLEVKARPVEPGLAI---IRPVRD-------VMVKAGETALFECHVIGPQDTDVDWLSDGKLIQPALLNCKMHF-DGKRCRLLLNSVHEDDSGTYTCKLSTAKEELTSSAKLKVIASIEPLFTRKLDVLEVIEGRNARFDCKVSGTPPPQVI-WS------HFDRPLEENEDIRILKE------GG--RHSLIISHVSNEDEGLYTVAARNSHGEDECAAELYVQEPRPAISSQIAKLEKMPSIPEEPEVPENEIERFTMPDFVKPLYDMDVVE--GREAVLRCKVAGLPYPTITWFHNGKRIDSTEDRKMTQFRDVHSLVVRCVCHAHGGVYKCVISNKVGKATCYSHLYVTD 1009          

HSP 4 Score: 55.8398 bits (133), Expect = 7.391e-7
Identity = 30/90 (33.33%), Postives = 48/90 (53.33%), Query Frame = 3
Query: 4470 PQFVTTFTDEIVKEGDDVVLKCCLIGYPEP-LIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            P F     D +   G +V+LKC + G P P +IW   NT   N+P   +K E + + L++K  +  D+G Y++TA N  G  + SA + +
Sbjct:  465 PVFEFPLQDTVASTGTEVLLKCIISGTPLPEVIWKKDNTEVKNSPTHVVKIEGERHSLLIKWTKPSDAGTYTVTAVNEVGEVSSSATLFI 554          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Zebrafish
Match: neo1a (neogenin 1a [Source:ZFIN;Acc:ZDB-GENE-021031-1])

HSP 1 Score: 87.8113 bits (216), Expect = 1.035e-16
Identity = 91/308 (29.55%), Postives = 138/308 (44.81%), Query Frame = 3
Query: 3435 VGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTT-------IVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNA--RYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPIN------EKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVID 4313
            VGDS  L  E   D+ S + W + N+     D R+    P     +L I+ AT  D+G Y+ V+   G T+T+       + E    +    +Q+ PQ +      S+ + CVV  YP+   I W  K         L+ ++  R+++       L G   RI     N+T  D G Y    EN+ G        ++ A AE    K SP+F++K       P+N        VI  C+VSG+P+P +KW+KNG+ +  SD+ KI K      L +    KSD G Y+  A N  G+  S   L ++D
Sbjct:  146 VGDSQVLSCEVNPDLVSFIRW-EQNKEAVELDHRV-FSLP---SGALVISNATETDAGLYRCVIDNAGPTKTSEEAQLHILTETGEERTLEFLQE-PQHVSKLVGESVLLPCVVTGYPTPE-ITWMYK-------DQLIEDSSGRFEI-------LGGGSLRIF----NLTEEDAGVYNCLAENTNG--------SIEAQAEL-TLKDSPQFLKK-------PVNVFAHEATDVIFECEVSGSPSPTIKWVKNGDAVIPSDYFKIIK---EQNLQVLGLVKSDEGFYQCLAENDAGNVQSSAQLVILD 409          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Zebrafish
Match: neo1a (neogenin 1a [Source:ZFIN;Acc:ZDB-GENE-021031-1])

HSP 1 Score: 87.8113 bits (216), Expect = 1.061e-16
Identity = 91/308 (29.55%), Postives = 138/308 (44.81%), Query Frame = 3
Query: 3435 VGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTT-------IVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNA--RYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPIN------EKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVID 4313
            VGDS  L  E   D+ S + W + N+     D R+    P     +L I+ AT  D+G Y+ V+   G T+T+       + E    +    +Q+ PQ +      S+ + CVV  YP+   I W  K         L+ ++  R+++       L G   RI     N+T  D G Y    EN+ G        ++ A AE    K SP+F++K       P+N        VI  C+VSG+P+P +KW+KNG+ +  SD+ KI K      L +    KSD G Y+  A N  G+  S   L ++D
Sbjct:  146 VGDSQVLSCEVNPDLVSFIRW-EQNKEAVELDHRV-FSLP---SGALVISNATETDAGLYRCVIDNAGPTKTSEEAQLHILTETGEERTLEFLQE-PQHVSKLVGESVLLPCVVTGYPTPE-ITWMYK-------DQLIEDSSGRFEI-------LGGGSLRIF----NLTEEDAGVYNCLAENTNG--------SIEAQAEL-TLKDSPQFLKK-------PVNVFAHEATDVIFECEVSGSPSPTIKWVKNGDAVIPSDYFKIIK---EQNLQVLGLVKSDEGFYQCLAENDAGNVQSSAQLVILD 409          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Xenopus
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:Xenbase;Acc:XB-GENE-972643])

HSP 1 Score: 102.449 bits (254), Expect = 8.056e-21
Identity = 147/575 (25.57%), Postives = 233/575 (40.52%), Query Frame = 3
Query: 2622 QCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANT---EPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVAKTHLEIG----EKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYIND-NGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEA--LISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDP 4316
            Q NSQ     + I+     D G Y CE  N    I   + + ++      G V+P   E     +      ++L  VL      PE   + +N+ +  N    P++ + ++  +      V LKD G YL   ++K+VA T   I          + H  +  S + + +A+S+P K      P TIIWKK    +     ++ T I + +G L+   P    +  G+Y+C   N  G    K+QL+      L+S +  I +S +                GD + L  E  +     + W K+ Q ++    R  I+       SLKI    V+D+G Y  V        T +V+++ +   P IQ  P+ IR K   S  I C+ +  P               PT     + +    ++  +    NM R+E    +   SDGG Y     N  G  S     TV   A        P +  K ++E IS   +++   C V G+P P++KW +NG+EL+ S+   +  V +   LVI +    D G Y   ASN  G    K  L+V DP
Sbjct:  831 QYNSQQKAGTLQINKLWVGDEGIYICEAENQFGKISSQATITVT------GLVVPVIGESPSVVSVIEGNQVTLPCVLLVGNPLPERHWVKDNVVLVTN----PYTSIRADGSLHLER--VLLKDGGDYL--CTAKNVAGTADRITTINVHVSPVIQHGPQIFSTI-EGIAVSLPCKASGVPKP-TIIWKKKGEIVVP---NNDTIIAESDGTLLLSSPGGEDS--GEYSCSAINAAGYAARKVQLTVYGKVFLLSQKNQIEISVR---------------AGDDVILPCEVKSVPPPFITWAKETQLISPFSQRHSIF----PSGSLKIFETRVSDAGMYTCVGTNIAGNITQLVKLS-VYVPPKIQRGPKLIRVKLGHSFEIACISHGIPP--------------PTAAWYKDGQIMEFDQGQDN---NMLRVE----SAKPSDGGTYTCVASNVIGTDSANA--TVEIYAPPTLSDLEPPY-NKQNQERIS--RQQISFPCPVKGHPKPVIKWFRNGKELTGSEP-GVNIVEDRAVLVIDSLTPYDNGEYTCVASNEAGQTEKKYSLKVHDP 1337          

HSP 2 Score: 88.5817 bits (218), Expect = 1.217e-16
Identity = 119/491 (24.24%), Postives = 178/491 (36.25%), Query Frame = 3
Query: 3243 FEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIE----LYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRK--VGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAEN 4697
             EIP    +H G YTC+  N+ G   + + L   E              P+   Q  ++Y+   + +S+ L  E        + W K+   + S        Y   S  +L I  AT  D+GTY  + +    T    V +  +   PVI    +      + SI IVC                 A GSPT  ++    +     PL KL G  QR+     L+   V   D GEY    EN AG  SV   + ++ L         P  I K  K++   IN++  + C   G P P + W KN   ++    +K  K  V  + EL++ N +  D G Y   ASN  G +     L V               P SFT +PT                    I S                  + EG+ + L C   G P P   W +    +  P  + +R   +  L++  + + +SG Y   AEN
Sbjct: 3836 LEIPSSRLSHAGKYTCRAVNQVGSAHIHVNLHVQEV-------------PVIKEQ--NDYLEVVLSNSVTLACEASGTPIPTISWQKEGVGIKSGSS-----YTILSNGNLNIASATQEDAGTYTCIAQNPAGTALKKVRLK-VHVPPVIVPHQKEYVISMDKSIMIVC----------------EAHGSPTPEII----WHKDGVPLAKLAG--QRMSATGGLHIAVVQPDDAGEYTCTAENIAG--SVNSSMNLSVLV--------PPRIVKNIKDVSVVINDQTTLPCAAHGIPTPTITWAKNNLPIT----VKAGKYSVLASGELILYNAQHKDVGTYTCTASNAIGEDTHTVRLTV-------------HFPPSFTEMPT--------------------IVS------------------LNEGERLSLLCKATGNPLPHTTWIFKDKIL--PVLQDRRSKQQNELVIDKVSRENSGAYMCVAEN 4216          

HSP 3 Score: 87.8113 bits (216), Expect = 2.324e-16
Identity = 108/451 (23.95%), Postives = 163/451 (36.14%), Query Frame = 3
Query: 3423 VTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDP-RIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQN------GSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAG---WSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPR---FEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +T +VG    L  +  + V  ++ WL++N  L   +P ++ I        SL+I   T++D G Y       G T T  V +       + QD P+++   +N        I + C+V  YP+ H I W            + N+   +  N+ +    G          N    D G Y     N+AG    +SVM+ I V  +   +N             E++ P+  +  + CK +G P P++ W K    LS S  + I  +  T  L IKN + SDAG Y   A N  G    K  L+V  P                   P     P D + DI                                G DV L C   G PEP I W    H   + +   ++   +     L +  +  GD G Y   AEN  G  +  A + V
Sbjct:  518 ITVTVGKGAILTCDVVSTVRFNLTWLRNNLDLKHMNPSKLSILRNN----SLEIKSVTIDDGGEYNCFASNEGGTATASVTL-------IAQDPPKAVLEPRNVTFTKGAEIKLKCLVTGYPTPHII-W------------MHNDMFVRFSNRYIITHNGT-----FIIKNAVERDSGVYKCLATNAAGTDHQTSVMVYIEVPQVTAVKN-------------EMLVPVGSETTLACKATGIPRPLIHWYKGKSTLSPSALITIDSLLGT--LKIKNTQFSDAGHYVCIAVNDAGKANGKVSLRVGSP-------------------PVFTQTPGDVSMDI--------------------------------GSDVSLTCSAEGIPEPKIKWRRLNHTSESSKPLSYQYNSQQKAGTLQINKLWVGDEGIYICEAENQFGKISSQATITV 873          

HSP 4 Score: 79.337 bits (194), Expect = 7.065e-14
Identity = 112/481 (23.28%), Postives = 171/481 (35.55%), Query Frame = 3
Query: 3276 GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDP-RIQIYYPEESKCSLKINGATVNDSGTYQAVLKET-GQTQTTIVEINPIQFAPVI--QDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG 4706
            G+Y C V+N  G+D  K  L+             V   P S   L + Y  G + +S+    +        + WLKD  P+   D   IQI         +KI  A + D GTY  +     G  + T +    IQ  P I        +       I ++C     P+   I+W     DG    NLV       I      LT              TSD G+Y     N AG    +  + V    +  + K +P  +  +       ++  + V C  SG P P + W+KNG  L  S  ++++  G+   L I   +KSD   Y   ASN  G +    ++QV                            P+ D +D+     TQ I   T++R  P                VV++C   G P P I W  +   + +      +       I+K  +  D  RY+  A N++G
Sbjct: 3008 GEYECIVTNVVGQDNKKFFLN-------------VYVHP-SIQGLQNEYHNGIIQNSVTFSCDAYGIPVPTLRWLKDGHPIGLTDSLEIQIL---SGGSKMKIARAQLTDGGTYTCLASNVEGTAEKTYILT--IQVPPSIDGSGMTNELNVLPGEIIQLICNAKGIPT-PVIHWL---KDGKHITNLVGETISGCITSDGEILT---------ISKTQTSDMGKYTCVATNPAGEDDRIFNVNVFVAPKIDDNKGTPVVLTAV-------LDTSINVECHASGFPTPQINWLKNGLPLPVSSQVRLQSGGQV--LRISRVQKSDGATYTCIASNRAGVDKKDYNIQV-------------------------YVSPSLDEADV-----TQQI---TVIRDDP----------------VVMRCIANGVPAPRISWLKDGKQLGDEYLPYIQSQGMVLHIVK-AKMDDIARYTCVASNAAG 3397          

HSP 5 Score: 77.0258 bits (188), Expect = 3.453e-13
Identity = 116/527 (22.01%), Postives = 197/527 (37.38%), Query Frame = 3
Query: 3144 MSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAV-LKETGQTQ-----TTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG 4706
            + P TIIW K+  PL  +   + TYI     L     + T    G YTC V+N  G+          E   S    +P           +   +   VG S+ L+ E        + WLKD  P+ + D  I+++Y  +    L+I      D G Y  V +   G+T+     + +   +  QF  V+    +        S    C+ +  P+ H I W     DG P      N + +   +             L F      D G+Y     N+AG +   I + V    + +N   S + IQ+    +++  N  +I+ CK +GNP+P++ W K+ ++L+ +  + +   G+   L I   +   AG Y+  A++  G      +LQV  P                                IS    +  +  N +VR                     L+C   G+P P + W  +   +++    ++       L L N Q GD+G+Y+  A N++G
Sbjct: 1553 IPPPTIIWYKDGEPLLPS--PYVTYIQKGKYLRITESQITDG--GTYTCSVTNVAGQ---------TEKNYSVDIYVPARIHGDEKKHQNKKVI---VGKSLTLECEATGHPPPLITWLKDGVPVETND-NIRLHYNGKK---LEIRNTVEYDRGLYTCVAVNVAGETEMKYKVSVLAGSSTKQFNVVVHGELKQKHDHHTFSYLTSCIASGIPNPH-ITWL---KDGLPFNVAKANIKMESFGR------------SLQFKKTLLEDAGKYTCVATNAAGEAEQTIWLNVYEPPKIEN---SGELIQE---TVLA--NHNIILECKATGNPDPVVTWFKDNQQLTNTGDISVSDRGQV--LQISGAQVFHAGTYKCVAASIAGRAELSYNLQVHVP------------------------------PSISGRSSSITVIVNNVVR---------------------LECEATGFPAPSLTWLKDGSPVSSFTNGIQILSGGRVLALTNAQVGDAGKYTCVAVNAAG 1982          

HSP 6 Score: 75.485 bits (184), Expect = 1.137e-12
Identity = 128/541 (23.66%), Postives = 193/541 (35.67%), Query Frame = 3
Query: 3258 FTQAHVGD---YTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQTQTTIVEINPIQFAPVIQDFPQS--IRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVA-----ALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG-----------SVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVR--------------------------------SPPQFVTTFTDEI-VKEGDDVVLKCCLIGYPEPLIWWSYNTHFI---NNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG 4706
             T A VGD   YTC   N  GE      LS             V   P    +  +  ++  + +++ L  E  A     + W KD +PL +R P + I    E    LKI GA V D+G Y    +   G+T+     +N I   P I+   +   +   +   I+++C     P          PA         N A        +  L+G  Q   L       SD   Y     NS G  S M   TV      +++E+ N  +          EI+      V + C   G+P P+L W+K G  L   +  +I   G    L ++  + S+AG+Y   A N  G    K  L+V  P             S+    P       + IP  +     D + I   +  Q++    ++R                                 PP+   +  +EI VKE  ++ L C   G P P I W  + H +    N R + K +L    L + N+   DSGRY   A N +G
Sbjct: 1962 LTNAQVGDAGKYTCVAVNAAGEQQTDYDLS-------------VYVPPNIMGE--EQNISSLISETLILKCESDAIPPPVLTWYKDWKPLVNR-PGLTI---SEDGSILKIEGAQVKDTGRYSCEAVNIAGKTEKNF-NVN-IMVPPAIRGSAEESEVNIIEGTLISLLCDSTGIP---------PPALAWKKNGQHNVAIQSGAAGHIRLLSGGRQ---LQIITARKSDAASYTCTASNSVG--SAMKKYTVKVYVRPSISESGNHPS----------EIVVIQGNNVTLECDARGDPQPMLTWLKEGIPLISGNGFEISSNGRL--LHLQKAQISNAGLYVCVAVNVAGQSDRKYDLKVFVPPAFPDGIMKHENISIVEKNPFTLTCEVSGIPPPKVTWYKDGNPIPPSRSPQIMSGGFLLRFSQSSLSDTGRYTCAVSNAAGEDMRKFDVNVLVPPKITGSVQEEIKVKERGNITLSCEATGTPIPQITWLKDGHPVLEDTNHRIDHKGQL----LRISNVMMTDSGRYVCVASNPAG 2451          

HSP 7 Score: 73.559 bits (179), Expect = 3.873e-12
Identity = 91/370 (24.59%), Postives = 148/370 (40.00%), Query Frame = 3
Query: 3222 NDNGEL-----VFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDP 4316
            NDN  L     V  I      +VG + C  SN  G+       +  E L+  +  IP +   +S +Q     +T      I ++ +  A     + WLKD QPL    P + I    +    ++I+   V D+G Y  +        T    +N IQ  P I++ P  + A  +  + + C+ +  P      W     DGS   +  +NAR+ +            Q   LY   V  +D G+Y     N+AG S   I + V            P  I+     I + IN +  + C+V+G P P ++W KNG  ++   +  + ++  +  LVI +    D GIY   A +  G +    +L V  P
Sbjct: 3456 NDNMHLMKAGQVLRITSAQVENVGRFVCLASNHAGD-------TKKEFLV--KVHIPPNIAGVSGTQ----NITVLQKKQITMECKSDALPPPRITWLKDGQPLQP-SPMVHILSNGQF---VQIDNTEVTDTGRYTCIATNIAGKTTKEFILN-IQVPPSIEEGPSLVTAFVDEPVTLECISSGVP-LPKTAWR---KDGSLLSH--HNARFLV-----------SQNGSLYISAVEVADSGQYFCLATNAAGSSQRQIDLLVY----------DPPRIKSEPTNITAKINIQTTLPCEVTGTPKPKIQWKKNGHPINTDLNQNMYRLLSSGSLVIISPSVDDTGIYVCSALSDAGDDEIDMYLSVHVP 3780          

HSP 8 Score: 72.0182 bits (175), Expect = 1.330e-11
Identity = 140/611 (22.91%), Postives = 231/611 (37.81%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQY---LFRVSSKDVAK----------------------THLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPL-NSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDP 4316
            I WYKD E +LP   P +      Q GK  + I   + +D G Y C V N      K+  V + V ++  G      ++K     +  L+L+    G    P    + + +P+  N           N  + +N + + +++  +Y   L+   + +VA                        H E+ +K +  +H F   S L   +A  IP  N H      I W K+  P    K + K    ++     +  K      G YTC  +N  GE    + L+  E        I  S + I  + L+++        +I L+ +   +    V W KDNQ L N+ D  +      +    L+I+GA V  +GTY+ V             +  +   P I     SI    N  + + C    +P+  S+ W     DGSP  +  N          +  L+G   R+ L   N    D G+Y     N+AG       ++V            P  I   ++ I S I+E +I++C+    P P+L W K+ + L     L I + G    L I+  +  D G Y  +A N  G      ++ ++ P
Sbjct: 1558 IIWYKDGEPLLPS--PYVTY---IQKGKY-LRITESQITDGGTYTCSVTNVAGQTEKNYSVDIYVPARIHGDEKKHQNKKVIVGKS--LTLECEATGHP-PPLITWLKDGVPVETN----------DNIRLHYNGKKLEIRNTVEYDRGLYTCVAVNVAGETEMKYKVSVLAGSSTKQFNVVVHGELKQKHD--HHTF---SYLTSCIASGIP--NPH------ITWLKDGLPFNVAKANIKM---ESFGRSLQFKKTLLEDAGKYTCVATNAAGEAEQTIWLNVYEP-----PKIENSGELIQETVLANH--------NIILECKATGNPDPVVTWFKDNQQLTNTGDISV-----SDRGQVLQISGAQVFHAGTYKCVAASIAGRAELSYNLQ-VHVPPSISGRSSSITVIVNNVVRLECEATGFPA-PSLTWL---KDGSPVSSFTNG---------IQILSGG--RV-LALTNAQVGDAGKYTCVAVNAAGEQQTDYDLSVYV----------PPNIMGEEQNISSLISETLILKCESDAIPPPVLTWYKDWKPLVNRPGLTISEDGSI--LKIEGAQVKDTGRYSCEAVNIAGKTEKNFNVNIMVP 2086          

HSP 9 Score: 66.2402 bits (160), Expect = 7.168e-10
Identity = 91/365 (24.93%), Postives = 138/365 (37.81%), Query Frame = 3
Query: 3228 NGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIK--------LDVEFPADVSSDVVWLKDNQP-LNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK----ETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSE 4283
            +G  +    + + +  G YTC VSN  GED+ K  ++          L+P               +TGSV + IK        L  E        + WLKD  P L   + RI     +     L+I+   + DSG Y  V      E  ++ +  V I+P      I   P+ ++     SI++ C V+S+P   +I W     DG   +   +N R     + L  L    +            D G Y     N AG  +    + V    + +    S        KEI + +N    + C V  NP   + W K+G+ L    HL I   G T  L ++  + SD G Y   ASN  G +
Sbjct: 2332 SGGFLLRFSQSSLSDTGRYTCAVSNAAGEDMRKFDVNV---------LVPPK-------------ITGSVQEEIKVKERGNITLSCEATGTPIPQITWLKDGHPVLEDTNHRI-----DHKGQLLRISNVMMTDSGRYVCVASNPAGERSRSFSLGVLISP-TIKGAINGSPEDVKVVLLSSISLECEVHSHPPA-TITWH---KDGRLFK-FKDNVRILPGGRTLQILKAQEK------------DAGRYSCIATNEAGEGTHHYNLNVHIPPKIRKDDISE--FGGFSKEIKAIVNTNFTLVCDVKANPLAKITWYKDGQPLEPDSHLAIVS-GNT--LYVEKAQVSDTGRYTCLASNIAGED 2646          

HSP 10 Score: 64.3142 bits (155), Expect = 2.567e-9
Identity = 103/500 (20.60%), Postives = 171/500 (34.20%), Query Frame = 3
Query: 3231 GELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTY-----QAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVV---NSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG 4706
            G L  +  +F+ A  G Y C   N+ G+   K+ L      + +QT   VS                 +G  + L           + W + N    S  P    Y  ++   +L+IN   V D G Y         K + Q   T+  +      PVI + P  +   +   + + CV+   N  P  H +             N+V      ++  P   +  +     L+ + V   DGG+Y    +N AG +  +  I V      Q+    P+    ++   +S       + CK SG P P + W K GE +  ++   I +   T  L++ +    D+G Y   A N  G    K  L V   +  ++                               Q+ Q+  S                  V+ GDDV+L C +   P P I W+  T  I +P  +         L +   +  D+G Y+    N +G
Sbjct:  744 GTLKIKNTQFSDA--GHYVCIAVNDAGKANGKVSLRVGSPPVFTQTPGDVSM---------------DIGSDVSLTCSAEGIPEPKIKWRRLNHTSESSKPLSYQYNSQQKAGTLQINKLWVGDEGIYICEAENQFGKISSQATITVTGL----VVPVIGESPSVVSVIEGNQVTLPCVLLVGNPLPERHWVK-----------DNVV------LVTNPYTSIRADG---SLHLERVLLKDGGDYLCTAKNVAGTADRITTINVHVSPVIQH---GPQIFSTIEGIAVS-------LPCKASGVPKPTIIWKKKGEIVVPNNDTIIAESDGT--LLLSSPGGEDSGEYSCSAINAAGYAARKVQLTVYGKVFLLS-------------------------------QKNQIEIS------------------VRAGDDVILPCEVKSVPPPFITWAKETQLI-SPFSQRHSIFPSGSLKIFETRVSDAGMYTCVGTNIAG 1140          

HSP 11 Score: 63.929 bits (154), Expect = 3.415e-9
Identity = 103/428 (24.07%), Postives = 156/428 (36.45%), Query Frame = 3
Query: 3447 IKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAV-LKETGQTQTTI-VEI-NPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPI-NEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEI-VKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKREL---DEYFLILKNIQKGDSGRYSITAENSSG 4706
            I L  E        V WLKD   LNS D  + I        +L+I    ++D G Y  + + + G+ + T  ++I  P      ++D    +  K N S  + C  N+ P+   INW     +G P R     + Y+ +           QR+ +   N    D GEY   V N  G  +    + V               IQ L  E  + I    V   C   G P P L+W+K+G  +  +D L+I+ +    ++ I   + +D G Y   ASN  G+                      EK    T I T +  P+ D S +                         T+E+ V  G+ + L C   G P P+I W  +   I N   E        D   L +   Q  D G+Y+  A N +G
Sbjct: 2864 ISLTCEVTGFPPPAVSWLKDTMVLNS-DSHLFIV---PGGRTLQIPQTRLSDVGEYSCIAINQAGEAKKTFFLDIYAPPSIVANVRDSSTEVNVKVNASTILECESNAIPA-PVINWY---KNGQPIRE---TSSYQFLE--------GGQRLNI--RNAQVFDTGEYECIVTNVVGQDNKKFFLNVYVHPS----------IQGLQNEYHNGIIQNSVTFSCDAYGIPVPTLRWLKDGHPIGLTDSLEIQILSGGSKMKIARAQLTDGGTYTCLASNVEGTA---------------------EK----TYILTIQVPPSIDGSGM-------------------------TNELNVLPGEIIQLICNAKGIPTPVIHWLKDGKHITNLVGETISGCITSDGEILTISKTQTSDMGKYTCVATNPAG 3210          

HSP 12 Score: 62.7734 bits (151), Expect = 8.816e-9
Identity = 113/506 (22.33%), Postives = 185/506 (36.56%), Query Frame = 3
Query: 3216 YINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKP-ISSSQLSD--NYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK-ETGQTQTT-IVEIN-PIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINW--SIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFE-MKRELDEYFLILKNIQKGDSGRYSITAENSSG 4706
            YI   G +V  I K     +  YTC  SN  G              +S   ++ V   P I+ S++++  + V  +  D +     FP  +   + WLKD QPL+  D    ++  +  +  L+I  A V + G +  +     G T+   +V+++ P   A V     Q+I   Q   I + C  ++ P    I W    +P   SP  ++++N ++  I                  DN   +D G Y     N AG ++    + +            P  I++    + + ++E V + C  SG P P   W K+G  LS   H     V +   L I   + +D+G Y   A+N  GS   +  L V DP                                                   P+  +  T+   K      L C + G P+P I W  N H IN    + M R L    L++ +    D+G Y  +A + +G
Sbjct: 3367 YIQSQG-MVLHIVKAKMDDIARYTCVASNAAGR-------------VSKHFILNVMEPPHINGSEVTEELSVVVNTHLDLLCYTTGFPPPL---ITWLKDGQPLSQND---NMHLMKAGQV-LRITSAQVENVGRFVCLASNHAGDTKKEFLVKVHIPPNIAGV--SGTQNITVLQKKQITMECKSDALPP-PRITWLKDGQPLQPSPMVHILSNGQFVQI------------------DNTEVTDTGRYTCIATNIAGKTTKEFILNIQV----------PPSIEEGPSLVTAFVDEPVTLECISSGVPLPKTAWRKDGSLLSH--HNARFLVSQNGSLYISAVEVADSGQYFCLATNAAGSSQRQIDLLVYDP---------------------------------------------------PRIKSEPTNITAKINIQTTLPCEVTGTPKPKIQWKKNGHPINTDLNQNMYRLLSSGSLVIISPSVDDTGIYVCSALSDAG 3767          

HSP 13 Score: 60.077 bits (144), Expect = 5.924e-8
Identity = 124/553 (22.42%), Postives = 197/553 (35.62%), Query Frame = 3
Query: 3219 INDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQ--------DFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWS------SVMIPITVAALAEAQNKKTSPKFIQKLD-KEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDP--------------IGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIF----------SNTIVRS-------PPQFVTTFTDEI-VKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLI--------LKNIQKGDSGRYSITAENSSGLA 4712
            I+  G+L   I        G Y C  SN  GE      L     LIS     P     I+ S      V  S   SI L+ E  +   + + W KD +    +D  ++I        +L+I  A   D+G Y  +        T    +N +   P I+         F + I+A  N +  +VC V + P    I W     DG P             +  L  ++GN     LY +    SD G Y     N AG        ++ +P     L+       S       + KE+I  IN    + C+ +  P P + W K+ + L+ S+   I   G  H L I   ++ DAG Y   A N  G +    +++V+ P                 VN T  ++  ++ T  P        D   I         +          S ++ +S       PP  + + ++ + V E + + L C + G+P P + W  +T  +N+         D +  I        +   +  D G YS  A N +G A
Sbjct: 2422 IDHKGQL-LRISNVMMTDSGRYVCVASNPAGERSRSFSLGV---LIS-----PTIKGAINGSPEDVKVVLLS---SISLECEVHSHPPATITWHKDGRLFKFKD-NVRIL---PGGRTLQILKAQEKDAGRYSCIATNEAGEGTHHYNLN-VHIPPKIRKDDISEFGGFSKEIKAIVNTNFTLVCDVKANP-LAKITWY---KDGQPLEP----------DSHLAIVSGNT----LYVEKAQVSDTGRYTCLASNIAGEDELDFDVTIQVPPNFPKLSGLWTTSKSSTGSSNGEHKEVI--INNPFSLYCETNAVPPPTITWYKDDKLLTPSNRAFILPGG--HILQIARAQEDDAGTYTCVAVNEAGRDSMHYNVRVLLPPAFEGSDEDLSKDITSLVNETLEMDCTVAVTGSPAPTISWLKDGHPIQEGTHNTCAYKFLHNGRKGLSGSVQKSFNLNIYVPPSVIGSNSENVTVVESNFISLTCEVTGFPPPAVSWLKDTMVLNS---------DSHLFIVPGGRTLQIPQTRLSDVGEYSCIAINQAGEA 2926          

HSP 14 Score: 53.9138 bits (128), Expect = 3.648e-6
Identity = 105/492 (21.34%), Postives = 160/492 (32.52%), Query Frame = 3
Query: 3276 GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHN 4748
            G+YTC   N  G     + LS          L+P    P     + D  V+  + D   L        +  + W K+N P+  +  +  +    E    L +  A   D GTY           T  V +  + F P   + P  +   +   ++++C     P  H+  W  K         ++ + R K             Q+ EL  D V+  + G Y    EN     +  I + V         K  P      +K    P+   +I+ C V GNP P ++W K  + +S + H+K    G    L I + +  D G Y   A+N  G                      LE  ++ T+                  QR            PP       D  V  G  V L C   G P P I W+ +N    +  R  +   L    L + + QK D+  Y   A N  G         V  H 
Sbjct: 4027 GEYTCTAENIAGSVNSSMNLSV---------LVP----PRIVKNIKD--VSVVINDQTTLPCAAHGIPTPTITWAKNNLPITVKAGKYSVLASGE----LILYNAQHKDVGTYTCTASNAIGEDTHTVRLT-VHFPPSFTEMPTIVSLNEGERLSLLCKATGNPLPHT-TWIFK----DKILPVLQDRRSK-------------QQNELVIDKVSRENSGAYMCVAENIVASINTTIHVFV---------KEPPVLNGVHNKHRTVPLGGNIILNCVVKGNPFPKIQWHKKAKVISYNKHIKEFSNG---SLAIYDLE--DVGDYTCIAANDAGV---------------------LEHTVTLTL------------------QR------------PPTIKVPPLDTTVDAGATVALNCQSEGEPVPTITWYRHNNPISSEDRITI---LPNNSLQIVSAQKEDTSVYECKATNIMGTDVVKVTFTVQVHG 4412          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Xenopus
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:Xenbase;Acc:XB-GENE-972643])

HSP 1 Score: 102.449 bits (254), Expect = 8.689e-21
Identity = 147/575 (25.57%), Postives = 233/575 (40.52%), Query Frame = 3
Query: 2622 QCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANT---EPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVAKTHLEIG----EKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYIND-NGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEA--LISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDP 4316
            Q NSQ     + I+     D G Y CE  N    I   + + ++      G V+P   E     +      ++L  VL      PE   + +N+ +  N    P++ + ++  +      V LKD G YL   ++K+VA T   I          + H  +  S + + +A+S+P K      P TIIWKK    +     ++ T I + +G L+   P    +  G+Y+C   N  G    K+QL+      L+S +  I +S +                GD + L  E  +     + W K+ Q ++    R  I+       SLKI    V+D+G Y  V        T +V+++ +   P IQ  P+ IR K   S  I C+ +  P               PT     + +    ++  +    NM R+E    +   SDGG Y     N  G  S     TV   A        P +  K ++E IS   +++   C V G+P P++KW +NG+EL+ S+   +  V +   LVI +    D G Y   ASN  G    K  L+V DP
Sbjct:  843 QYNSQQKAGTLQINKLWVGDEGIYICEAENQFGKISSQATITVT------GLVVPVIGESPSVVSVIEGNQVTLPCVLLVGNPLPERHWVKDNVVLVTN----PYTSIRADGSLHLER--VLLKDGGDYL--CTAKNVAGTADRITTINVHVSPVIQHGPQIFSTI-EGIAVSLPCKASGVPKP-TIIWKKKGEIVVP---NNDTIIAESDGTLLLSSPGGEDS--GEYSCSAINAAGYAARKVQLTVYGKVFLLSQKNQIEISVR---------------AGDDVILPCEVKSVPPPFITWAKETQLISPFSQRHSIF----PSGSLKIFETRVSDAGMYTCVGTNIAGNITQLVKLS-VYVPPKIQRGPKLIRVKLGHSFEIACISHGIPP--------------PTAAWYKDGQIMEFDQGQDN---NMLRVE----SAKPSDGGTYTCVASNVIGTDSANA--TVEIYAPPTLSDLEPPY-NKQNQERIS--RQQISFPCPVKGHPKPVIKWFRNGKELTGSEP-GVNIVEDRAVLVIDSLTPYDNGEYTCVASNEAGQTEKKYSLKVHDP 1349          

HSP 2 Score: 88.5817 bits (218), Expect = 1.346e-16
Identity = 119/491 (24.24%), Postives = 178/491 (36.25%), Query Frame = 3
Query: 3243 FEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIE----LYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRK--VGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAEN 4697
             EIP    +H G YTC+  N+ G   + + L   E              P+   Q  ++Y+   + +S+ L  E        + W K+   + S        Y   S  +L I  AT  D+GTY  + +    T    V +  +   PVI    +      + SI IVC                 A GSPT  ++    +     PL KL G  QR+     L+   V   D GEY    EN AG  SV   + ++ L         P  I K  K++   IN++  + C   G P P + W KN   ++    +K  K  V  + EL++ N +  D G Y   ASN  G +     L V               P SFT +PT                    I S                  + EG+ + L C   G P P   W +    +  P  + +R   +  L++  + + +SG Y   AEN
Sbjct: 3835 LEIPSSRLSHAGKYTCRAVNQVGSAHIHVNLHVQEV-------------PVIKEQ--NDYLEVVLSNSVTLACEASGTPIPTISWQKEGVGIKSGSS-----YTILSNGNLNIASATQEDAGTYTCIAQNPAGTALKKVRLK-VHVPPVIVPHQKEYVISMDKSIMIVC----------------EAHGSPTPEII----WHKDGVPLAKLAG--QRMSATGGLHIAVVQPDDAGEYTCTAENIAG--SVNSSMNLSVLV--------PPRIVKNIKDVSVVINDQTTLPCAAHGIPTPTITWAKNNLPIT----VKAGKYSVLASGELILYNAQHKDVGTYTCTASNAIGEDTHTVRLTV-------------HFPPSFTEMPT--------------------IVS------------------LNEGERLSLLCKATGNPLPHTTWIFKDKIL--PVLQDRRSKQQNELVIDKVSRENSGAYMCVAEN 4215          

HSP 3 Score: 87.4261 bits (215), Expect = 2.570e-16
Identity = 108/451 (23.95%), Postives = 163/451 (36.14%), Query Frame = 3
Query: 3423 VTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDP-RIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQN------GSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAG---WSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPR---FEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +T +VG    L  +  + V  ++ WL++N  L   +P ++ I        SL+I   T++D G Y       G T T  V +       + QD P+++   +N        I + C+V  YP+ H I W            + N+   +  N+ +    G          N    D G Y     N+AG    +SVM+ I V  +   +N             E++ P+  +  + CK +G P P++ W K    LS S  + I  +  T  L IKN + SDAG Y   A N  G    K  L+V  P                   P     P D + DI                                G DV L C   G PEP I W    H   + +   ++   +     L +  +  GD G Y   AEN  G  +  A + V
Sbjct:  530 ITVTVGKGAILTCDVVSTVRFNLTWLRNNLDLKHMNPSKLSILRNN----SLEIKSVTIDDGGEYNCFASNEGGTATASVTL-------IAQDPPKAVLEPRNVTFTKGAEIKLKCLVTGYPTPHII-W------------MHNDMFVRFSNRYIITHNGT-----FIIKNAVERDSGVYKCLATNAAGTDHQTSVMVYIEVPQVTAVKN-------------EMLVPVGSETTLACKATGIPRPLIHWYKGKSTLSPSALITIDSLLGT--LKIKNTQFSDAGHYVCIAVNDAGKANGKVSLRVGSP-------------------PVFTQTPGDVSMDI--------------------------------GSDVSLTCSAEGIPEPKIKWRRLNHTSESSKPLSYQYNSQQKAGTLQINKLWVGDEGIYICEAENQFGKISSQATITV 885          

HSP 4 Score: 77.7962 bits (190), Expect = 2.595e-13
Identity = 117/528 (22.16%), Postives = 199/528 (37.69%), Query Frame = 3
Query: 3144 MSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAV-LKETGQTQ-----TTIVEINPIQFAPVIQ-DFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG 4706
            + P TIIW K+  PL  +   + TYI     L     + T    G YTC V+N  G+          E   S    +P           +   +   VG S+ L+ E        + WLKD  P+ + D  I+++Y  +    L+I      D G Y  V +   G+T+     + +   +  QF  V+  +  Q         +  VC+ +  P+ H I W     DG P      N + +   +             L F      D G+Y     N+AG +   I + V    + +N   S + IQ+    +++  N  +I+ CK +GNP+P++ W K+ ++L+ +  + +   G+   L I   +   AG Y+  A++  G      +LQV  P                                IS    +  +  N +VR                     L+C   G+P P + W  +   +++    ++       L L N Q GD+G+Y+  A N++G
Sbjct: 1565 IPPPTIIWYKDGEPLLPS--PYVTYIQKGKYLRITESQITDG--GTYTCSVTNVAGQ---------TEKNYSVDIYVPARIHGDEKKHQNKKVI---VGKSLTLECEATGHPPPLITWLKDGVPVETND-NIRLHYNGKK---LEIRNTVEYDRGLYTCVAVNVAGETEMKYKVSVLAGSSTKQFNVVVHGELKQKHDHHTFSYLTSVCIASGIPNPH-ITWL---KDGLPFNVAKANIKMESFGR------------SLQFKKTLLEDAGKYTCVATNAAGEAEQTIWLNVYEPPKIEN---SGELIQE---TVLA--NHNIILECKATGNPDPVVTWFKDNQQLTNTGDISVSDRGQV--LQISGAQVFHAGTYKCVAASIAGRAELSYNLQVHVP------------------------------PSISGRSSSITVIVNNVVR---------------------LECEATGFPAPSLTWLKDGSPVSSFTNGIQILSGGRVLALTNAQVGDAGKYTCVAVNAAG 1995          

HSP 5 Score: 73.559 bits (179), Expect = 3.939e-12
Identity = 111/481 (23.08%), Postives = 175/481 (36.38%), Query Frame = 3
Query: 3276 GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDP-RIQIYYPEESKCSLKINGATVNDSGTYQAVLKET-GQTQTTIVEINPIQFAPVI--QDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG 4706
            G+Y C V+N  G+D  K  L+             V   P S   L + Y  G + +S+    +        + WLKD  P+   D   IQI         +KI  A + D GTY  +     G  + T +    IQ  P I        +       I ++C     P+   I+W     DG      + +  Y  IN     +T + +   L      TSD G+Y     N AG    +  + V    +  + K +P  +  +       ++  + V C  SG P P + W+KNG  L  S  ++++  G+   L I   +KSD   Y   ASN  G +    ++QV                            P+ D +D+     TQ I   T++R  P                VV++C   G P P I W  +   + +      +       I+K  +  D  RY+  A N++G
Sbjct: 3009 GEYECIVTNVVGQDNKKFFLN-------------VYVHP-SIQGLQNEYHNGIIQNSVTFSCDAYGIPVPTLRWLKDGHPIGLTDSLEIQIL---SGGSKMKIARAQLTDGGTYTCLASNVEGTAEKTYILT--IQVPPSIDGSGMTNELNVLPGEIIQLICNAKGIPT-PVIHWL---KDG----KHITSEDYLGIN-----ITSDGEI--LTISKTQTSDMGKYTCVATNPAGEDDRIFNVNVFVAPKIDDNKGTPVVLTAV-------LDTSINVECHASGFPTPQINWLKNGLPLPVSSQVRLQSGGQV--LRISRVQKSDGATYTCIASNRAGVDKKDYNIQV-------------------------YVSPSLDEADV-----TQQI---TVIRDDP----------------VVMRCIANGVPAPRISWLKDGKQLGDEYLPYIQSQGMVLHIVK-AKMDDIARYTCVASNAAG 3396          

HSP 6 Score: 73.559 bits (179), Expect = 4.142e-12
Identity = 91/370 (24.59%), Postives = 148/370 (40.00%), Query Frame = 3
Query: 3222 NDNGEL-----VFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDP 4316
            NDN  L     V  I      +VG + C  SN  G+       +  E L+  +  IP +   +S +Q     +T      I ++ +  A     + WLKD QPL    P + I    +    ++I+   V D+G Y  +        T    +N IQ  P I++ P  + A  +  + + C+ +  P      W     DGS   +  +NAR+ +            Q   LY   V  +D G+Y     N+AG S   I + V            P  I+     I + IN +  + C+V+G P P ++W KNG  ++   +  + ++  +  LVI +    D GIY   A +  G +    +L V  P
Sbjct: 3455 NDNMHLMKAGQVLRITSAQVENVGRFVCLASNHAGD-------TKKEFLV--KVHIPPNIAGVSGTQ----NITVLQKKQITMECKSDALPPPRITWLKDGQPLQP-SPMVHILSNGQF---VQIDNTEVTDTGRYTCIATNIAGKTTKEFILN-IQVPPSIEEGPSLVTAFVDEPVTLECISSGVP-LPKTAWR---KDGSLLSH--HNARFLV-----------SQNGSLYISAVEVADSGQYFCLATNAAGSSQRQIDLLVY----------DPPRIKSEPTNITAKINIQTTLPCEVTGTPKPKIQWKKNGHPINTDLNQNMYRLLSSGSLVIISPSVDDTGIYVCSALSDAGDDEIDMYLSVHVP 3779          

HSP 7 Score: 73.1738 bits (178), Expect = 6.044e-12
Identity = 137/610 (22.46%), Postives = 232/610 (38.03%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQY---LFRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDS-----LAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPK-------FTQA---------HVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPL-NSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDP 4316
            I WYKD E +LP   P +      Q GK  + I   + +D G Y C V N      K+  V + V ++  G      ++K     +  L+L+    G    P    + + +P+  N           N  + +N + + +++  +Y   L+   + +VA      GE       ++K + L G S     + +   +K  H     T  +  +    +     H T++ D   L F + K       F ++           G YTC  +N  GE    + L+  E        I  S + I  + L+++        +I L+ +   +    V W KDNQ L N+ D  +      +    L+I+GA V  +GTY+ V             +  +   P I     SI    N  + + C    +P+  S+ W     DGSP  +  N          +  L+G   R+ L   N    D G+Y     N+AG       ++V            P  I   ++ I S I+E +I++C+    P P+L W K+ + L     L I + G    L I+  +  D G Y  +A N  G      ++ ++ P
Sbjct: 1570 IIWYKDGEPLLPS--PYVTY---IQKGKY-LRITESQITDGGTYTCSVTNVAGQTEKNYSVDIYVPARIHGDEKKHQNKKVIVGKS--LTLECEATGHP-PPLITWLKDGVPVETN----------DNIRLHYNGKKLEIRNTVEYDRGLYTCVAVNVA------GE----TEMKYKVSVLAGSSTKQFNVVVHGELKQKHDH--HTFSYLTSVCIASGIPNPHITWLKDG--LPFNVAKANIKMESFGRSLQFKKTLLEDAGKYTCVATNAAGEAEQTIWLNVYEP-----PKIENSGELIQETVLANH--------NIILECKATGNPDPVVTWFKDNQQLTNTGDISV-----SDRGQVLQISGAQVFHAGTYKCVAASIAGRAELSYNLQ-VHVPPSISGRSSSITVIVNNVVRLECEATGFPA-PSLTWL---KDGSPVSSFTNG---------IQILSGG--RV-LALTNAQVGDAGKYTCVAVNAAGEQQTDYDLSVYV----------PPNIMGEEQNISSLISETLILKCESDAIPPPVLTWYKDWKPLVNRPGLTISEDGSI--LKIEGAQVKDTGRYSCEAVNIAGKTEKNFNVNIMVP 2099          

HSP 8 Score: 67.0106 bits (162), Expect = 4.051e-10
Identity = 126/515 (24.47%), Postives = 188/515 (36.50%), Query Frame = 3
Query: 3258 FTQAHVGD---YTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQTQTTIVEINPIQFAPVIQDFPQS--IRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVA-----ALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG-----------SVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIV-----KEGDDVVL-KCCLIGY-PEPLIWWSYNTHFI---NNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG 4706
             T A VGD   YTC   N  GE      LS             V   P    +  +  ++  + +++ L  E  A     + W KD +PL +R P + I    E    LKI GA V D+G Y    +   G+T+     +N I   P I+   +   +   +   I+++C     P          PA         N A        +  L+G  Q   L       SD   Y     NS G  S M   TV      +++E+ N  +          EI+      V + C   G+P P+L W+K G  L   +  +I   G    L ++  + S+AG+Y   A N  G    K  L+V  P             S+    P       + IP  +     D + I  P R+  I S   +    Q   + T           GD  ++ +  LI + P P I W  + H +    N R + K +L    L + N+   DSGRY   A N +G
Sbjct: 1975 LTNAQVGDAGKYTCVAVNAAGEQQTDYDLS-------------VYVPPNIMGE--EQNISSLISETLILKCESDAIPPPVLTWYKDWKPLVNR-PGLTI---SEDGSILKIEGAQVKDTGRYSCEAVNIAGKTEKNF-NVN-IMVPPAIRGSAEESEVNIIEGTLISLLCDSTGIP---------PPALAWKKNGQHNVAIQSGAAGHIRLLSGGRQ---LQIITARKSDAASYTCTASNSVG--SAMKKYTVKVYVRPSISESGNHPS----------EIVVIQGNNVTLECDARGDPQPMLTWLKEGIPLISGNGFEISSNGRL--LHLQKAQISNAGLYVCVAVNVAGQSDRKYDLKVFVPPAFPDGIMKHENISIVEKNPFTLTCEVSGIPPPKVTWYKDGNPI-PPSRSPQIMSGGFLLRFSQSSLSDTGRYTCAVSNAAGDKYIMGEIELIAWTPIPQITWLKDGHPVLEDTNHRIDHKGQL----LRISNVMMTDSGRYVCVASNPAG 2437          

HSP 9 Score: 64.3142 bits (155), Expect = 2.677e-9
Identity = 103/500 (20.60%), Postives = 171/500 (34.20%), Query Frame = 3
Query: 3231 GELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTY-----QAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVV---NSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG 4706
            G L  +  +F+ A  G Y C   N+ G+   K+ L      + +QT   VS                 +G  + L           + W + N    S  P    Y  ++   +L+IN   V D G Y         K + Q   T+  +      PVI + P  +   +   + + CV+   N  P  H +             N+V      ++  P   +  +     L+ + V   DGG+Y    +N AG +  +  I V      Q+    P+    ++   +S       + CK SG P P + W K GE +  ++   I +   T  L++ +    D+G Y   A N  G    K  L V   +  ++                               Q+ Q+  S                  V+ GDDV+L C +   P P I W+  T  I +P  +         L +   +  D+G Y+    N +G
Sbjct:  756 GTLKIKNTQFSDA--GHYVCIAVNDAGKANGKVSLRVGSPPVFTQTPGDVSM---------------DIGSDVSLTCSAEGIPEPKIKWRRLNHTSESSKPLSYQYNSQQKAGTLQINKLWVGDEGIYICEAENQFGKISSQATITVTGL----VVPVIGESPSVVSVIEGNQVTLPCVLLVGNPLPERHWVK-----------DNVV------LVTNPYTSIRADG---SLHLERVLLKDGGDYLCTAKNVAGTADRITTINVHVSPVIQH---GPQIFSTIEGIAVS-------LPCKASGVPKPTIIWKKKGEIVVPNNDTIIAESDGT--LLLSSPGGEDSGEYSCSAINAAGYAARKVQLTVYGKVFLLS-------------------------------QKNQIEIS------------------VRAGDDVILPCEVKSVPPPFITWAKETQLI-SPFSQRHSIFPSGSLKIFETRVSDAGMYTCVGTNIAG 1152          

HSP 10 Score: 62.3882 bits (150), Expect = 9.349e-9
Identity = 114/504 (22.62%), Postives = 185/504 (36.71%), Query Frame = 3
Query: 3216 YINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKP-ISSSQLSD--NYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK-ETGQTQTT-IVEIN-PIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFE-MKRELDEYFLILKNIQKGDSGRYSITAENSSG 4706
            YI   G +V  I K     +  YTC  SN  G              +S   ++ V   P I+ S++++  + V  +  D +     FP  +   + WLKD QPL+  D    ++  +  +  L+I  A V + G +  +     G T+   +V+++ P   A V     Q+I   Q   I + C  ++ P    I W     DG P +             P+  +  N Q +++  DN   +D G Y     N AG ++    + +            P  I++    + + ++E V + C  SG P P   W K+G  LS   H     V +   L I   + +D+G Y   A+N  GS   +  L V DP                                                   P+  +  T+   K      L C + G P+P I W  N H IN    + M R L    L++ +    D+G Y  +A + +G
Sbjct: 3366 YIQSQG-MVLHIVKAKMDDIARYTCVASNAAGR-------------VSKHFILNVMEPPHINGSEVTEELSVVVNTHLDLLCYTTGFPPPL---ITWLKDGQPLSQND---NMHLMKAGQV-LRITSAQVENVGRFVCLASNHAGDTKKEFLVKVHIPPNIAGV--SGTQNITVLQKKQITMECKSDALPP-PRITWL---KDGQPLQ-----------PSPMVHILSNGQFVQI--DNTEVTDTGRYTCIATNIAGKTTKEFILNIQV----------PPSIEEGPSLVTAFVDEPVTLECISSGVPLPKTAWRKDGSLLSH--HNARFLVSQNGSLYISAVEVADSGQYFCLATNAAGSSQRQIDLLVYDP---------------------------------------------------PRIKSEPTNITAKINIQTTLPCEVTGTPKPKIQWKKNGHPINTDLNQNMYRLLSSGSLVIISPSVDDTGIYVCSALSDAG 3766          

HSP 11 Score: 57.3806 bits (137), Expect = 3.147e-7
Identity = 156/731 (21.34%), Postives = 268/731 (36.66%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRN--GPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVS--SKDVAKT-HLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGE--DVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQN--------GSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGL 4709
            I WYKD++ + P     IL       G   + I   +E DAG Y C   N  G   +  +  VLL    +     + K    +    T  +   + + G   AP    + +  PI        +  +++   ++  +    L D G+Y+  V   +  V K+ +L I   P  +     EN  + +S  IS+  +      P  + W K+   L ++  SH   +   G    +IP+   + VG+Y+C   N+ GE      L + A  +++++              + S   V   V  S  L+ E  A  +  + W K+ QP+         Y   E    L I  A V D+G Y+ ++       T +V  +  +F   +   P SI+  QN         S+   C     P   ++ W     DG P   L ++   ++++       G+  +I         +DGG Y     N  G +     +T+           + + +  L  EII  I       C   G P P++ W+K+G+ ++  D+L I    +   L I   + SD G Y   A+N  G +         D I +VN            + P       DDN                  +  P  +T   D  +       ++C   G+P P I W  N   +     +++ +     L +  +QK D   Y+  A N +G+
Sbjct: 2690 ITWYKDDKLLTPSNRAFIL------PGGHILQIARAQEDDAGTYTCVAVNEAGRDSMHYNVRVLLPPAFEGSDEDLSK-DITSLVNETLEMDCTVAVTGSP-APTISWLKDGHPI---QEGTRYHFLTNGRTLKILY--AQLMDTGRYVCVVENPAGSVQKSFNLNIYVPPSVIGSN-SENVTVVESNFISLTCE-VTGFPPPAVSWLKDTMVLNSD--SHLFIVP--GGRTLQIPQTRLSDVGEYSCIAINQAGEAKKTFFLDIYAPPSIVAN-------------VRDSSTEVNVKVNASTILECESNAIPAPVINWYKNGQPIRETSS----YQFLEGGQRLNIRNAQVFDTGEYECIV-------TNVVGQDNKKFFLNVYVHP-SIQGLQNEYHNGIIQNSVTFSCDAYGIP-VPTLRWL---KDGHPI-GLTDSLEIQILSG------GSKMKIA----RAQLTDGGTYTCLASNVEGTAEKTYILTIQVPPSIDGSGMTNE-LNVLPGEIIQLI-------CNAKGIPTPVIHWLKDGKHITSEDYLGINITSDGEILTISKTQTSDMGKYTCVATNPAGED---------DRIFNVN----------VFVAPK-----IDDN------------------KGTPVVLTAVLDTSIN------VECHASGFPTPQINWLKNGLPLPVSS-QVRLQSGGQVLRISRVQKSDGATYTCIASNRAGV 3304          

HSP 12 Score: 53.9138 bits (128), Expect = 3.773e-6
Identity = 127/597 (21.27%), Postives = 223/597 (37.35%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQ----FNHRSVSLKDVGQY---LFRVSSKDVAKTHLEIGEKPEFVYHQFK-ENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQD---FPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQK-LDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDP 4316
            + W KD   +  D    I+       G   + I   R SD G+Y C   N     +K+    L +++    +++    + +   N + ++   +L+      ES+ I   + IN   +  P  + SS + ++     N R+  + D G+Y   +  V  +D  K  L +   P     Q +  N ++ +S+  S    + + +   T+ W K+  P+          ++   ++     + T    G YTC  SN              E       ++ +   P        N +    G+ I+L        +  + WLKD + + S D  + I    + +  L I+    +D G Y  V          I  +N +  AP I D    P  + A  + SIN+ C  + +P+   INW            L N     + ++   +  G + RI      V  SDG  Y     N AG       I V           SP   +  + ++I    ++ V++RC  +G P P + W+K+G++L +     I+  G    +V    K  D   Y   ASN  G       L V++P
Sbjct: 2879 VSWLKDTMVLNSDSHLFIV------PGGRTLQIPQTRLSDVGEYSCIAINQAGEAKKT--FFLDIYAPP--SIVANVRDSSTEVNVK-VNASTILEC-----ESNAIPAPV-INWYKNGQPIRETSSYQFLEGGQRLNIRNAQVFDTGEYECIVTNVVGQDNKKFFLNVYVHPSIQGLQNEYHNGIIQNSVTFSC---DAYGIPVPTLRWLKDGHPIGLTDSLEIQILSGGSKMKIARAQLTDG--GTYTCLASN-------------VEGTAEKTYILTIQVPPSIDGSGMTNELNVLPGEIIQLICNAKGIPTPVIHWLKDGKHITSED-YLGINITSDGEI-LTISKTQTSDMGKYTCVATNPAGEDDRIFNVN-VFVAPKIDDNKGTPVVLTAVLDTSINVECHASGFPT-PQINW------------LKNGLPLPVSSQVRLQSGGQVLRIS----RVQKSDGATYTCIASNRAGVDKKDYNIQVYV---------SPSLDEADVTQQITVIRDDPVVMRCIANGVPAPRISWLKDGKQLGDEYLPYIQSQGMVLHIV--KAKMDDIARYTCVASNAAGRVSKHFILNVMEP 3409          

HSP 13 Score: 53.9138 bits (128), Expect = 4.138e-6
Identity = 105/492 (21.34%), Postives = 160/492 (32.52%), Query Frame = 3
Query: 3276 GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHN 4748
            G+YTC   N  G     + LS          L+P    P     + D  V+  + D   L        +  + W K+N P+  +  +  +    E    L +  A   D GTY           T  V +  + F P   + P  +   +   ++++C     P  H+  W  K         ++ + R K             Q+ EL  D V+  + G Y    EN     +  I + V         K  P      +K    P+   +I+ C V GNP P ++W K  + +S + H+K    G    L I + +  D G Y   A+N  G                      LE  ++ T+                  QR            PP       D  V  G  V L C   G P P I W+ +N    +  R  +   L    L + + QK D+  Y   A N  G         V  H 
Sbjct: 4026 GEYTCTAENIAGSVNSSMNLSV---------LVP----PRIVKNIKD--VSVVINDQTTLPCAAHGIPTPTITWAKNNLPITVKAGKYSVLASGE----LILYNAQHKDVGTYTCTASNAIGEDTHTVRLT-VHFPPSFTEMPTIVSLNEGERLSLLCKATGNPLPHT-TWIFK----DKILPVLQDRRSK-------------QQNELVIDKVSRENSGAYMCVAENIVASINTTIHVFV---------KEPPVLNGVHNKHRTVPLGGNIILNCVVKGNPFPKIQWHKKAKVISYNKHIKEFSNG---SLAIYDLE--DVGDYTCIAANDAGV---------------------LEHTVTLTL------------------QR------------PPTIKVPPLDTTVDAGATVALNCQSEGEPVPTITWYRHNNPISSEDRITI---LPNNSLQIVSAQKEDTSVYECKATNIMGTDVVKVTFTVQVHG 4411          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Xenopus
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:Xenbase;Acc:XB-GENE-972643])

HSP 1 Score: 93.2041 bits (230), Expect = 5.268e-18
Identity = 139/559 (24.87%), Postives = 228/559 (40.79%), Query Frame = 3
Query: 2676 SDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANT---EPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVAKTHLEIG----EKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYIND-NGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEAL----ISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDP 4316
             D G Y CE  N    I   + + ++      G V+P   E     +      ++L  VL      PE   + +N+ +     + P++ + ++  +      V LKD G YL   ++K+VA T   I          + H  +  S + + +A+S+P K      P TIIWKK    +     ++ T I + +G L+   P    +  G+Y+C   N  G    K+QL+    +    I ++  I +S +                GD + L  E  +     + W K+ Q ++    R  I+       SLKI    V+D+G Y  V        T +V+++ +   P IQ  P+ IR K   S  I C+ +  P               PT     + +    ++  +    NM R+E    +   SDGG Y     N  G  +   P T++ L    NK+         ++E IS   +++   C V G+P P++KW +NG+EL+ S+   +  V +   LVI +    D G Y   ASN  G    K  L+V DP
Sbjct:  862 GDEGIYICEAENQFGKISSQATITVT------GLVVPVIGESPSVVSVIEGNQVTLPCVLLVGNPLPERHWVKDNVLV-----TNPYTSIRADGSLHLER--VLLKDGGDYL--CTAKNVAGTADRITTINVHVSPVIQHGPQIFSTI-EGIAVSLPCKASGVPKP-TIIWKKKGEIVVP---NNDTIIAESDGTLLLSSPGGEDS--GEYSCSAINAAGYAARKVQLTVYGKVFLLYIGNKNQIEISVR---------------AGDDVILPCEVKSVPPPFITWAKETQLISPFSQRHSIF----PSGSLKIFETRVSDAGMYTCVGTNIAGNITQLVKLS-VYVPPKIQRGPKLIRVKLGHSFEIACISHGIPP--------------PTAAWYKDGQIMEFDQGQDN---NMLRVE----SAKPSDGGTYTCVASNVIGTDT---PPTLSDLEPPYNKQ---------NQERIS--RQQISFPCPVKGHPKPVIKWFRNGKELTGSEP-GVNIVEDRAVLVIDSLTPYDNGEYTCVASNEAGQTEKKYSLKVHDP 1342          

HSP 2 Score: 92.4337 bits (228), Expect = 8.645e-18
Identity = 161/730 (22.05%), Postives = 290/730 (39.73%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNN------MPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDV---AKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVF-----EIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQ-DFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG 4706
            IQW+K+N  +L   DP +++  N Q     +HI + R SD+G+Y C   N  +   ++  + L+V+S          ++ +F  N E   + L  D     P + + + +       P         + +++ +++      + S+ +V     +  S D+   A+ H   G++ +   HQ K+  ++G SL +           P  I W K+  P+ T         NDN  L +     EI    +   G YTC   N  GE  +K ++S          L+P S +    +  +D+ V  S   +++L+          V+WLK+  P+++   R+ I   + +   L I+    +DSG YQ V+K    + T        QF  V+    P SI   +  +  + C+ +  P+ H I W     DG P      N + +   +             L F      D G+Y     N+AG +   I + V    + +N   S + IQ+    +++  N  +I+ CK +GNP+P++ W K+ ++L+ +  + +   G+   L I   +   AG Y+  A++  G      +LQV  P                                IS    +  +  N +VR                     L+C   G+P P + W  +   +++    ++       L L N Q GD+G+Y+  A N++G
Sbjct: 1469 IQWFKENR-LLSTEDPNVVMLENGQV----LHIKHSRLSDSGKYKCIAAN--TAGSQTKEIKLTVYSNT--------TDLSFTVNGE---INLECDARGIPPPTIIWYKDGEPLLPSPYVTYIQKGKYLRITESQITDGGTYTCSVTNVAGQTEKNYSVDIYVPARIH---GDEKK---HQNKK-VIVGKSLTLECEATGH---PPPLITWLKDGVPVET---------NDNIRLHYNGKKLEIRNTVEYDRGLYTCVAVNVAGETEMKYKVSV---------LVPPSIE--GGNDPADHTVIAS--GAVELECLASGTPLPSVMWLKNGTPVDTSG-RLII---QSNGHKLLISSTESSDSGNYQCVVKNEAGSSTK-------QFNVVVHVASPVSILMHK--ATTLQCIASGIPNPH-ITWL---KDGLPFNVAKANIKMESFGR------------SLQFKKTLLEDAGKYTCVATNAAGEAEQTIWLNVYEPPKIEN---SGELIQE---TVLA--NHNIILECKATGNPDPVVTWFKDNQQLTNTGDISVSDRGQV--LQISGAQVFHAGTYKCVAASIAGRAELSYNLQVHVP------------------------------PSISGRSSSITVIVNNVVR---------------------LECEATGFPAPSLTWLKDGSPVSSFTNGIQILSGGRVLALTNAQVGDAGKYTCVAVNAAG 2058          

HSP 3 Score: 89.3521 bits (220), Expect = 7.801e-17
Identity = 132/531 (24.86%), Postives = 193/531 (36.35%), Query Frame = 3
Query: 3243 FEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIE----LYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRK--VGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPT-------ERYQPADDNSD------ISSPQR----TQMIFSNTIVRSPPQFVTTFTDE------------IVKEGDDVVLKCCLIGYPEPLIWW-------SYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGL 4709
             EIP    +H G YTC+  N+ G   + + L   E              P+   Q  ++Y+   + +S+ L  E        + W K+   + S        Y   S  +L I  AT  D+GTY  + +    T    V +  +   PVI    +      + SI IVC                 A GSPT  ++    +     PL KL G  QR+     L+   V   D GEY    EN AG  SV   + ++ L         P  I K  K++   IN++  + C   G P P + W KN   ++    +K  K  V  + EL++ N +  D G Y   ASN  G +     L V               P SFT +PT       ER       S+      I    R      M  +  IV S    +  F  E             V  G +++L C + G P P I W       SYN H          +E     L + +++  D G Y+  A N +G+
Sbjct: 3905 LEIPSSRLSHAGKYTCRAVNQVGSAHIHVNLHVQEV-------------PVIKEQ--NDYLEVVLSNSVTLACEASGTPIPTISWQKEGVGIKSGSS-----YTILSNGNLNIASATQEDAGTYTCIAQNPAGTALKKVRLK-VHVPPVIVPHQKEYVISMDKSIMIVC----------------EAHGSPTPEII----WHKDGVPLAKLAG--QRMSATGGLHIAVVQPDDAGEYTCTAENIAG--SVNSSMNLSVLV--------PPRIVKNIKDVSVVINDQTTLPCAAHGIPTPTITWAKNNLPIT----VKAGKYSVLASGELILYNAQHKDVGTYTCTASNAIGEDTHTVRLTV-------------HFPPSFTEMPTIVSLNEGERLSLLCKCSNYQNELVIDKVSRENSGAYMCVAENIVASINTTIHVFVKEPPVLNGVHNKHRTVPLGGNIILNCVVKGNPFPKIQWHKKAKVISYNKHI---------KEFSNGSLAIYDLE--DVGDYTCIAANDAGV 4354          

HSP 4 Score: 84.3445 bits (207), Expect = 2.586e-15
Identity = 111/461 (24.08%), Postives = 163/461 (35.36%), Query Frame = 3
Query: 3423 VTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDP-RIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQN------GSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAG---WSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELD---------EYFLI----LKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +T +VG    L  +  + V  ++ WL++N  L   +P ++ I        SL+I   T++D G Y       G T T  V +       + QD P+++   +N        I + C+V  YP+ H I W            + N+   +  N+ +    G          N    D G Y     N+AG    +SVM+ I V  +   +N             E++ P+  +  + CK +G P P++ W K    LS S  + I  +  T  L IKN + SDAG Y   A N  G    K  L+V  P                   P     P D + DI                                G DV L C   G PEP I W      I    F+                +F+I    L  +  GD G Y   AEN  G  +  A + V
Sbjct:  521 ITVTVGKGAILTCDVVSTVRFNLTWLRNNLDLKHMNPSKLSILRNN----SLEIKSVTIDDGGEYNCFASNEGGTATASVTL-------IAQDPPKAVLEPRNVTFTKGAEIKLKCLVTGYPTPHII-W------------MHNDMFVRFSNRYIITHNGT-----FIIKNAVERDSGVYKCLATNAAGTDHQTSVMVYIEVPQVTAVKN-------------EMLVPVGSETTLACKATGIPRPLIHWYKGKSTLSPSALITIDSLLGT--LKIKNTQFSDAGHYVCIAVNDAGKANGKVSLRVGSP-------------------PVFTQTPGDVSMDI--------------------------------GSDVSLTCSAEGIPEPKIKWRRLCCSIAGFTFQQGLAFILMFSDVTSLNHFMISCYFLPELWVGDEGIYICEAENQFGKISSQATITV 886          

HSP 5 Score: 81.6481 bits (200), Expect = 1.458e-14
Identity = 120/528 (22.73%), Postives = 204/528 (38.64%), Query Frame = 3
Query: 3240 VFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWS--SVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKP------------LEKPISFTIIPTERY----QPADDNSD-----------ISSPQRT-----QMIFSNTIVRSPPQF---VTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLA 4712
            + +I K      G YTC+ +N  GE                Q  + V   P  +   + + V+   G  + L+ +        + W K+N+ L++ DP + +    E+   L I  + ++DSG Y+ +   T  +QT  +++        +      +    NG IN+ C     P   +I W     DG P   L+ +     I K      G   RI         +DGG Y   V N AG +  +  + I V A      KK         +K++I  + + + + C+ +G+P P++ W+K+G  +  +D++++   G+  +L I+N  + D G+Y   A N  G    K  + V+ P        P            LE   S T +P+  +     P D +             ISS + +     Q +  N    S  QF   V   +   +       L+C   G P P I W  +    N  +  +K E     L  K     D+G+Y+  A N++G A
Sbjct: 1399 ILKILKMALKDSGHYTCKANNIAGES-------------KKQYFVNVLDPPTIAGVGTISDVSVIAGREVNLECKVKGIPFPSIQWFKENRLLSTEDPNVVML---ENGQVLHIKHSRLSDSGKYKCIAANTAGSQTKEIKLT-------VYSNTTDLSFTVNGEINLECDARGIPP-PTIIWY---KDGEP---LLPSPYVTYIQK------GKYLRIT----ESQITDGGTYTCSVTNVAGQTEKNYSVDIYVPARIHGDEKKHQ-------NKKVI--VGKSLTLECEATGHPPPLITWLKDGVPVETNDNIRLHYNGK--KLEIRNTVEYDRGLYTCVAVNVAGETEMKYKVSVLVPPSIEGGNDPADHTVIASGAVELECLASGTPLPSVMWLKNGTPVDTSGRLIIQSNGHKLLISSTESSDSGNYQCVVKNEAGSSTKQFNVVVHVASPVSILMHKATTLQCIASGIPNPHITWLKDGLPFNVAKANIKMESFGRSLQFKKTLLEDAGKYTCVATNAAGEA 1875          

HSP 6 Score: 76.2554 bits (186), Expect = 7.601e-13
Identity = 128/546 (23.44%), Postives = 197/546 (36.08%), Query Frame = 3
Query: 3258 FTQAHVGD---YTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQTQTTIVEINPIQFAPVIQDFPQS--IRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKP-----LNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVA-----ALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG-----------SVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVR--------------------------------SPPQFVTTFTDEI-VKEGDDVVLKCCLIGYPEPLIWWSYNTHFI---NNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG 4706
             T A VGD   YTC   N  GE      LS             V   P    +  +  ++  + +++ L  E  A     + W KD +PL +R P + I    E    LKI GA V D+G Y    +   G+T+     +N I   P I+   +   +   +   I+++C     P   ++ W              N     +I +P     +  L+G  Q   L       SD   Y     NS G  S M   TV      +++E+ N  +          EI+      V + C   G+P P+L W+K G  L   +  +I   G    L ++  + S+AG+Y   A N  G    K  L+V  P             S+    P       + IP  +     D + I   +  Q++    ++R                                 PP+   +  +EI VKE  ++ L C   G P P I W  + H +    N R + K +L    L + N+   DSGRY   A N +G
Sbjct: 2038 LTNAQVGDAGKYTCVAVNAAGEQQTDYDLS-------------VYVPPNIMGE--EQNISSLISETLILKCESDAIPPPVLTWYKDWKPLVNR-PGLTI---SEDGSILKIEGAQVKDTGRYSCEAVNIAGKTEKNF-NVN-IMVPPAIRGSAEESEVNIIEGTLISLLCDSTGIPP-PALAWK------------KNGQHSILIGQPFRFWHIRLLSGGRQ---LQIITARKSDAASYTCTASNSVG--SAMKKYTVKVYVRPSISESGNHPS----------EIVVIQGNNVTLECDARGDPQPMLTWLKEGIPLISGNGFEISSNGRL--LHLQKAQISNAGLYVCVAVNVAGQSDRKYDLKVFVPPAFPDGIMKHENISIVEKNPFTLTCEVSGIPPPKVTWYKDGNPIPPSRSPQIMSGGFLLRFSQSSLSDTGRYTCAVSNAAGEDMRKFDVNVLVPPKITGSVQEEIKVKERGNITLSCEATGTPIPQITWLKDGHPVLEDTNHRIDHKGQL----LRISNVMMTDSGRYVCVASNPAG 2528          

HSP 7 Score: 73.9442 bits (180), Expect = 3.683e-12
Identity = 111/481 (23.08%), Postives = 175/481 (36.38%), Query Frame = 3
Query: 3276 GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDP-RIQIYYPEESKCSLKINGATVNDSGTYQAVLKET-GQTQTTIVEINPIQFAPVI--QDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG 4706
            G+Y C V+N  G+D  K  L+             V   P S   L + Y  G + +S+    +        + WLKD  P+   D   IQI         +KI  A + D GTY  +     G  + T +    IQ  P I        +       I ++C     P+   I+W     DG      + +  Y  IN     +T + +   L      TSD G+Y     N AG    +  + V    +  + K +P  +  +       ++  + V C  SG P P + W+KNG  L  S  ++++  G+   L I   +KSD   Y   ASN  G +    ++QV                            P+ D +D+     TQ I   T++R  P                VV++C   G P P I W  +   + +      +       I+K  +  D  RY+  A N++G
Sbjct: 3079 GEYECIVTNVVGQDNKKFFLN-------------VYVHP-SIQGLQNEYHNGIIQNSVTFSCDAYGIPVPTLRWLKDGHPIGLTDSLEIQIL---SGGSKMKIARAQLTDGGTYTCLASNVEGTAEKTYILT--IQVPPSIDGSGMTNELNVLPGEIIQLICNAKGIPT-PVIHWL---KDG----KHITSEDYLGIN-----ITSDGEI--LTISKTQTSDMGKYTCVATNPAGEDDRIFNVNVFVAPKIDDNKGTPVVLTAV-------LDTSINVECHASGFPTPQINWLKNGLPLPVSSQVRLQSGGQV--LRISRVQKSDGATYTCIASNRAGVDKKDYNIQV-------------------------YVSPSLDEADV-----TQQI---TVIRDDP----------------VVMRCIANGVPAPRISWLKDGKQLGDEYLPYIQSQGMVLHIVK-AKMDDIARYTCVASNAAG 3466          

HSP 8 Score: 73.559 bits (179), Expect = 4.040e-12
Identity = 91/370 (24.59%), Postives = 148/370 (40.00%), Query Frame = 3
Query: 3222 NDNGEL-----VFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDP 4316
            NDN  L     V  I      +VG + C  SN  G+       +  E L+  +  IP +   +S +Q     +T      I ++ +  A     + WLKD QPL    P + I    +    ++I+   V D+G Y  +        T    +N IQ  P I++ P  + A  +  + + C+ +  P      W     DGS   +  +NAR+ +            Q   LY   V  +D G+Y     N+AG S   I + V            P  I+     I + IN +  + C+V+G P P ++W KNG  ++   +  + ++  +  LVI +    D GIY   A +  G +    +L V  P
Sbjct: 3525 NDNMHLMKAGQVLRITSAQVENVGRFVCLASNHAGD-------TKKEFLV--KVHIPPNIAGVSGTQ----NITVLQKKQITMECKSDALPPPRITWLKDGQPLQP-SPMVHILSNGQF---VQIDNTEVTDTGRYTCIATNIAGKTTKEFILN-IQVPPSIEEGPSLVTAFVDEPVTLECISSGVP-LPKTAWR---KDGSLLSH--HNARFLV-----------SQNGSLYISAVEVADSGQYFCLATNAAGSSQRQIDLLVY----------DPPRIKSEPTNITAKINIQTTLPCEVTGTPKPKIQWKKNGHPINTDLNQNMYRLLSSGSLVIISPSVDDTGIYVCSALSDAGDDEIDMYLSVHVP 3849          

HSP 9 Score: 71.633 bits (174), Expect = 1.785e-11
Identity = 179/769 (23.28%), Postives = 289/769 (37.58%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVS--SKDVAKTHL-EIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETG---QTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAG------WSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEEL-SESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV------------IDPIGSVNTTKPLEKPISFTIIPTERYQP--------------ADDNSDISS---------------PQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG 4706
            I W KD + +  +  P I      QS  M +HI   +  D  +Y C   N     R S   +L+V             E +   NT  L L     GF   P    + +  P++ N +      + + ++++    S  +++VG+++   S  + D  K  L ++   P        +N  +     I++  K+   + P  I W K+  PL  + + H   I  NG+ V +I        G YTC  +N  G+       +  E +++ Q    +   P   +   D  VT    + I   V  P        W KD   L+  + R  +        SL I+   V DSG Y  +        Q Q  ++  +P    P I+  P +I AK N    + C V   P    I W     +G P    +N   Y++++      +G++  I    D     D G Y     + AG      + SV +P T+A   EA N      F+ KL   +I          C VSG P P + W+K+  +L + SD  +I   G    L I + + S AG Y  +A N  GS     +L V            ++ + S + T   E   S T IPT  +Q               ++ N +I+S               P  T +      V  PP  V    + ++     +++ C   G P P I W  +   +   +   +R      L +  +Q  D+G Y+ TAEN +G
Sbjct: 3420 ISWLKDGKQLGDEYLPYI------QSQGMVLHIVKAKMDDIARYTCVASNAAG--RVSKHFILNVMEPPHINGSEVTEELSVVVNTH-LDLLCYTTGFP-PPLITWLKDGQPLSQNDN---MHLMKAGQVLRIT--SAQVENVGRFVCLASNHAGDTKKEFLVKVHIPPNIAGVSGTQNITVLQKKQITMECKS-DALPPPRITWLKDGQPLQPSPMVH---ILSNGQFV-QIDNTEVTDTGRYTCIATNIAGK-------TTKEFILNIQVPPSIEEGPSLVTAFVDEPVT---LECISSGVPLP-----KTAWRKDGSLLSHHNARFLV----SQNGSLYISAVEVADSGQYFCLATNAAGSSQRQIDLLVYDP----PRIKSEPTNITAKINIQTTLPCEVTGTPK-PKIQWK---KNGHPINTDLNQNMYRLLS------SGSLVIISPSVD-----DTGIYVCSALSDAGDDEIDMYLSVHVPPTIA--DEAAN-----IFVTKLSPAVIP---------CTVSGVPFPSVHWLKDSIQLPAISDSYRILPSG---SLEIPSSRLSHAGKYTCRAVNQVGSAHIHVNLHVQEVPVIKEQNDYLEVVLSNSVTLACEA--SGTPIPTISWQKEGVGIKSGSSYTILSNGNLNIASATQEDAGTYTCIAQNPAGTALKKVRLKVHVPPVIVPHQKEYVISMDKSIMIVCEAHGSPTPEIIWHKDG--VPLAKLAGQRMSATGGLHIAVVQPDDAGEYTCTAENIAG 4107          

HSP 10 Score: 69.3218 bits (168), Expect = 9.564e-11
Identity = 113/485 (23.30%), Postives = 176/485 (36.29%), Query Frame = 3
Query: 3276 GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPL-NSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTH---FINNP-RFEMKRELDEYF-LILKNIQKGDSGRYSITAENSSGLA 4712
            G YTC  +N  GE    + L+  E        I  S + I  + L+++        +I L+ +   +    V W KDNQ L N+ D  +      +    L+I+GA V  +GTY+ V             +  +   P I     SI    N  + + C    +P+  S+ W     DGSP  +  N          +  L+G   R+ L   N    D G+Y     N+AG       ++V            P  I   ++ I S I+E +I++C+    P P+L W K+ + L     L I + G    L I+  +  D G Y  +A N  G                       EK  +  I+     + + + S+++                            + EG  + L C   G P P + W  N      I  P RF   R L     L +   +K D+  Y+ TA NS G A
Sbjct: 1862 GKYTCVATNAAGEAEQTIWLNVYEP-----PKIENSGELIQETVLANH--------NIILECKATGNPDPVVTWFKDNQQLTNTGDISV-----SDRGQVLQISGAQVFHAGTYKCVAASIAGRAELSYNLQ-VHVPPSISGRSSSITVIVNNVVRLECEATGFPA-PSLTWL---KDGSPVSSFTNG---------IQILSGG--RV-LALTNAQVGDAGKYTCVAVNAAGEQQTDYDLSVYV----------PPNIMGEEQNISSLISETLILKCESDAIPPPVLTWYKDWKPLVNRPGLTISEDGSI--LKIEGAQVKDTGRYSCEAVNIAGKT---------------------EKNFNVNIMVPPAIRGSAEESEVN----------------------------IIEGTLISLLCDSTGIPPPALAWKKNGQHSILIGQPFRFWHIRLLSGGRQLQIITARKSDAASYTCTASNSVGSA 2250          

HSP 11 Score: 67.3958 bits (163), Expect = 3.512e-10
Identity = 146/732 (19.95%), Postives = 259/732 (35.38%), Query Frame = 3
Query: 2658 IDNCRESDAGQYWCEVRNGPSVIRKSSPVLL----SVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMI-QFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISI-------PMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLD-VEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDK-EIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPI--SFTII--------PTERY----------QPADDN------SDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDD------VVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG 4706
            I N  E D+G Y C   N      ++S ++      V + K   ++P  SE T A     +   L+     Y  +S L              P + ++ + ++     ++    D G Y+      + K   K  L +G  P F       +  +G  ++++        P   + ++      +   +        S  T +N      + +P+      G Y C+  N+FG+             ISSQ  I V+   +     S + V+   G+ + L  V    +   +  W+KDN  +   +P   I     +  SL +    + D G Y    K    T   I  IN +  +PVIQ  PQ     +  ++++ C                 A G P   ++   + +++  P N          L   +    D GEY     N+AG+++  + +TV         K    +I   ++ EI     + VI+ C+V   P P + W K  + +S         +  +  L I   + SDAG+Y    +N  G+      L V  P       K +   +  SF I         PT  +          Q  D+N      +  S       + SN I    P  ++       K+  +      +   C + G+P+P+I W  N   +      +    D   L++ ++   D+G Y+  A N +G
Sbjct:  660 IKNAVERDSGVYKCLATNAAGTDHQTSVMVYIEVPQVTAVKNEMLVPVGSETTLACKATGIPRPLI---HWYKGKSTL-------------SPSALITIDSLLGTLKIKNTQFSDAGHYVCIAVNDAGKANGKVSLRVGSPPVFTQTPGDVSMDIGSDVSLTCSAEGIPEPKIKWRRLCCSIAGFTFQQGLAFILMFSDVTSLNHFMISCYFLPELWVGDEGIYICEAENQFGK-------------ISSQATITVTGLVVPVIGESPSVVSVIEGNQVTLPCVLLVGNPLPERHWVKDNVLVT--NPYTSI----RADGSLHLERVLLKDGGDYLCTAKNVAGTADRITTIN-VHVSPVIQHGPQIFSTIEGIAVSLPC----------------KASGVPKPTIIWKKKGEIV-VPNNDTIIAESDGTLLLSSPGGEDSGEYSCSAINAAGYAARKVQLTVYG-------KVFLLYIGNKNQIEISVRAGDDVILPCEVKSVPPPFITWAKETQLISPFSQR--HSIFPSGSLKIFETRVSDAGMYTCVGTNIAGNITQLVKLSVYVPPKIQRGPKLIRVKLGHSFEIACISHGIPPPTAAWYKDGQIMEFDQGQDNNMLRVESAKPSDGGTYTCVASNVIGTDTPPTLSDLEPPYNKQNQERISRQQISFPCPVKGHPKPVIKWFRNGKELTGSEPGVNIVEDRAVLVIDSLTPYDNGEYTCVASNEAG 1329          

HSP 12 Score: 66.2402 bits (160), Expect = 7.109e-10
Identity = 163/738 (22.09%), Postives = 285/738 (38.62%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEK---TFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVAKTHLEIGEKPEFVYHQFK-----ENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEIN-PIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEK--------PISFTIIPTERYQPADDNSDI-------SSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYF--LILKNIQKGDSGRYSITAEN 4697
            I W KD + + P   P + +  N Q     + IDN   +D G+Y C   N     + +   +L++       V P   E      A   EP++L+ +  G    P     +      ++H +  +  VS N  +  +  +V + D GQY F +++     +  +I      VY   +      N     ++  ++P +      PK I WKKN  P+ T+   +   +  +G LV   P       G Y C   ++ G+D + + LS     +     I   A  I  ++LS   +  +V       V FP+     V WLKD+  L    P I   Y      SL+I  + ++ +G Y    +   Q  +  + +N  +Q  PVI++    +    + S+ + C  +  P   +I+W  K   G     + + + Y +++       GN+        + T  D G Y    +N AG           AL + + K   P  I    KE +  +++ +++ C+  G+P P + W K+G  L++    ++   G  H  V++     DAG Y   A N  GS  S  +L V+ P   V   K +          P +   IPT     A +N  I       S     ++I  N   +    +  T ++ I ++   V L    + +P                R  +  +   Y   L++  + + +SG Y   AEN
Sbjct: 3606 ITWLKDGQPLQPS--PMVHILSNGQF----VQIDNTEVTDTGRYTCIATNIAG--KTTKEFILNI------QVPPSIEEGPSLVTAFVDEPVTLECISSG---VPLPKTAWRKDGSLLSHHNARF-LVSQNGSLYIS--AVEVADSGQY-FCLATNAAGSSQRQIDL---LVYDPPRIKSEPTNITAKINIQTTLPCEVTGTPKPK-IQWKKNGHPINTDLNQNMYRLLSSGSLVIISPSVDDT--GIYVCSALSDAGDDEIDMYLS-----VHVPPTIADEAANIFVTKLSPAVIPCTVSG-----VPFPS-----VHWLKDSIQL----PAISDSYRILPSGSLEIPSSRLSHAGKYTC--RAVNQVGSAHIHVNLHVQEVPVIKEQNDYLEVVLSNSVTLACEASGTP-IPTISWQ-KEGVG-----IKSGSSYTILSN------GNLN-----IASATQEDAGTYTCIAQNPAG----------TALKKVRLKVHVPPVIVPHQKEYVISMDKSIMIVCEAHGSPTPEIIWHKDGVPLAKLAGQRMSATGGLHIAVVQ---PDDAGEYTCTAENIAGSVNSSMNLSVLVPPRIVKNIKDVSVVINDQTTLPCAAHGIPTPTITWAKNNLPITVKAGKYSVLASGELILYNAQHKDVGTYTCTASNAIGEDTHTVRLT---VHFPPSFTEMPTIVSLNEGERLSLLCKCSNYQNELVIDKVSRENSGAYMCVAEN 4261          

HSP 13 Score: 66.2402 bits (160), Expect = 7.667e-10
Identity = 91/365 (24.93%), Postives = 138/365 (37.81%), Query Frame = 3
Query: 3228 NGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIK--------LDVEFPADVSSDVVWLKDNQP-LNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK----ETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSE 4283
            +G  +    + + +  G YTC VSN  GED+ K  ++          L+P               +TGSV + IK        L  E        + WLKD  P L   + RI     +     L+I+   + DSG Y  V      E  ++ +  V I+P      I   P+ ++     SI++ C V+S+P   +I W     DG   +   +N R     + L  L    +            D G Y     N AG  +    + V    + +    S        KEI + +N    + C V  NP   + W K+G+ L    HL I   G T  L ++  + SD G Y   ASN  G +
Sbjct: 2409 SGGFLLRFSQSSLSDTGRYTCAVSNAAGEDMRKFDVNV---------LVPPK-------------ITGSVQEEIKVKERGNITLSCEATGTPIPQITWLKDGHPVLEDTNHRI-----DHKGQLLRISNVMMTDSGRYVCVASNPAGERSRSFSLGVLISP-TIKGAINGSPEDVKVVLLSSISLECEVHSHPPA-TITWH---KDGRLFK-FKDNVRILPGGRTLQILKAQEK------------DAGRYSCIATNEAGEGTHHYNLNVHIPPKIRKDDISE--FGGFSKEIKAIVNTNFTLVCDVKANPLAKITWYKDGQPLEPDSHLAIVS-GNT--LYVEKAQVSDTGRYTCLASNIAGED 2723          

HSP 14 Score: 64.3142 bits (155), Expect = 2.723e-9
Identity = 123/553 (22.24%), Postives = 193/553 (34.90%), Query Frame = 3
Query: 3219 INDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQ--------DFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDP--------------IGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFS------------------------NTIVRSPPQFVTTFTDEI-VKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKN--------IQKGDSGRYSITAENSSGLA 4712
            I+  G+L   I        G Y C  SN  GE      L     LIS     P     I+ S      V  S   SI L+ E  +   + + W KD +    +D  ++I        +L+I  A   D+G Y  +        T    +N +   P I+         F + I+A  N +  +VC V + P    I W     DG P             +  L  ++GN     LY +    SD G Y     N AG   +   +T+         ++S        KE+I  IN    + C+ +  P P + W K+ + L+ S+   I   G  H L I   ++ DAG Y   A N  G +    +++V+ P                 VN T  ++  ++ T  P        D   I        I                          N  +  PP  + + ++ + V E + + L C + G+P P + W  +T  +N+         D +  I+           +  D G YS  A N +G A
Sbjct: 2499 IDHKGQL-LRISNVMMTDSGRYVCVASNPAGERSRSFSLGV---LIS-----PTIKGAINGSPEDVKVVLLS---SISLECEVHSHPPATITWHKDGRLFKFKD-NVRIL---PGGRTLQILKAQEKDAGRYSCIATNEAGEGTHHYNLN-VHIPPKIRKDDISEFGGFSKEIKAIVNTNFTLVCDVKANP-LAKITWY---KDGQPLEP----------DSHLAIVSGNT----LYVEKAQVSDTGRYTCLASNIAGEDELDFDVTIQGWRGENGDRSS----NGEHKEVI--INNPFSLYCETNAVPPPTITWYKDDKLLTPSNRAFILPGG--HILQIARAQEDDAGTYTCVAVNEAGRDSMHYNVRVLLPPAFEGSDEDLSKDITSLVNETLEMDCTVAVTGSPAPTISWLKDGHPIQEGTHNTCILYAQLMDTGRYVCVVENPAGSVQKSFNLNIYVPPSVIGSNSENVTVVESNFISLTCEVTGFPPPAVSWLKDTMVLNS---------DSHLFIVPGGRTLQIPQTRLSDVGEYSCIAINQAGEA 2999          

HSP 15 Score: 64.3142 bits (155), Expect = 2.912e-9
Identity = 161/791 (20.35%), Postives = 279/791 (35.27%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNG--------------PSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLS-LKLVLDGFKYAPESDLIF---NNMPI------NVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLD--VEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAA----LAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV-----IDPIGSVNTTKPLEKPISFTI------IPTERYQPADDNSDISSPQRTQMIFSNT--------------------------------IVRSPPQF-VTTFTDEI-VKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG 4706
            I W+KD        + RIL       G   + I   +E DAG+Y C   N               P  IRK        FS++   ++             PL+ +    DG    P+S L     N + +      +    +C  S ++  + + F        DV    +R  + D +      GE  E + +     SL  ++ A+           P TI W K+   LT    S++ +I   G  + +I +  +   G YTC   NE G D +   +         + L+P  A   S   LS + +T  V +++++D  V      +  + WLKD  P+        I Y            A + D+G Y  V++    +      +N      VI    +++   ++  I++ C V  +P          PA       +V N+   +   P  +         L       SD GEY     N AG +     + + A    +A  ++  T          E+   +N   I+ C+ +  P P++ W KNG+ + E+   +  + G+   L I+N    D G YE   +N  G +  K  L V     I  + +      ++  ++F+       +PT R+        ++     Q++   +                                 ++ PP    +  T+E+ V  G+ + L C   G P P+I W     H  +     +    D   L +   Q  D G+Y+  A N +G
Sbjct: 2577 ITWHKDGRLFKFKDNVRIL------PGGRTLQILKAQEKDAGRYSCIATNEAGEGTHHYNLNVHIPPKIRKDDISEFGGFSKEIKAIVNTNFTLVCDVKANPLAKITWYKDGQPLEPDSHLAIVSGNTLYVEKAQVSDTGRYTCLASNIAGEDELDF--------DVTIQGWRGENGDRSSN----GEHKEVIINN--PFSLYCETNAVP----------PPTITWYKDDKLLTP---SNRAFILPGGH-ILQIARAQEDDAGTYTCVAVNEAGRDSMHYNV---------RVLLP-PAFEGSDEDLSKD-ITSLVNETLEMDCTVAVTGSPAPTISWLKDGHPIQEGTHNTCILY------------AQLMDTGRYVCVVENPAGSVQKSFNLNIYVPPSVIGSNSENVTVVESNFISLTCEVTGFP---------PPAVSWLKDTMVLNSDSHLFIVPGGR--------TLQIPQTRLSDVGEYSCIAINQAGEAKKTFFLDIYAPPSIVANVRDSST----------EVNVKVNASTILECESNAIPAPVINWYKNGQPIRETSSYQFLEGGQ--RLNIRNV--FDTGEYECIVTNVVGQDNKKFFLNVYVHPSIQGLQNEYHNGIIQNSVTFSCDAYGIPVPTLRWLKDGHPIGLTDSLEIQILSGGSKMKIARAQLTDGGTYTCLASNVEGTAEKTYILTIQVPPSIDGSGMTNELNVLPGEIIQLICNAKGIPTPVIHWLKDGKHITSEDYLGINITSDGEILTISKTQTSDMGKYTCVATNPAG 3279          

HSP 16 Score: 54.6842 bits (130), Expect = 2.300e-6
Identity = 91/392 (23.21%), Postives = 149/392 (38.01%), Query Frame = 3
Query: 3573 LKINGATVNDSGTYQAVLKETGQTQT--TIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINW--SIKPADGS-PTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPI----NEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDP--IGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLAT 4715
            L++  A  +D GTY  V      T T  T+ ++ P    P  +   + I  +Q   I+  C V  +P    I W  + K   GS P  N+V +                  R  L  D++T  D GEY     N AG +     + V            P  I+ +D  IIS +    ++ + + C+ SG+P P++ W K   ++ ES  ++I + G+  +++    K  D+G Y  +A+N  G    +  + V+DP  I  V T                        SD+S                            V  G +V L+C + G P P I W      ++     +    +   L +K+ +  DSG+Y   A N++G  T
Sbjct: 1219 LRVESAKPSDGGTYTCVASNVIGTDTPPTLSDLEP----PYNKQNQERISRQQ---ISFPCPVKGHPK-PVIKWFRNGKELTGSEPGVNIVED------------------RAVLVIDSLTPYDNGEYTCVASNEAGQTEKKYSLKVH----------DPPLIKDMD--IISNVSVLLHQTMSLLCEASGSPPPLITWYKGRTQVDESATVQILEKGKILKILKMALK--DSGHYTCKANNIAGESKKQYFVNVLDPPTIAGVGTI-----------------------SDVS----------------------------VIAGREVNLECKVKGIPFPSIQWFKENRLLSTEDPNVVMLENGQVLHIKHSRLSDSGKYKCIAANTAGSQT 1519          

HSP 17 Score: 53.5286 bits (127), Expect = 5.597e-6
Identity = 156/732 (21.31%), Postives = 268/732 (36.61%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRN--GPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPIN-VNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVS--SKDVAKT-HLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGE--DVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQN--------GSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGL 4709
            I WYKD++ + P     IL       G   + I   +E DAG Y C   N  G   +  +  VLL    +     + K    +    T  +   + + G   AP    + +  PI    H++C          I +      L D G+Y+  V   +  V K+ +L I   P  +     EN  + +S  IS+  +      P  + W K+   L ++  SH   +   G    +IP+   + VG+Y+C   N+ GE      L + A  +++++              + S   V   V  S  L+ E  A  +  + W K+ QP+          + E  +   ++N   V D+G Y+ ++       T +V  +  +F   +   P SI+  QN         S+   C     P   ++ W     DG P   L ++   ++++       G+  +I         +DGG Y     N  G +     +T+           + + +  L  EII  I       C   G P P++ W+K+G+ ++  D+L I    +   L I   + SD G Y   A+N  G +         D I +VN            + P       DDN                  +  P  +T   D  +       ++C   G+P P I W  N   +     +++ +     L +  +QK D   Y+  A N +G+
Sbjct: 2770 ITWYKDDKLLTPSNRAFIL------PGGHILQIARAQEDDAGTYTCVAVNEAGRDSMHYNVRVLLPPAFEGSDEDLSK-DITSLVNETLEMDCTVAVTGSP-APTISWLKDGHPIQEGTHNTC----------ILY----AQLMDTGRYVCVVENPAGSVQKSFNLNIYVPPSVIGSN-SENVTVVESNFISLTCE-VTGFPPPAVSWLKDTMVLNSD--SHLFIVP--GGRTLQIPQTRLSDVGEYSCIAINQAGEAKKTFFLDIYAPPSIVAN-------------VRDSSTEVNVKVNASTILECESNAIPAPVINWYKNGQPIRETS---SYQFLEGGQ---RLNIRNVFDTGEYECIV-------TNVVGQDNKKFFLNVYVHP-SIQGLQNEYHNGIIQNSVTFSCDAYGIP-VPTLRWL---KDGHPI-GLTDSLEIQILSG------GSKMKIA----RAQLTDGGTYTCLASNVEGTAEKTYILTIQVPPSIDGSGMTNE-LNVLPGEIIQLI-------CNAKGIPTPVIHWLKDGKHITSEDYLGINITSDGEILTISKTQTSDMGKYTCVATNPAGED---------DRIFNVN----------VFVAPK-----IDDN------------------KGTPVVLTAVLDTSIN------VECHASGFPTPQINWLKNGLPLPVSS-QVRLQSGGQVLRISRVQKSDGATYTCIASNRAGV 3374          

HSP 18 Score: 53.1434 bits (126), Expect = 7.139e-6
Identity = 82/351 (23.36%), Postives = 129/351 (36.75%), Query Frame = 3
Query: 3276 GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQD---FPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQK-LDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDP 4316
            G YTC  SN              E       ++ +   P        N +    G+ I+L        +  + WLKD + + S D  + I    + +  L I+    +D G Y  V          I  +N +  AP I D    P  + A  + SIN+ C  + +P+   INW            L N     + ++   +  G + RI      V  SDG  Y     N AG       I V           SP   +  + ++I    ++ V++RC  +G P P + W+K+G++L +     I+  G    +V    K  D   Y   ASN  G       L V++P
Sbjct: 3173 GTYTCLASN-------------VEGTAEKTYILTIQVPPSIDGSGMTNELNVLPGEIIQLICNAKGIPTPVIHWLKDGKHITSED-YLGINITSDGEI-LTISKTQTSDMGKYTCVATNPAGEDDRIFNVN-VFVAPKIDDNKGTPVVLTAVLDTSINVECHASGFPT-PQINW------------LKNGLPLPVSSQVRLQSGGQVLRIS----RVQKSDGATYTCIASNRAGVDKKDYNIQVYV---------SPSLDEADVTQQITVIRDDPVVMRCIANGVPAPRISWLKDGKQLGDEYLPYIQSQGMVLHIV--KAKMDDIARYTCVASNAAGRVSKHFILNVMEP 3479          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Xenopus
Match: cep131 (centrosomal protein 131kDa [Source:Xenbase;Acc:XB-GENE-1016768])

HSP 1 Score: 82.8037 bits (203), Expect = 5.432e-15
Identity = 92/398 (23.12%), Postives = 151/398 (37.94%), Query Frame = 3
Query: 3597 NDSGTYQAVL-------KETGQTQTTIVEINPI--QFAPVIQ-DFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIV--KEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRE------LDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +D+G Y  V+       +E G +    +  + +  ++ P I+  FP+S+ + +  ++ + C     P   +I W  + ADG P    V   R   +               L   N    D G Y    EN+ G + V   +T  A          P ++QK++   I+ I E ++  CK SG P     W+KNG+ L     L+I    +   L I +   SD+G+Y+  A N +G+  S   L+VI  +G                                                 P F   F   +   K G  V+++C     P+P I W            E++RE      LD+  L + N+ K D+G Y+ TA N  G A+ +  ++V
Sbjct:  185 SDAGNYTCVVTNTVTNTRELGPSTPLTLRTDGVMGEYEPKIEVHFPESVPSAKGSTVKLECFALGNP-VPTITW--RRADGKPISRKVRRHRSSGV---------------LEIPNFQQEDAGPYECVAENTRGKNMVRGQLTYFA---------PPTWVQKINDAHIA-IEENILWECKASGRPKASYTWLKNGQRLQSKGRLQI----DHGSLTITSVNISDSGMYQCLAENKHGTIYSSAELRVI-AVG-------------------------------------------------PDFSKGFVKRVTLGKVGGSVLIECKPKASPKPSITWKKGK--------ELQRESSRISILDDGTLKISNLTKADAGSYTCTASNHFGTASSTGTLVV 492          

HSP 2 Score: 58.5362 bits (140), Expect = 1.222e-7
Identity = 77/347 (22.19%), Postives = 138/347 (39.77%), Query Frame = 3
Query: 3240 VFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSI-----RAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNP--NPILKWMKNGEELS-ESDHLKIRKVG--ETHELVIKNCKKSDAGIY 4250
            V EIP F Q   G Y C   N  G+++++ QL+               A P    +++D ++  ++ ++I  + +      +   WLK+ Q L S+  R+QI        SL I    ++DSG YQ + +    T  +  E+  I   P   DF +         K  GS+ I C   + P   SI W                 + K + +  ++++  +    L   N+T +D G Y     N  G +S    + V  L +     +S              + E +++ C+VS +   +    W+ NG+ +  + D     +VG     +L+I++ +   AG Y
Sbjct:  277 VLEIPNFQQEDAGPYECVAENTRGKNMVRGQLT-------------YFAPPTWVQKINDAHI--AIEENILWECKASGRPKASYTWLKNGQRLQSKG-RLQI-----DHGSLTITSVNISDSGMYQCLAENKHGTIYSSAELRVIAVGP---DFSKGFVKRVTLGKVGGSVLIECKPKASPK-PSITWK----------------KGKELQRESSRIS-ILDDGTLKISNLTKADAGSYTCTASNHFGTASSTGTLVVKDLTQVLVPPSSMDVT----------VGESIVLPCQVSHDHSLDISFSWVFNGQLIDFQKDGEHFERVGGDSAGDLMIRSIQLKHAGKY 571          

HSP 3 Score: 56.225 bits (134), Expect = 6.467e-7
Identity = 91/374 (24.33%), Postives = 142/374 (37.97%), Query Frame = 3
Query: 3249 IPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLK-DNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMI-NKPLNKLTGNMQ--RIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEI-ISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASN------TNGSEVSKCHLQVIDPIGSVNTT 4337
            I K   +  G+YTC V+N         +L  +  L      +    +P       ++ V  + G ++KL+     +    + W + D +P++ +  R        S   L+I      D+G Y+ V + T      +V      FAP     P  ++   +  I I           +I W  K A G P       A Y  + N    +  G +Q     L   +V  SD G Y    EN  G        T+ + AE +     P F +   K + +  +   V++ CK   +P P + W K  E   ES  + I   G    L I N  K+DAG Y   ASN      + G+ V K   QV+ P  S++ T
Sbjct:  179 IAKVEPSDAGNYTCVVTNTVTN---TRELGPSTPLTLRTDGVMGEYEPKIEVHFPES-VPSAKGSTVKLECFALGNPVPTITWRRADGKPISRKVRR------HRSSGVLEIPNFQQEDAGPYECVAENT--RGKNMVRGQLTYFAP-----PTWVQKINDAHIAIE---------ENILWECK-ASGRP------KASYTWLKNGQRLQSKGRLQIDHGSLTITSVNISDSGMYQCLAENKHG--------TIYSSAELRVIAVGPDFSKGFVKRVTLGKVGGSVLIECKPKASPKPSITWKKGKELQRESSRISILDDGT---LKISNLTKADAGSYTCTASNHFGTASSTGTLVVKDLTQVLVPPSSMDVT 508          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Xenopus
Match: cep131 (centrosomal protein 131kDa [Source:Xenbase;Acc:XB-GENE-1016768])

HSP 1 Score: 82.8037 bits (203), Expect = 5.592e-15
Identity = 92/398 (23.12%), Postives = 151/398 (37.94%), Query Frame = 3
Query: 3597 NDSGTYQAVL-------KETGQTQTTIVEINPI--QFAPVIQ-DFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIV--KEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRE------LDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +D+G Y  V+       +E G +    +  + +  ++ P I+  FP+S+ + +  ++ + C     P   +I W  + ADG P    V   R   +               L   N    D G Y    EN+ G + V   +T  A          P ++QK++   I+ I E ++  CK SG P     W+KNG+ L     L+I    +   L I +   SD+G+Y+  A N +G+  S   L+VI  +G                                                 P F   F   +   K G  V+++C     P+P I W            E++RE      LD+  L + N+ K D+G Y+ TA N  G A+ +  ++V
Sbjct:  188 SDAGNYTCVVTNTVTNTRELGPSTPLTLRTDGVMGEYEPKIEVHFPESVPSAKGSTVKLECFALGNP-VPTITW--RRADGKPISRKVRRHRSSGV---------------LEIPNFQQEDAGPYECVAENTRGKNMVRGQLTYFA---------PPTWVQKINDAHIA-IEENILWECKASGRPKASYTWLKNGQRLQSKGRLQI----DHGSLTITSVNISDSGMYQCLAENKHGTIYSSAELRVI-AVG-------------------------------------------------PDFSKGFVKRVTLGKVGGSVLIECKPKASPKPSITWKKGK--------ELQRESSRISILDDGTLKISNLTKADAGSYTCTASNHFGTASSTGTLVV 495          

HSP 2 Score: 58.151 bits (139), Expect = 1.613e-7
Identity = 77/348 (22.13%), Postives = 138/348 (39.66%), Query Frame = 3
Query: 3240 VFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSI-----RAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNP--NPILKWMKNGEELS-ESDHLKIRKVG---ETHELVIKNCKKSDAGIY 4250
            V EIP F Q   G Y C   N  G+++++ QL+               A P    +++D ++  ++ ++I  + +      +   WLK+ Q L S+  R+QI        SL I    ++DSG YQ + +    T  +  E+  I   P   DF +         K  GS+ I C   + P   SI W                 + K + +  ++++  +    L   N+T +D G Y     N  G +S    + V  L +     +S              + E +++ C+VS +   +    W+ NG+ +  + D     +VG      +L+I++ +   AG Y
Sbjct:  280 VLEIPNFQQEDAGPYECVAENTRGKNMVRGQLT-------------YFAPPTWVQKINDAHI--AIEENILWECKASGRPKASYTWLKNGQRLQSKG-RLQI-----DHGSLTITSVNISDSGMYQCLAENKHGTIYSSAELRVIAVGP---DFSKGFVKRVTLGKVGGSVLIECKPKASPK-PSITWK----------------KGKELQRESSRIS-ILDDGTLKISNLTKADAGSYTCTASNHFGTASSTGTLVVKDLTQVLVPPSSMDVT----------VGESIVLPCQVSHDHSLDISFSWVFNGQLIDFQKDGEHFERVGGQDSAGDLMIRSIQLKHAGKY 575          

HSP 3 Score: 56.225 bits (134), Expect = 7.204e-7
Identity = 91/374 (24.33%), Postives = 142/374 (37.97%), Query Frame = 3
Query: 3249 IPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLK-DNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMI-NKPLNKLTGNMQ--RIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEI-ISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASN------TNGSEVSKCHLQVIDPIGSVNTT 4337
            I K   +  G+YTC V+N         +L  +  L      +    +P       ++ V  + G ++KL+     +    + W + D +P++ +  R        S   L+I      D+G Y+ V + T      +V      FAP     P  ++   +  I I           +I W  K A G P       A Y  + N    +  G +Q     L   +V  SD G Y    EN  G        T+ + AE +     P F +   K + +  +   V++ CK   +P P + W K  E   ES  + I   G    L I N  K+DAG Y   ASN      + G+ V K   QV+ P  S++ T
Sbjct:  182 IAKVEPSDAGNYTCVVTNTVTN---TRELGPSTPLTLRTDGVMGEYEPKIEVHFPES-VPSAKGSTVKLECFALGNPVPTITWRRADGKPISRKVRR------HRSSGVLEIPNFQQEDAGPYECVAENT--RGKNMVRGQLTYFAP-----PTWVQKINDAHIAIE---------ENILWECK-ASGRP------KASYTWLKNGQRLQSKGRLQIDHGSLTITSVNISDSGMYQCLAENKHG--------TIYSSAELRVIAVGPDFSKGFVKRVTLGKVGGSVLIECKPKASPKPSITWKKGKELQRESSRISILDDGT---LKISNLTKADAGSYTCTASNHFGTASSTGTLVVKDLTQVLVPPSSMDVT 511          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Mouse
Match: Ttn (titin [Source:MGI Symbol;Acc:MGI:98864])

HSP 1 Score: 124.79 bits (312), Expect = 9.158e-28
Identity = 175/773 (22.64%), Postives = 304/773 (39.33%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTY--INDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE----KPISFT-------------------IIPTERYQPADDNS---------DISSPQRTQMIFSN----------TIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYN-THFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            I W KDN  I P  + ++ L  N+ +    + +    + DAGQY C   N     + S    L V  Q+    I K  +       E    +  + G   +PE  +++    + +  SS  +     + +      S+S++D G Y       +    + T L++ E P F    F   +L G  + +   ++      P  + W K+K  L     S K Y  +++N      I     A +G+Y C+ +N+ G D            + S T+    A P    +L+D  ++  +G  ++L           V W KD   +      I I Y  E+  +L+ + A   ++G Y   +K     Q     ++ ++ A +++  P+SI+     +  + C V+  P   S  W     DG   + L ++ +YK+     NK++G      L   NV   D G Y   V+N  G  S  + I V+      ++   P F +KL KE        V++ CKV G+P   + W  +G E+S     +      T  L +   +++DAG Y   A+N  GS+     L V +P   V    P++      ++FT                   ++P  R   +  +S         D S       I SN            V++P  FV    D  +++G  ++L+    G P   + W  N  + I + R  +        L + +    DSG+Y+   EN+SG  +CSA +++
Sbjct: 1146 ITWAKDNREIRPGGNYKMTLVENTAT----LTVLKVAKGDAGQYTCYASNVAG--KDSCSAQLGV--QEPPRFIKKLDQSRIVKQDEYTRYECKIGG---SPEIKVLWYKDEVEIQESS-KFRMSFEDSVAILEMHSLSVEDSGDYTCEARNAAGSASSSTSLKVKEPPVFRKKPFPVETLKGADVHLECELQG---TPPFQVSWHKDKRELR----SGKKYKIMSENLLTSIHILNVDTADIGEYQCKATNDVGSDTC----------VGSVTM---KAPPQFVKKLTD--ISTIIGKEVQLQTTIEGAEPISVAWFKDKGEIVRESDNIWISY-SENIATLQFSRAEPANAGKYTCQIKNDAGMQECYATLSVLEPAAIVEK-PESIKVTTGDTCTLECTVSGTPEL-STKWF---KDG---KELTSDNKYKI--SFFNKVSG------LKIINVVPGDSGVYSFEVQNPVGKDSCKVSIQVS------DRIIPPSFTRKL-KETNGLSGSSVVMECKVYGSPPISVLWFHDGNEISSGRKYQTTLTDNTCALTVNMLEEADAGDYTCIATNVAGSDECSAPLTVREPPSFVQKPDPMDVLTGSNVTFTSIVKGSPPFTVSWFKGSTELVPGARCNVSLQDSVGELELFDVDTSQSGEYTCIVSNEAGRASCTTRLFVKAPAIFVKRLNDYSIEKGKPLILEGTFSGTPPISVTWKKNGINVIASQRCNITTTEKSAILEILSSTVEDSGQYNCYIENASGKDSCSAQILI 1860          

HSP 2 Score: 92.4337 bits (228), Expect = 5.589e-18
Identity = 163/762 (21.39%), Postives = 290/762 (38.06%), Query Frame = 3
Query: 2652 MHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLS---VFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHK-TYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQ-AVLKETGQTQTTIV-----EINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG--------SVNTTKPL--------EKPISFTIIPTERYQPADDNSDISSPQRTQM--IFSNTI------------------------VRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDR 4769
            + I+     D G Y CE  NG      S+ + +    VF+QK   V         A     + L+  + G    P  ++++      V  SS  +   S N     +  ++   D+G+Y  + +++   D     ++  E P FV      ++L+GD + +   ++ F    P +++W K+K  +     + + +++++   L    P+ +Q+  G Y CQ+ N+ G      + SA   ++   T++    KP          +T + G+   L+            W KD + L+S   R  I +   +  SLKI  A +ND G Y   V    G++  T+       + P  F   ++D   ++ A    S+ + C V+      S+ W +   DG+           ++I+ P  + +       L   ++  SD G Y     N AG       +TV         +  P F Q  D   + P    +     + G P   +KW K   EL   +   I       EL +   +   +G Y    +N  GS     HL V +P          SV T  P+          PIS + +  E       N  I++ +++ +  I  +TI                        V  PP F+          G+ + L+C + G PE  I W+  +T   + P ++M+ + +   L++  +   D G Y+  AENS G    SA++++       S  R
Sbjct:  325 LTINEASAEDTGDYICEAHNGVGDASCSTALKVKAPPVFTQKPPPV--------GALKGSDVILQCEISG---TPPFEVVWVKDRKQV-RSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDTCACTVKFKEPPRFVKKLSDASTLIGDPVELQAVVEGFQ---PISVVWLKDKGEVIRESENVRISFVDNIATLQLGSPEASQS--GKYVCQIKNDAG----MRECSAVLTVLEPATIV---EKP--------EPMTVTTGNPFTLECVVAGTPELSAKWFKDGRELSSGS-RHHITF-VRNLASLKIPSAEMNDKGLYTFEVENRVGKSSCTVSVHVSDRVVPPSFVRRLKDTSATLGA----SVVLECRVSGSAPI-SVGWFL---DGN-----------EIISSPKCQSSFADNVCTLTLSSLEPSDTGAYTCVAANVAGQDESSAVLTV---------QEPPSFEQTPDSVEVLP-GMSLTFTSVIRGTPPFKVKWFKGSRELVSGEACTISLEDFVTELELLEVEPGQSGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADTSVETGSPIVLEATYSGTPPISVSWMKNEYPLSQSPNCGITTTEKSSILEILESTIEDYAQYACLIENEAGQDICEALVSVLEPPYFIEPLEHVEAAIGEPITLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYTCKAENSVGAVASSAVLVIKERKLPPSFAR 1023          

HSP 3 Score: 87.8113 bits (216), Expect = 1.433e-16
Identity = 177/737 (24.02%), Postives = 281/737 (38.13%), Query Frame = 3
Query: 2553 QYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYA--PESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLF---RVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVL-----KETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFT--DEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSA 4724
            +   +W+KD + +  D   +I    N  SG   + I N    D+G Y  EV+N   V + S  V + V  +    + P F+ K    N    S  +V++   Y   P S L F++   N   S   +    ++         +   D G Y      V+  D     L + E P FV      + L G ++  +  +K      P T+ W K  T L      + +  +  GEL  E+     +  G+YTC VSNE G               S  T + V A  I   +L+D  +    G  + L+  F       V W K+   + +   R  I   E+S   L+I  +TV DSG Y   +     K++   Q  I+E  P  F   ++     ++     S ++ C +   P    ++W        PT      A  KM          N+    L F  V +SD GEY  R ENS G  S    +TV      Q +K  P F ++L +++   +   V+  C VSG+    + W K+G+ L +S +++   +     L I    +S +G Y   A+N               PIGS ++   L        I TE                          ++PP F       D +V E  D  L+C + G  P  + W   N    +   +++    +   L +  + KGDSG+Y+  A N  G  +C+A
Sbjct: 1517 ELSTKWFKDGKELTSDNKYKISF-FNKVSG---LKIINVVPGDSGVYSFEVQN--PVGKDSCKVSIQVSDR---IIPPSFTRKLKETNGLSGS-SVVMECKVYGSPPISVLWFHDG--NEISSGRKYQTTLTDNTCALTVNMLEEADAGDYTCIATNVAGSDECSAPLTVREPPSFVQKPDPMDVLTGSNVTFTSIVKG---SPPFTVSWFKGSTELVPGARCNVSLQDSVGEL--ELFDVDTSQSGEYTCIVSNEAGR-------------ASCTTRLFVKAPAIFVKRLNDYSIEK--GKPLILEGTFSGTPPISVTWKKNGINVIASQ-RCNITTTEKSAI-LEILSSTVEDSGQYNCYIENASGKDSCSAQILILE--PPYFVKQLE----PVKVTVGDSASLQCQLAGTPEI-GVSWYKGDTKLRPT------ATCKM------HFKNNVAT--LVFTQVDSSDSGEYICRAENSVGEVSSSTFLTV------QEQKLPPSFSRQL-RDVQETVGLPVVFECAVSGSEPISVSWYKDGKPLKDSPNIQTSFLDNIATLNIFKTDRSLSGQYSCTATN---------------PIGSASSGAKL--------ILTEG-------------------------KNPPFFDIPLAPMDAVVGESAD--LECHVTGTQPIKVTWAKDNREIRSGGNYQISYLENSAHLTIVKVDKGDSGQYTCYAVNEVGKDSCTA 2141          

HSP 4 Score: 81.2629 bits (199), Expect = 1.653e-14
Identity = 135/567 (23.81%), Postives = 209/567 (36.86%), Query Frame = 3
Query: 3207 HKTYINDN-GELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQ--FAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWS-----IKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKP------------LEKPISFT-------------IIPTERYQPADDNSDIS-------SP-------QRTQMIFSNTIV-----RSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFIN---NPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            ++TY  +N   LVF   K +    G+YTC   N  G    K         I  + L P  A+     QL D  +  +VG  + L           V W +D   L   D  +Q+ +  ++  +LKI    ++ SG Y         T ++   +   +   +P     P SI      S +  C V  + P    + WS     I+P  G+ T   V N  +  I K                  V   D G+Y  +  N  G       ++V         K  PKFI+KLD   ++   E + + CK+SG+P   + W +N  EL ES    +  V     L I      D G Y  +A N  G       L+V  P   V T KP            L+  IS T             +  +++++    N D S       +P       + T  + S+T       + PP+FV   +D     GD V L+  + G+ P  ++W       I    N R      +    L L + +   SG+Y    +N +G+  CSA++ V
Sbjct:   28 YRTYFTNNVATLVFN--KVSINDSGEYTCMAENSIGTAASKTIFR-----IQERQLPPSFAR-----QLKD--IEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRD-DENLQMSF-VDNVATLKILQTDLSHSGQYSCSASNPLGTASSTARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQP--MRVTWSKDNKEIRPG-GNYTITCVGNTPHLRILK------------------VGKGDSGQYTCQATNDVGKDMCSAQLSV---------KEPPKFIKKLDASKVAKQGESIQLECKISGSPEIKVVWFRNDSELHESWKYNMSFVNSVALLTINEASAEDTGDYICEAHNGVGDASCSTALKVKAP--PVFTQKPPPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDTCACTVKFKEPPRFVKKLSDASTLIGDPVELQAVVEGFQPISVVWLKDKGEVIRESENVRISFVDNIAT--LQLGSPEASQSGKYVCQIKNDAGMRECSAVLTV 544          

HSP 5 Score: 77.411 bits (189), Expect = 2.452e-13
Identity = 151/764 (19.76%), Postives = 263/764 (34.42%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNG-------PSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIF-------------NNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYL-----FRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDR 4769
            + + W+KD   +      +I+    S++    +HI N   +D G+Y C+  N         SV  K+ P  +   +     +  +   +T     EP+S+    D  +   ESD I+                P N    +C   ++ ++  +Q  + ++S+ +    +      +V++ D       +   PE     FK+   L       I    F+K+S   II                    D+G   FE+    Q  VG  +C+VS +                  S  +IP    P  + +L +    G  G S+ ++ +        V+W  D   ++S   R       ++ C+L +N     D+G Y  +      +      +  ++  P     P  +      ++    +V   P   +++W      GS    LV  AR  +       L  ++  +EL+  +V TS  GEY   V N AG +S    + V A A          F+++L+   I    + +I+    SG P   + W KNG  +  S    I    ++  L I +    D+G Y     N +G +     + +++P                                                   P FV       V  GD   L+C L G PE  + W+  +T        +M  + +   L+   +   DSG Y   AENS G  + S  + V       S  R
Sbjct: 1331 FQVSWHKDKRELRSGKKYKIM----SENLLTSIHILNVDTADIGEYQCKATNDVGSDTCVGSVTMKAPPQFVKKLTDISTIIGKEVQLQTTIEGAEPISVAWFKDKGEIVRESDNIWISYSENIATLQFSRAEPANAGKYTC---QIKNDAGMQECYATLSVLEPAAIVEKPESIKVTTGDTCTLECTVSGTPELSTKWFKDGKELTSDNKYKISF--FNKVSGLKII---------------NVVPGDSGVYSFEV----QNPVGKDSCKVSIQV-----------------SDRIIP----PSFTRKLKET--NGLSGSSVVMECKVYGSPPISVLWFHDGNEISSG--RKYQTTLTDNTCALTVNMLEEADAGDYTCIATNVAGSDECSAPLT-VREPPSFVQKPDPMDVLTGSNVTFTSIVKGSPP-FTVSW----FKGS--TELVPGARCNV------SLQDSVGELELF--DVDTSQSGEYTCIVSNEAGRASCTTRLFVKAPA---------IFVKRLNDYSIEK-GKPLILEGTFSGTPPISVTWKKNGINVIASQRCNITTTEKSAILEILSSTVEDSGQYNCYIENASGKDSCSAQILILEP---------------------------------------------------PYFVKQLEPVKVTVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTATCKMHFKNNVATLVFTQVDSSDSGEYICRAENSVGEVSSSTFLTVQEQKLPPSFSR 1964          

HSP 6 Score: 66.2402 bits (160), Expect = 5.575e-10
Identity = 116/512 (22.66%), Postives = 183/512 (35.74%), Query Frame = 3
Query: 3276 GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-----VLKETGQTQTTIVE-INPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWSIKPADGSPTRN----LVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVID--PIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNT--HFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSID 4766
            G Y+C  +N  G        S A+ +++     P    P++        +   VG+S  L+          V W KDN+ + S     QI Y E S   L I      DSG Y       V K++   Q  I E + P  F    +   +++   +  S  +   V  S P   ++ W     +  PT N      NNA                  + L     + +D G Y  +  N AG +     I +      +  K  P F Q L   + +   + V + C V G+    ++W+K G E+  SD         T  L +K   K+D+G Y  +ASN  GS+ SKC + + +            ++  + F                +S PQ  +++   T          TF   I K G D          P P + W+           R  + ++ DE  L +++  K DSG Y   A N  G    +  + VD   K   I+
Sbjct: 2028 GQYSCTATNPIGS-----ASSGAKLILTEGKNPPFFDIPLAP-------MDAVVGESADLECHVTGTQPIKVTWAKDNREIRSGG-NYQISYLENS-AHLTIVKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFT---KKLSETVEETEGNSFKLEGRVAGSQPI--TVAWYKNNVEIHPTSNCEIMFKNNA------------------LLLQVKRASMADAGLYTCKATNDAGSALCTSSIVI------KEPKKPPVFDQHL-APVTASEGDSVQLSCHVQGSEPIRIQWLKAGREVKPSDRCSFSFASGTAMLELKETAKADSGDYVCKASNVAGSDTSKCKVTIKEKPAAAPAAKKAAVDGKLFF----------------VSEPQSIRVVEKTT---------ATF---IAKVGGD----------PIPNVKWTKGKWRQLNQGGRILIHQKGDEAKLEIRDTTKTDSGLYRCVAFNKHGEIESNVNLQVDERKKQEKIE 2457          

HSP 7 Score: 62.7734 bits (151), Expect = 6.370e-9
Identity = 138/660 (20.91%), Postives = 240/660 (36.36%), Query Frame = 3
Query: 2976 SLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEI--NPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIR-----KVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPAD----------------------------------------------DNSDISSPQ--RTQMIFSNTIV-----RSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYF---------LILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +++D  QY   +   + +D+ +  + + E P F+       + +G+ + +   +    ++    I W K  T L +       + N+   LV  I K   + VG+YTC+  N  G       ++++  L+  +  +P    P  + +L D + T  +G  +  +          V W KD + L   D  +Q+ +      +L+I     +  G Y         T ++  ++  +  +  P     P S+      S +  C V  + P    I W+         R +     YKM       L  N   + +    V   D G+Y     N AG  S    + V         +  P+FI+KLD+  I   +E     CK+ G+P   + W K+  E+ ES   ++       + E H L ++     D+G Y  +A N  GS  S   L+V +P   V   KP          P E  + AD                                              D +DI   Q   T  + S+T V     ++PPQFV   TD     G +V L+  + G     + W  +       + E+ RE D  +         L     +  ++G+Y+   +N +G+  C A + V
Sbjct:  893 TIEDYAQYACLIENEAGQDICEALVSVLEPPYFIEPLEHVEAAIGEPITLQCKVDGTPEIR---ISWYKEHTKLRSAPAYKMQFKNNVASLV--INKVDHSDVGEYTCKAENSVG------AVASSAVLVIKERKLP----PSFARKLKDVHET--LGFPVAFECRINGSEPLQVSWYKDGELLKD-DANLQMSFVHHV-ATLQILQTDQSHVGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGSFKCHVTGTAPI--KITWA------KDNREIRPGGNYKMT------LVENTATLTVL--KVAKGDAGQYTCYASNVAGKDSCSAQLGV---------QEPPRFIKKLDQSRIVKQDEYTRYECKIGGSPEIKVLWYKDEVEIQESSKFRMSFEDSVAILEMHSLSVE-----DSGDYTCEARNAAGSASSSTSLKVKEP--PVFRKKPF---------PVETLKGADVHLECELQGTPPFQVSWHKDKRELRSGKKYKIMSENLLTSIHILNVDTADIGEYQCKATNDVGSDTCVGSVTMKAPPQFVKKLTDISTIIGKEVQLQTTIEGAEPISVAWFKD-------KGEIVRESDNIWISYSENIATLQFSRAEPANAGKYTCQIKNDAGMQECYATLSV 1485          

HSP 8 Score: 62.003 bits (149), Expect = 9.142e-9
Identity = 153/723 (21.16%), Postives = 264/723 (36.51%), Query Frame = 3
Query: 2940 SNEMIQFNHRSVSLKDVGQYLFRVS---SKDVAKTHLEIGEK--PEFVYHQFKENSLLGDSLAISIPMK-NFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN----------SRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-----VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSV----NTTKPLEKPISFTIIPTERYQP--------------ADDNSDIS-----------SPQRTQ----------------------MIFSNTIVRSP-PQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLPPETYSNLVKTHINDESRVMQASP--RGW 4880
            +N +       VS+ D G+Y            +KT   I E+  P     Q K+   +  ++ + + +    +  +P  + W ++   L  ++    +++++   L  +I +   +H G Y+C  SN  G      +L+A E   S    I    KP+S   ++        G+S   +          V W KDN+ +              P ++I         LK+      DSG Y       V K+    Q ++ E  P +F   I+    S  AKQ  SI + C ++  P    + W    ++      L  + +Y M    +N +        L  +  +  D G+Y     N  G +S    + V         K  P F QK    + +     VI++C++SG P   + W+K+ +++  S   KI        L I N +  D G Y  +A+N  GS+   C ++  +P   V    + +  +  P+    +  E +QP                +N  IS           SP+ +Q                      ++   TIV  P P  VTT        G+   L+C + G PE    W+       +  R  +    +   L + + +  D G Y+   EN  G ++C+  V        H  DR   PS  + L  +  S  +   +  E RV  ++P   GW
Sbjct:   33 TNNVATLVFNKVSINDSGEYTCMAENSIGTAASKTIFRIQERQLPPSFARQLKD---IEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQMSFVDNVATL--KILQTDLSHSGQYSCSASNPLGTASSTARLTAREPKKSPFFDI----KPVSIDVIA--------GESADFECHVTGAQPMRVTWSKDNKEIRPGGNYTITCVGNTPHLRI---------LKVGKG---DSGQYTCQATNDVGKDMCSAQLSVKE--PPKF---IKKLDASKVAKQGESIQLECKISGSPEIKVV-WFRNDSE------LHESWKYNM--SFVNSVA------LLTINEASAEDTGDYICEAHNGVGDASCSTALKV---------KAPPVFTQK-PPPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDTCACTVKFKEPPRFVKKLSDASTLIGDPVELQAV-VEGFQPISVVWLKDKGEVIRESENVRISFVDNIATLQLGSPEASQSGKYVCQIKNDAGMRECSAVLTVLEPATIVEKPEPMTVTT--------GNPFTLECVVAGTPELSAKWFKDGRELSSGSRHHITFVRNLASLKIPSAEMNDKGLYTFEVENRVGKSSCTVSV--------HVSDRVVPPSFVRRL--KDTSATLGASVVLECRVSGSAPISVGW 677          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Mouse
Match: Ttn (titin [Source:MGI Symbol;Acc:MGI:98864])

HSP 1 Score: 124.405 bits (311), Expect = 1.340e-27
Identity = 174/773 (22.51%), Postives = 304/773 (39.33%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVAKTH---LEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTY--INDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE----KPISFT-------------------IIPTERYQPADDNS---------DISSPQRTQMIFSN----------TIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYN-THFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            I W KDN  I P  + ++ L  N+ +    + +    + DAGQY C   N     + S    L V  Q+    I K  +       E    +  + G   +PE  +++    + +  SS  +     + +      S+S++D G Y     +   + +    L++ E P F    F   +L G  + +   ++      P  + W K+K  L     S K Y  +++N      I     A +G+Y C+ +N+ G D            + S T+    A P    +L+D  ++  +G  ++L           V W KD   +      I I Y  E+  +L+ + A   ++G Y   +K     Q     ++ ++ A +++  P+SI+     +  + C V+  P   S  W     DG   + L ++ +YK+     NK++G      L   NV   D G Y   V+N  G  S  + I V+      ++   P F +KL KE        V++ CKV G+P   + W  +G E+S     +      T  L +   +++DAG Y   A+N  GS+     L V +P   V    P++      ++FT                   ++P  R   +  +S         D S       I SN            V++P  FV    D  +++G  ++L+    G P   + W  N  + I + R  +        L + +    DSG+Y+   EN+SG  +CSA +++
Sbjct: 8256 ITWAKDNREIRPGGNYKMTLVENTAT----LTVLKVAKGDAGQYTCYASNVAG--KDSCSAQLGV--QEPPRFIKKLDQSRIVKQDEYTRYECKIGG---SPEIKVLWYKDEVEIQESS-KFRMSFEDSVAILEMHSLSVEDSGDYTCEARNAAGSASSSTSLKVKEPPVFRKKPFPVETLKGADVHLECELQG---TPPFQVSWHKDKRELR----SGKKYKIMSENLLTSIHILNVDTADIGEYQCKATNDVGSD----------TCVGSVTM---KAPPQFVKKLTD--ISTIIGKEVQLQTTIEGAEPISVAWFKDKGEIVRESDNIWISY-SENIATLQFSRAEPANAGKYTCQIKNDAGMQECYATLSVLEPAAIVEK-PESIKVTTGDTCTLECTVSGTPEL-STKWF---KDG---KELTSDNKYKISF--FNKVSG------LKIINVVPGDSGVYSFEVQNPVGKDSCKVSIQVS------DRIIPPSFTRKL-KETNGLSGSSVVMECKVYGSPPISVLWFHDGNEISSGRKYQTTLTDNTCALTVNMLEEADAGDYTCIATNVAGSDECSAPLTVREPPSFVQKPDPMDVLTGSNVTFTSIVKGSPPFTVSWFKGSTELVPGARCNVSLQDSVGELELFDVDTSQSGEYTCIVSNEAGRASCTTRLFVKAPAIFVKRLNDYSIEKGKPLILEGTFSGTPPISVTWKKNGINVIASQRCNITTTEKSAILEILSSTVEDSGQYNCYIENASGKDSCSAQILI 8970          

HSP 2 Score: 93.2041 bits (230), Expect = 3.511e-18
Identity = 163/762 (21.39%), Postives = 290/762 (38.06%), Query Frame = 3
Query: 2652 MHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLS---VFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHK-TYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQ-AVLKETGQTQTTIV-----EINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG--------SVNTTKPL--------EKPISFTIIPTERYQPADDNSDISSPQRTQM--IFSNTI------------------------VRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDR 4769
            + I+     D G Y CE  NG      S+ + +    VF+QK   V         A     + L+  + G    P  ++++      V  SS  +   S N     +  ++   D+G+Y  + +++   D     ++  E P FV      ++L+GD + +   ++ F    P +++W K+K  +     + + +++++   L    P+ +Q+  G Y CQ+ N+ G      + SA   ++   T++    KP          +T + G+   L+            W KD + L+S   R  I +   +  SLKI  A +ND G Y   V    G++  T+       + P  F   ++D   ++ A    S+ + C V+      S+ W +   DG+           ++I+ P  + +       L   ++  SD G Y     N AG       +TV         +  P F Q  D   + P    +     + G P   +KW K   EL   +   I       EL +   +   +G Y    +N  GS     HL V +P          SV T  P+          PIS + +  E       N  I++ +++ +  I  +TI                        V  PP F+          G+ + L+C + G PE  I W+  +T   + P ++M+ + +   L++  +   D G Y+  AENS G    SA++++       S  R
Sbjct: 7435 LTINEASAEDTGDYICEAHNGVGDASCSTALKVKAPPVFTQKPPPV--------GALKGSDVILQCEISG---TPPFEVVWVKDRKQV-RSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDTCACTVKFKEPPRFVKKLSDASTLIGDPVELQAVVEGFQ---PISVVWLKDKGEVIRESENVRISFVDNIATLQLGSPEASQS--GKYVCQIKNDAG----MRECSAVLTVLEPATIV---EKP--------EPMTVTTGNPFTLECVVAGTPELSAKWFKDGRELSSGS-RHHITF-VRNLASLKIPSAEMNDKGLYTFEVENRVGKSSCTVSVHVSDRVVPPSFVRRLKDTSATLGA----SVVLECRVSGSAPI-SVGWFL---DGN-----------EIISSPKCQSSFADNVCTLTLSSLEPSDTGAYTCVAANVAGQDESSAVLTV---------QEPPSFEQTPDSVEVLP-GMSLTFTSVIRGTPPFKVKWFKGSRELVSGEACTISLEDFVTELELLEVEPGQSGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADTSVETGSPIVLEATYSGTPPISVSWMKNEYPLSQSPNCGITTTEKSSILEILESTIEDYAQYACLIENEAGQDICEALVSVLEPPYFIEPLEHVEAAIGEPITLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYTCKAENSVGAVASSAVLVIKERKLPPSFAR 8133          

HSP 3 Score: 92.0485 bits (227), Expect = 1.002e-17
Identity = 112/501 (22.36%), Postives = 189/501 (37.72%), Query Frame = 3
Query: 3237 LVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +  EI  F  A VGDY C V+NE G    K    A   L    T +          +  D++ T   G ++ L           V+W+K  Q +   D +I++ +       L I    ++  G Y  + +    +QT++ E+   + A +I+   + I+        +   V+  P        +KP      R LV + +Y++          N+ +++ Y  +    D G+Y   + N  G SS     TV       ++  +P F + L + + S +     + CK++G+    + W K+G+EL+ SD  +I  V  T  L I     +DAG +  +A+N+ GS+ S   L V +P                                                   P FVT      V  G  V LK    G  P  + W+  +   ++     + +E  E  L L  ++  DSG Y+    N +G   CSA + V
Sbjct: 4899 VYLEISSFNSADVGDYECVVANEVG----KCGCVATHLLKEPPTFV----------KKVDDF-TALAGQTVTLQAAVRGSEPISVMWMK-GQEVIKEDGKIKMSF-SNGVAVLTIPDVQISLGGKYTCLAENEAGSQTSVGELIVKEPAKIIERA-ELIQVTAGDPATLEYTVSGTPE-------LKPKWYKDGRPLVASKKYRI------SFKNNIAQLKFY--SAELHDSGQYTFEISNEVGSSSCETTFTVL------DRDIAPLFTKPL-RNVDSVVGGACRLDCKIAGSLPMRVSWFKDGKELTASDRYQIAFVEGTASLEISRVDMNDAGNFTCRATNSVGSKDSSGALIVQEP---------------------------------------------------PSFVTKPGSRDVLPGSAVCLKSAFQGSAPLTIKWFKGDKELVSGGSCYITKETSESSLELYAVKTSDSGTYTCKVSNVAGSVECSADLFV 5308          

HSP 4 Score: 90.8929 bits (224), Expect = 2.060e-17
Identity = 179/797 (22.46%), Postives = 305/797 (38.27%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVN-HSSCPWSKVSSNEMIQFNHRS-------VSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELV-FEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDF---------PQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVI-VRCKVSGNPNPI-LKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQ-----------------------PA-------DDNS----------------------DISSPQRTQMIFSNTIVRSPPQFVTTFTDEIV-KEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLI-LKNIQKGDSGRYSITAENSSGLATCS 4721
            I+W+K ++ ++      I  + +  S    + +   + SD+G Y C+V N    +  S+     +F ++  T I K          EP  L    DG + A +   +    PI +   ++    + SS   + F   +       V+++D G+Y+      +  D     + + E P F   +FK   +L +   +   +       P  I W K+ T L + +  +KT++ D  +LV  ++ KF  A  G+Y C+V+NE G      +++  E         P   K I ++       +   G +          +   V WLKDN  + + D  I++ + E +  SL ++G  V   G Y    K     Q     ++  + A ++++          P +++ K +G+  I           S  W     DG   + L    +YK+       +T  +  +++   +    D GEY   V+N  G SS    I V  L         P F +KL K  +  I    I + C V+G+ +PI ++W K+ +E+S SD  K      T  L I   + +D+G Y   A+N  G      HL V +P   V      EKP S  + P  R Q                       P        DD S                      D+ +      IF    V+ PPQF+   +  +V + G     +C + G PE  + W  + + I + R      +D      + N +  +SG Y   A N +G A+CS
Sbjct: 5250 IKWFKGDKELVSGGSCYITKETSESS----LELYAVKTSDSGTYTCKVSNVAGSVECSA----DLFVKEPATFIEKL---------EPSQLLKKGDGTQLACK---VTGTPPIKITWFANDRELRESSKHKMSFAESTAVLRLTDVAIEDSGEYMCEAQNEAGSDHCTGIVIVKESPYFT-KEFKSIEVLKEYDVML--LAEVAGTPPFEITWFKDNTTLRSGR-KYKTFLQD--QLVSLQVLKFVAADAGEYQCRVTNEVGSSTCSARVTLREP--------PSFIKKIEAT-------SSLRGGTAAFQATLKGSLPITVTWLKDNDEI-TEDDNIRMTF-ENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATIMEEAVSIDVTQGDPATLQVKFSGTKEI-----------SAKWF---KDG---QELTLGPKYKI------SVTDTVSILKII--STEKKDSGEYTFEVQNDVGRSSCKASINVLDLI------IPPSFTKKLRK--MDSIKGSFIDLECIVAGS-HPISIQWFKDDQEISASDKHKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHSQCSGHLTVKEPPYFV------EKPQSQDVNPGTRVQLKALVGGTAPMTIKWFKDNKELHPGAARSVWKDDTSTILELFSAKAADSGTYICQLSNDVGTTSSKATIF----VKEPPQFIKKPSPVLVLRNGQSTTFECQVTGTPEIRVSWYLDGNEITDLRKYGISFVDGLATFQISNARVENSGTYVCEARNDAGTASCS 5959          

HSP 5 Score: 88.1965 bits (217), Expect = 1.383e-16
Identity = 178/733 (24.28%), Postives = 281/733 (38.34%), Query Frame = 3
Query: 2565 QWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYA--PESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLF---RVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVL-----KETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFT--DEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSA 4724
            +W+KD + +  D   +I    N  SG   + I N    D+G Y  EV+N   V + S  V + V  +    + P F+ K    N    S  +V++   Y   P S L F++   N   S   +    ++         +   D G Y      V+  D     L + E P FV      + L G ++  +  +K      P T+ W K  T L      + +  +  GEL  E+     +  G+YTC VSNE G               S  T + V A  I   +L+D  +    G  + L+  F       V W K+   + +   R  I   E+S   L+I  +TV DSG Y   +     K++   Q  I+E  P  F   ++     ++     S ++ C +   P    ++W        PT      A  KM  K  N +        L F  V +SD GEY  R ENS G  S    +TV      Q +K  P F ++L +++   +   V+  C VSG+    + W K+G+ L +S +++   +     L I    +S +G Y   A+N               PIGS ++   L        I TE                          ++PP F       D +V E  D  L+C + G  P  + W   N    +   +++    +   L +  + KGDSG+Y+  A N  G  +C+A
Sbjct: 8631 KWFKDGKELTSDNKYKISF-FNKVSG---LKIINVVPGDSGVYSFEVQN--PVGKDSCKVSIQVSDR---IIPPSFTRKLKETNGLSGS-SVVMECKVYGSPPISVLWFHDG--NEISSGRKYQTTLTDNTCALTVNMLEEADAGDYTCIATNVAGSDECSAPLTVREPPSFVQKPDPMDVLTGSNVTFTSIVKG---SPPFTVSWFKGSTELVPGARCNVSLQDSVGEL--ELFDVDTSQSGEYTCIVSNEAGR-------------ASCTTRLFVKAPAIFVKRLNDYSI--EKGKPLILEGTFSGTPPISVTWKKNGINVIASQ-RCNITTTEKSAI-LEILSSTVEDSGQYNCYIENASGKDSCSAQILILE--PPYFVKQLE----PVKVTVGDSASLQCQLAGTPEI-GVSWYKGDTKLRPT------ATCKMHFK--NNVA------TLVFTQVDSSDSGEYICRAENSVGEVSSSTFLTV------QEQKLPPSFSRQL-RDVQETVGLPVVFECAVSGSEPISVSWYKDGKPLKDSPNIQTSFLDNIATLNIFKTDRSLSGQYSCTATN---------------PIGSASSGAKL--------ILTEG-------------------------KNPPFFDIPLAPMDAVVGESAD--LECHVTGTQPIKVTWAKDNREIRSGGNYQISYLENSAHLTIVKVDKGDSGQYTCYAVNEVGKDSCTA 9251          

HSP 6 Score: 87.0409 bits (214), Expect = 3.225e-16
Identity = 172/767 (22.43%), Postives = 275/767 (35.85%), Query Frame = 3
Query: 2649 KMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFS------------EKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQ--FAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWS-----IKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKP------------LEKPISFT-------------IIPTERYQPADDNSDIS-------SP-------QRTQMIFSNTIV-----RSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFIN---NPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            ++ + N   S +G+Y C V N        +     +F ++  T + K S            E T+   T P+S+    DG    P          I     +C    +SS +            D G Y   +   + +D     +   E P FV       + +GDS+++   +    ++   T+ W K  T L +       + N+   LVF   K +    G+YTC   N  G    K         I  + L P  A+     QL D  +  +VG  + L           V W +D   L   D  +Q+ +  ++  +LKI    ++ SG Y         T ++   +   +   +P     P SI      S +  C V  + P    + WS     I+P  G+ T   V N  +  I K                  V   D G+Y  +  N  G       ++V         K  PKFI+KLD   ++   E + + CK+SG+P   + W +N  EL ES    +  V     L I      D G Y  +A N  G       L+V  P   V T KP            L+  IS T             +  +++++    N D S       +P       + T  + S+T       + PP+FV   +D     GD V L+  + G+ P  ++W       I    N R      +    L L + +   SG+Y    +N +G+  CSA++ V
Sbjct: 6962 ELELFNIDISQSGEYTCVVSNNAG----QASCTTRLFVKEPATFVKKLSDHSVEPGKSIILEGTYTG-TLPISVTWKKDGVSITPS-----ERCNIVTTEKTCILEILSSTK-----------GDAGHYSCEIENEAGRDACDALVSTLEPPYFVTELEPLEASVGDSVSLQCQVAGTPEI---TVSWFKGDTKLRSTPEYRTYFTNNVATLVFN--KVSINDSGEYTCMAENSIGTAASKTIFR-----IQERQLPPSFAR-----QLKD--IEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRD-DENLQMSF-VDNVATLKILQTDLSHSGQYSCSASNPLGTASSTARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQP--MRVTWSKDNKEIRPG-GNYTITCVGNTPHLRILK------------------VGKGDSGQYTCQATNDVGKDMCSAQLSV---------KEPPKFIKKLDASKVAKQGESIQLECKISGSPEIKVVWFRNDSELHESWKYNMSFVNSVALLTINEASAEDTGDYICEAHNGVGDASCSTALKVKAP--PVFTQKPPPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDTCACTVKFKEPPRFVKKLSDASTLIGDPVELQAVVEGFQPISVVWLKDKGEVIRESENVRISFVDNI--ATLQLGSPEASQSGKYVCQIKNDAGMRECSAVLTV 7654          

HSP 7 Score: 83.5741 bits (205), Expect = 3.183e-15
Identity = 164/772 (21.24%), Postives = 286/772 (37.05%), Query Frame = 3
Query: 2475 LLVNAESSCPTRLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVN--------HSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK----DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPL-NSRDPRIQIYYPEESKCSLKINGATVNDSGTYQ-AVLKETGQT--QTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            L++  ES+   RL   L+  P I      + W+K+N+ +      R+    NS++    + I + +  D+G Y CE  N              V S    T +      +F    EP     ++ G     + + I    P  VN         SS  +   +    +     S +  DVG Y   V+++        THL + E P FV       +L G ++ +   ++      P +++W K +  +  +     ++   NG  V  IP    +  G YTC   NE G      Q S  E ++         AK I  ++L    +  + GD   L+            W KD +PL  S+  RI     + +   LK   A ++DSG Y   +  E G +  +TT   ++    AP+     +++ +   G+  + C +  S P    ++W     DG   + L  + RY++      + T +++        V  +D G +  R  NS G       + V         +  P F+ K     + P    V ++    G+    +KW K  +EL       I K      L +   K SD+G Y  + SN  GS   +C   +            +++P +F     E+ +P+                                 +++K+GD   L C + G P   + W++ +     + + +M        L L ++   DSG Y   A+N +G   C+ +VIV
Sbjct: 4761 LMLPGESA---RLHCKLKGSPVIQ-----VTWFKNNKELSESNTVRMSF-VNSEA---ILDITDVKVDDSGTYSCEATN-------------DVGSDSCSTEVVIKEPPSFIKTLEPAD---IVRGANALLQCE-IAGTGPFEVNWFKDKKQIRSSKKYRLFTQKTFVYLEISSFNSADVGDYECVVANEVGKCGCVATHL-LKEPPTFVKKVDDFTALAGQTVTLQAAVRGSE---PISVMWMKGQEVIKEDGKIKMSF--SNGVAVLTIPDVQISLGGKYTCLAENEAGS-----QTSVGELIVKE------PAKIIERAEL----IQVTAGDPATLEYTVSGTPELKPKWYKDGRPLVASKKYRISF---KNNIAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLD-RDIAPLFTKPLRNVDSVVGGACRLDCKIAGSLP--MRVSWF---KDG---KELTASDRYQIA---FVEGTASLE-----ISRVDMNDAGNFTCRATNSVGSKDSSGALIV---------QEPPSFVTKPGSRDVLP-GSAVCLKSAFQGSAPLTIKWFKGDKELVSGGSCYITKETSESSLELYAVKTSDSGTYTCKVSNVAGS--VECSADLF-----------VKEPATF----IEKLEPS---------------------------------QLLKKGDGTQLACKVTGTPPIKITWFANDRELRESSKHKMSFAESTAVLRLTDVAIEDSGEYMCEAQNEAGSDHCTGIVIV 5402          

HSP 8 Score: 83.1889 bits (204), Expect = 4.489e-15
Identity = 122/545 (22.39%), Postives = 202/545 (37.06%), Query Frame = 3
Query: 3255 KFTQAHV---GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSI---NIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVI--------DPIGSVNTTKPLEKPISFTIIPTERYQPA--DDNSDISSPQRTQMIFSNTIV----------------------------------RSPPQFVTTFTDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            KF  A +   G YT ++SNE G    +   +     +  + + P+  KP+ +       V   VG + +LD +    +   V W KD + L + D R QI +  E   SL+I+   +ND+G +           T  V       A ++Q+ P  +    +  +   + VC+ +++    S   +IK   G   + LV+     +  +       +   +ELY   V TSD G Y  +V N AG       + V         K    FI+KL+   +    +   + CKV+G P   + W  N  EL ES   K+     T  L + +    D+G Y  +A N  GS+   C   VI            S+   K  +  +   +  T  ++     DN+ + S ++ +    + +V                                  R PP F+          G     +  L G  P  + W   N     +    M  E +   L L  I+    G+Y   A+N +G+  CSAL+ V
Sbjct: 5088 KFYSAELHDSGQYTFEISNEVGSSSCETTFT-----VLDRDIAPLFTKPLRN-------VDSVVGGACRLDCKIAGSLPMRVSWFKDGKELTASD-RYQIAF-VEGTASLEISRVDMNDAGNFTC-------RATNSVGSKDSSGALIVQEPPSFVTKPGSRDVLPGSAVCLKSAFQG--SAPLTIKWFKGD--KELVSGGSCYITKE------TSESSLELY--AVKTSDSGTYTCKVSNVAGSVECSADLFV---------KEPATFIEKLEPSQLLKKGDGTQLACKVTGTPPIKITWFANDRELRESSKHKMSFAESTAVLRLTDVAIEDSGEYMCEAQNEAGSD--HCTGIVIVKESPYFTKEFKSIEVLKEYDVMLLAEVAGTPPFEITWFKDNTTLRSGRKYKTFLQDQLVSLQVLKFVAADAGEYQCRVTNEVGSSTCSARVTLREPPSFIKKIEATSSLRGGTAAFQATLKGSLPITVTWLKDNDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSV 5588          

HSP 9 Score: 78.1814 bits (191), Expect = 1.340e-13
Identity = 119/542 (21.96%), Postives = 203/542 (37.45%), Query Frame = 3
Query: 3243 FEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN-SRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE------KPISFTIIPTERYQPA--DDNSDISSPQRTQMIFSNTIV----------------------------------RSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
             EI +      G+YTC+ SNE+G       L+  EA   +    P               +T  VG + K           +++W KD   L+ S D R+      ++K SL+++  TV D G Y               E+  I     I++  +++++  N  I++ C V+      +I WS    DG   + L     YK+           +  +E+    +   D G Y     N AG SS    + V         +  P F++K+D   +    E   + CK+ G+P   + W KN +ELSES+ +++  V     L I + K  D+G Y  +A+N  GS+     + + +P   + T +P +        +   I  T  ++     D   I S ++ ++    T V                                  + PP FV    D     G  V L+  + G  P  ++W         + + +M        L + ++Q    G+Y+  AEN +G  T    +IV
Sbjct: 4526 LEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRP-------------KALTTFVGKAAKFLCTVSGTPVIEIIWQKDGAALSPSPDCRVT---DADNKHSLELSNLTVQDRGIYSCKASNKFGADICQAELTIIDKPHFIKEL-EAVQSAINKKIHLECQVDEDRKV-TITWS---KDG---QKLPAGKDYKIY------FEDKIASLEIPLAKL--KDSGTYTCTASNEAGSSSSSAAVAV---------REPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMSFVNSEAILDITDVKVDDSGTYSCEATNDVGSDSCSTEVVIKEPPSFIKTLEPADIVRGANALLQCEIAGTGPFEVNWFKDKKQIRSSKKYRLFTQKTFVYLEISSFNSADVGDYECVVANEVGKCGCVATHLLKEPPTFVKKVDDFTALAGQTVTLQAAVRGSEPISVMWMKGQEVIKEDGKIKMSFSNGVAVLTIPDVQISLGGKYTCLAENEAGSQTSVGELIV 5026          

HSP 10 Score: 77.7962 bits (190), Expect = 1.708e-13
Identity = 151/764 (19.76%), Postives = 264/764 (34.55%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNG-------PSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNM-------------PINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYL-----FRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDR 4769
            + + W+KD   +      +I+    S++    +HI N   +D G+Y C+  N         SV  K+ P  +   +     +  +   +T     EP+S+    D  +   ESD I+ +              P N    +C   ++ ++  +Q  + ++S+ +    +      +V++ D       +   PE     FK+   L       I    F+K+S   II                    D+G   FE+    Q  VG  +C+VS +                  S  +IP    P  + +L +    G  G S+ ++ +        V+W  D   ++S   R       ++ C+L +N     D+G Y  +      +      +  ++  P     P  +      ++    +V   P   +++W      GS    LV  AR  +       L  ++  +EL+  +V TS  GEY   V N AG +S    + V A A          F+++L+   I    + +I+    SG P   + W KNG  +  S    I    ++  L I +    D+G Y     N +G +     + +++P                                                   P FV       V  GD   L+C L G PE  + W+  +T        +M  + +   L+   +   DSG Y   AENS G  + S  + V       S  R
Sbjct: 8441 FQVSWHKDKRELRSGKKYKIM----SENLLTSIHILNVDTADIGEYQCKATNDVGSDTCVGSVTMKAPPQFVKKLTDISTIIGKEVQLQTTIEGAEPISVAWFKDKGEIVRESDNIWISYSENIATLQFSRAEPANAGKYTC---QIKNDAGMQECYATLSVLEPAAIVEKPESIKVTTGDTCTLECTVSGTPELSTKWFKDGKELTSDNKYKISF--FNKVSGLKII---------------NVVPGDSGVYSFEV----QNPVGKDSCKVSIQV-----------------SDRIIP----PSFTRKLKET--NGLSGSSVVMECKVYGSPPISVLWFHDGNEISSG--RKYQTTLTDNTCALTVNMLEEADAGDYTCIATNVAGSDECSAPLT-VREPPSFVQKPDPMDVLTGSNVTFTSIVKGSPP-FTVSW----FKGS--TELVPGARCNV------SLQDSVGELELF--DVDTSQSGEYTCIVSNEAGRASCTTRLFVKAPA---------IFVKRLNDYSIEK-GKPLILEGTFSGTPPISVTWKKNGINVIASQRCNITTTEKSAILEILSSTVEDSGQYNCYIENASGKDSCSAQILILEP---------------------------------------------------PYFVKQLEPVKVTVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTATCKMHFKNNVATLVFTQVDSSDSGEYICRAENSVGEVSSSTFLTVQEQKLPPSFSR 9074          

HSP 11 Score: 77.411 bits (189), Expect = 2.179e-13
Identity = 172/801 (21.47%), Postives = 301/801 (37.58%), Query Frame = 3
Query: 2508 RLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLS---VFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHK-TYINDNGELVFEIPKFTQAHVGDYTCQVSNEFG--EDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQ-AVLKETGQTQ-TTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPI--------------------GSVNTTKPLE---KPISFTIIPTERYQPADDNSDISSPQRTQM--IFSNT----------------------IVRS--PPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSAL 4727
            RL+  +   P I      + WY+ NE  L   D   +   +S +    + +++    D+G + CE +N       S+ V++    VFS       P   E     NTE +SL+  L G    P  ++++      +  SS  +   S N     +  +V   D+G+Y  +  ++   D     +++ E P+F+    K NSL   +   +    +     P ++ W K K  +     + + +++N+   L F   K   A+ G Y CQV N+ G  E++  L +     +I                      +T +VG++  L+ +        V W KD + L S       +Y + S  SLKI      D+GTY   V    G++  T +V+++     P    F + ++    G +   C++             K A  SP      + + K+++    + T +     L  +++ +SD G Y     N AG       +TV         +  P F+++ +   + P  + +     + G P   + W +   EL + +   I       EL + N   S +G Y    SN  G       L V +P                     G+   T P+    K    +I P+ER        +I + ++T +  I S+T                      +V +  PP FVT         GD V L+C + G PE  + W+  +T   + P +      +   L+   +   DSG Y+  AENS G A    +
Sbjct: 6455 RLECKITGSPEIQ-----VVWYR-NEHELTASDKYQMTFIDSVA---VIQMNSLGTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSS-----FPPIVETL--KNTE-VSLECELSG---TPPFEVVWYKDKRQL-RSSKKYKVASKNFHASIHILNVESTDIGEYHCKAQNEVGSDACVCAVKLKEPPKFIS---KLNSLTVVAGEPAELQASIEGAQPISVQWLKEKEEVIRESENIRISFVNNVATLQFA--KVEPANAGKYICQVKNDGGVRENMATLTVLEPAVIIEKA-----------------GSMTVTVGETCALECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKIS--SLKILSVEKEDAGTYTFQVQNNVGKSSCTAVVDVSDRMVPP---SFTRRLK-DTGGVLGTSCILEC-----------KVAGSSPISIAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGSYTCVAANVAGSDECRALLTV---------QEPPSFVKEPEPLEVLP-GKNITFTSVIRGTPPFKVGWFRGARELVKGNRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPATFVKKLSDHSVEPGKSIILEGTYTGTLPISVTWKKDGVSITPSER-------CNIVTTEKTCILEILSSTKGDAGHYSCEIENEAGRDACDALVSTLEPPYFVTELEPLEASVGDSVSLQCQVAGTPEITVSWFKGDTKLRSTPEYRTYFTNNVATLVFNKVSINDSGEYTCMAENSIGTAASKTI 7178          

HSP 12 Score: 73.9442 bits (180), Expect = 2.931e-12
Identity = 139/669 (20.78%), Postives = 249/669 (37.22%), Query Frame = 3
Query: 2985 DVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVW-LKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPR-FEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLPPETYSNLVKTHINDESRVMQASPRGWQEFQFHSNASTLRSSKNDIFEQELPVDKDVS 4973
            D G Y    ++K        HL + E P FV     ++   G  + +   +      +P TI W K+   L     + ++   D+   + E+     A  G Y CQ+SN+ G               SS+  I V   P    + S   V  + G S   + +        V W L  N+  + R   I      +   + +I+ A V +SGTY    +    T +  +E+  ++  P+     + +   ++  + + C V+ + P    + W            L NN   +   K    ++  M    L+      SD GEY   + N  G  +    + +         K  P FI+K++  + + +      +  V+G+P   + W+K+ + L E+D++ I        L +++     +G Y  QA N +G  + +C+                    +F ++                             + P Q +       V E D V L+C + G PE  + W  +   I   R F M  E +     ++++ K DSG+Y+   EN  G ++C A + V        +D+   PS +K L       ++ + I+ E +V  + P   Q F+     ST  S+K  +   E  V  +VS
Sbjct: 5754 DSGTYTCSATNKAGHSQCSGHLTVKEPPYFVEKPQSQDVNPGTRVQLKALVGG---TAPMTIKWFKDNKELHPG--AARSVWKDDTSTILELFSAKAADSGTYICQLSNDVG-------------TTSSKATIFVKEPPQFIKKPSPVLVLRN-GQSTTFECQVTGTPEIRVSWYLDGNEITDLRKYGISFV---DGLATFQISNARVENSGTYVCEARNDAGTASCSIELK-VKEPPIFIRELEPVEVVKDSDVELECEVMGTTP--FEVTW------------LKNNKEIRSGKK--YTMSEKMSVFYLHITKCDPSDVGEYQCIIANEGGSCACSARVAL---------KEPPSFIKKIEN-VTTVLKSSATFQSTVAGSPPISITWLKDDQILEENDNVHISFEDSVATLQVRSVDNGHSGRYTCQAKNESG--IERCY--------------------AFLLV-----------------------------QEPAQIIEKAKSVDVTEKDPVTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRV--------LDQDIPPSFTKKL--TKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEIST--SAKYRLVCHENTVSLEVS 6310          

HSP 13 Score: 71.633 bits (174), Expect = 1.430e-11
Identity = 174/862 (20.19%), Postives = 333/862 (38.63%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV------SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSS----DVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGAT-------VNDSGTYQAVLKETGQT-----QTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRN---LVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDP---IGSVNT-----TKPLE--------KPIS------------------------FTIIPTERYQPADDNSDISSPQRTQMIFSNT---IVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNP---RFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLPPETYSNLVKTHINDESRVMQASP--RGWQEFQFHSNASTLRSSK 4928
            I W KD++ +  + +  I  + +  + +++  +DN     +G+Y C+ +N   + R  + +L+    Q+   +I K ++       +P++L+ V+ G    PE  + +      +  S   +S    N +  F  +SV  +D GQY F+V      SS D     L+    P F     K + +LG S+ +   +     +S +   W K+   ++T+   ++   ++N  +  E+         +YTC+VSN  G++       A   +++ +       KP     + D+             VEF A +       + WLKD+  L S             KC + + G+T       V+ S T Q   + T         T ++   P +F   ++    S   K   S  + C +   P    + +          RN   L  + +Y+M          ++  I++  +++ T D G++    +N AG +S    + V    E     + P  ++ L        N +V + C++SG P   + W K+  +L  S   K+        + I N + +D G Y  +A N  GS+   C +++ +P   I  +N+      +P E        +PIS                           +   + +PA+    I   +    +  N     V  P   +       V  G+   L+C + G PE  + W  +   + +    +F    ++    L + +++K D+G Y+   +N+ G ++C+A+V V         DR   PS ++ L  +    ++ T    E +V  +SP    W    FH     +  +K
Sbjct: 6092 ITWLKDDQILEENDNVHISFEDSVATLQVR-SVDN---GHSGRYTCQAKNESGIERCYAFLLV----QEPAQIIEK-AKSVDVTEKDPVTLECVVAG---TPELKVKWLKDGKQIVPSRY-FSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQDIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQ---WFKDGKEISTSA-KYRLVCHEN-TVSLEVSNLELEDTANYTCKVSNVAGDN-------ACSGILTVKEPPSFLVKPERQQAIPDS------------TVEFKAVLKGTPPFKIKWLKDDVELVSG-----------PKCFIGLEGSTSFLNLYSVDSSKTGQYTCQVTNDVGSDSCTTMLLVTEPPKF---VKKLEASKIIKAGDSARLECKITGSPEIQVVWY----------RNEHELTASDKYQMT------FIDSVAVIQM--NSLGTEDSGDFICEAQNPAGSTSCSTKVIVK---EPPVFSSFPPIVETLK-------NTEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKVASKNFHASIHILNVESTDIGEYHCKAQNEVGSDACVCAVKLKEPPKFISKLNSLTVVAGEPAELQASIEGAQPISVQWLKEKEEVIRESENIRISFVNNVATLQFAKVEPANAGKYICQVKNDGGVRENMATLTVLEPAVIIEKAGSMTVTVGETCALECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISS--LKILSVEKEDAGTYTFQVQNNVGKSSCTAVVDVS--------DRMVPPSFTRRL--KDTGGVLGTSCILECKVAGSSPISIAW----FHEKTKIVSGAK 6858          

HSP 14 Score: 71.2478 bits (173), Expect = 1.793e-11
Identity = 48/162 (29.63%), Postives = 79/162 (48.77%), Query Frame = 3
Query: 3843 YKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRV--ENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG 4322
            Y+  ++P ++ T      +L        +G +Y  RV   N+ G   V +P     + EA+ +   PK +  + ++I     +K+ V   V G PNPI KW K  +E+  S HL I K   +  L+IK+  + D+G Y   A N++GS+  K  + V+D  G
Sbjct: 20751 YREEDQPADRWTEYSVVKDLSLIVTGLKEGKKYKFRVAARNAVG---VSMPREAEGVYEAKEQLLPPKIL--MPEQITIKAGKKLRVEAHVYGKPNPICKWKKGDDEVVTSSHLAIHKADGSSVLIIKDVTRKDSGYYSLTAENSSGSDTQKIKVTVMDAPG 20907          

HSP 15 Score: 69.707 bits (169), Expect = 5.468e-11
Identity = 81/325 (24.92%), Postives = 134/325 (41.23%), Query Frame = 3
Query: 3768 SCHSINWSIKPADG-SPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRV--ENSAG---WSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKV---GETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI-NNPRFEMKRELDEYFLILKN-IQKGDSGRYSITAENSSGL 4709
            SC  + W    +DG +  RN     R K  NK +   T  ++       N+   +G EY  RV  EN  G   WS +  P+T  +    Q    +P F ++L    +   +   +V CKV+G+P PI+KW + G+E+  +D LK R     G  H+L+I +    DA +Y+ +A+N  GS      L+V  P                              + I  P+  + + +   +R                G+ V +K    G P+P+I W      I NN  +++        L+  N +++ D+G Y + A+N  G+
Sbjct: 32754 SC-VVAWKPPASDGGAKIRNYYLERREKKQNKWIAVTTEEIRETVFSVQNLI--EGLEYEFRVKCENLGGESEWSEISEPVTPKSDVPIQ----APHFKEELRNLNVRYQSNATLV-CKVTGHPKPIVKWYRQGKEII-ADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVP------------------------------AKIHLPKTLEGMGAVHALR----------------GEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFSNGVERKDAGFYVVCAKNRFGI 33023          

HSP 16 Score: 68.9366 bits (167), Expect = 8.246e-11
Identity = 181/855 (21.17%), Postives = 308/855 (36.02%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCN--SQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKL---VLDGFKYAPESDLIFNNMPINVNHSSCP-WSKVSSNEMIQFNHRSVSLKDVGQYLFRVS---SKDVAKTHLEIGEK---PEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN----------SRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-----VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSV----NTTKPLEKPISFTIIPTERYQP--------------ADDNSDIS-----------SPQRTQ----------------------MIFSNTIVRSP-PQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLPPETYSNLVKTHINDESRVMQASP--RGW 4880
            + W KD  +I P        +CN  +      + I +  + DAG Y CE+ N     R +   L+S       T+ P +    F    EPL   +   V    + A   ++  +    +    S P +    +N +       VS+ D G+Y            +KT   I E+   P F          +G  + ++      +  +P  + W ++   L  ++    +++++   L  +I +   +H G Y+C  SN  G      +L+A E   S    I    KP+S   ++        G+S   +          V W KDN+ +              P ++I         LK+      DSG Y       V K+    Q ++ E  P +F   I+    S  AKQ  SI + C ++  P    + W    ++      L  + +Y M    +N +        L  +  +  D G+Y     N  G +S    + V         K  P F QK    + +     VI++C++SG P   + W+K+ +++  S   KI        L I N +  D G Y  +A+N  GS+   C ++  +P   V    + +  +  P+    +  E +QP                +N  IS           SP+ +Q                      ++   TIV  P P  VTT        G+   L+C + G PE    W+       +  R  +    +   L + + +  D G Y+   EN  G ++C+  V        H  DR   PS  + L  +  S  +   +  E RV  ++P   GW
Sbjct: 7030 VTWKKDGVSITPS------ERCNIVTTEKTCILEILSSTKGDAGHYSCEIEN--EAGRDACDALVS-------TLEPPY----FVTELEPLEASVGDSVSLQCQVAGTPEITVSWFKGDTKLRSTPEYRTYFTNNVATLVFNKVSINDSGEYTCMAENSIGTAASKTIFRIQERQLPPSFARQLKDIEQTVGLPVTLTC---RLNGSAPIQVCWYRDGVLLRDDENLQMSFVDNVATL--KILQTDLSHSGQYSCSASNPLGTASSTARLTAREPKKSPFFDI----KPVSIDVIA--------GESADFECHVTGAQPMRVTWSKDNKEIRPGGNYTITCVGNTPHLRI---------LKVGKG---DSGQYTCQATNDVGKDMCSAQLSVKE--PPKF---IKKLDASKVAKQGESIQLECKISGSPEIKVV-WFRNDSE------LHESWKYNMSF--VNSVA------LLTINEASAEDTGDYICEAHNGVGDASCSTALKV---------KAPPVFTQK-PPPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDTCACTVKFKEPPRFVKKLSDASTLIGDPVELQAV-VEGFQPISVVWLKDKGEVIRESENVRISFVDNIATLQLGSPEASQSGKYVCQIKNDAGMRECSAVLTVLEPATIVEKPEPMTVTT--------GNPFTLECVVAGTPELSAKWFKDGRELSSGSRHHITFVRNLASLKIPSAEMNDKGLYTFEVENRVGKSSCTVSV--------HVSDRVVPPSFVRRL--KDTSATLGASVVLECRVSGSAPISVGW 7787          

HSP 17 Score: 65.855 bits (159), Expect = 8.064e-10
Identity = 45/138 (32.61%), Postives = 64/138 (46.38%), Query Frame = 3
Query: 3897 ELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVG-ETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV 4307
            +L  ++VTT D  EY +   N  G  S    +TV            P F ++L         + V    +VSG P P LKW K+G+ LS   H++I   G + + L I++    D G Y   A+NT GS   + HLQV
Sbjct: 33662 QLTINSVTTDDDAEYTVVARNKHGEDSCKAKLTVTLHPPPTETTLRPMF-KRLLANAECHEGQSVCFEIRVSGIPAPTLKWEKDGQPLSLGPHIEIVHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 33798          

HSP 18 Score: 65.4698 bits (158), Expect = 9.616e-10
Identity = 116/512 (22.66%), Postives = 183/512 (35.74%), Query Frame = 3
Query: 3276 GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-----VLKETGQTQTTIVE-INPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWSIKPADGSPTRN----LVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVID--PIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNT--HFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSID 4766
            G Y+C  +N  G        S A+ +++     P    P++        +   VG+S  L+          V W KDN+ + S     QI Y E S   L I      DSG Y       V K++   Q  I E + P  F    +   +++   +  S  +   V  S P   ++ W     +  PT N      NNA                  + L     + +D G Y  +  N AG +     I +      +  K  P F Q L   + +   + V + C V G+    ++W+K G E+  SD         T  L +K   K+D+G Y  +ASN  GS+ SKC + + +            ++  + F                +S PQ  +++   T          TF   I K G D          P P + W+           R  + ++ DE  L +++  K DSG Y   A N  G    +  + VD   K   I+
Sbjct: 9138 GQYSCTATNPIGS-----ASSGAKLILTEGKNPPFFDIPLAP-------MDAVVGESADLECHVTGTQPIKVTWAKDNREIRSGG-NYQISYLENS-AHLTIVKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFT---KKLSETVEETEGNSFKLEGRVAGSQPI--TVAWYKNNVEIHPTSNCEIMFKNNA------------------LLLQVKRASMADAGLYTCKATNDAGSALCTSSIVI------KEPKKPPVFDQHL-APVTASEGDSVQLSCHVQGSEPIRIQWLKAGREVKPSDRCSFSFASGTAMLELKETAKADSGDYVCKASNVAGSDTSKCKVTIKEKPAAAPAAKKAAVDGKLFF----------------VSEPQSIRVVEKTT---------ATF---IAKVGGD----------PIPNVKWTKGKWRQLNQGGRILIHQKGDEAKLEIRDTTKTDSGLYRCVAFNKHGEIESNVNLQVDERKKQEKIE 9567          

HSP 19 Score: 63.5438 bits (153), Expect = 4.135e-9
Identity = 111/542 (20.48%), Postives = 187/542 (34.50%), Query Frame = 3
Query: 3276 GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKC---------SLKINGATVNDSGTYQA-VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTE--------RYQPA------DDNSDISSPQRTQMIFSNT----------------------------------IVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSA 4724
            G+Y C+ SN+ G+     +L+  E            A P+   ++    V  ++G   K   E     +    W K  +         +IY  E  KC         SL+I    V D G Y      E G    T        + P     P+++      +   +C V+  P    I W    A  SP+              P  ++T    +  L   N+T  D G Y  +  N  G       +T+            P FI++L+  + S IN+K+ + C+V  +    + W K+G++L      KI    +   L I   K  D+G Y   ASN  GS  S   + V +P   V    P     S+ ++P E        +  P        +N ++S     +M F N+                                  +++ PP F+ T     +  G + +L+C + G  P  + W+       ++ ++ +  +    +L + +    D G Y     N  G   C A
Sbjct: 4442 GEYVCEASNDSGKAKTSAKLTVGE-----------RAAPVIKRRIEPLEV--ALGHLAKFTCEIQGAPNVRFQWFKAGR---------EIY--ESDKCSIRSSNYVSSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKALTTFVGKAAKFLCTVSGTPVIEII-WQKDGAALSPS--------------PDCRVTDADNKHSLELSNLTVQDRGIYSCKASNKFGADICQAELTII---------DKPHFIKELEA-VQSAINKKIHLECQVDEDRKVTITWSKDGQKLPAGKDYKIYFEDKIASLEIPLAKLKDSGTYTCTASNEAGSSSSSAAVAVREPPSFVKKVDP-----SYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMSFVNSEAILDITDVKVDDSGTYSCEATNDVGSDSCSTEVVIKEPPSFIKTLEPADIVRGANALLQCEIAGTGPFEVNWFKDKKQIRSSKKYRLFTQKTFVYLEISSFNSADVGDYECVVANEVGKCGCVA 4929          

HSP 20 Score: 63.1586 bits (152), Expect = 4.650e-9
Identity = 38/139 (27.34%), Postives = 66/139 (47.48%), Query Frame = 3
Query: 3891 RIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV 4307
            R  L    VT ++ G Y LR  N +G ++    + V A      +   P F Q+L    +     +V ++ +V+G P P++K+ ++G E+  S   +I + G+ + L+I      D+G Y   A+N+ G   S   L V
Sbjct:   62 RARLMIPAVTKANSGRYSLRATNGSGQATSTAELLVTA------ETAPPNFSQRLQSMTVRQ-GSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELVV 193          

HSP 21 Score: 63.1586 bits (152), Expect = 5.273e-9
Identity = 81/383 (21.15%), Postives = 139/383 (36.29%), Query Frame = 3
Query: 3657 VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQN----------KKTSPKFIQKLDKEIISP-------INEKVIVRCKVSGNPNPILKWMKNGEELSESDHLK---IRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRE-LDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVD 4739
            V++  I+  PV      +I  ++ G +  VC + +Y     + W          R L N+ +Y+        +T       +Y  ++T  D G Y  +V N  G  S    + V  + E  +          ++T    + +   E   P       + E V     ++ +P P + W K+G+++   D  K          ++L I +    D   Y   A N +G +  K  L V            L  P      PTE                       T +R  P F     +    EG  V  +  + G P P + W  +   ++  P  E+  E LD Y L +++    D+G Y +TA N++G  +C A + V+
Sbjct: 33474 VKVASIEIGPVSGQIMHAI-GEEGGYVKYVCKIENYDQSTQVTWYFG------VRQLENSEKYE--------ITYEDGVATMYVKDITKFDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTKKVKRRTDAMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPRVTWYKSGQKIKPGDDEKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKHGEDSCKAKLTVT-----------LHPP------PTE-----------------------TTLR--PMFKRLLANAECHEGQSVCFEIRVSGIPAPTLKWEKDGQPLSLGPHIEIVHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVE 33799          

HSP 22 Score: 62.7734 bits (151), Expect = 6.613e-9
Identity = 68/282 (24.11%), Postives = 100/282 (35.46%), Query Frame = 3
Query: 3900 LYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSA-LVIVD 4739
            L  + V T D GEY     N +G +     +TV        ++ +P   ++++   ++ +       C++ G PN   +W K G E+ ESD   IR       L I   +  D G Y  +ASN  GS      L V                       TE Y P                       S P+ +TTF  +  K        C + G P   +IW         +P   +    +++ L L N+   D G YS  A N  G   C A L I+D
Sbjct: 4431 LVIEAVKTEDEGEYVCEASNDSGKAKTSAKLTVG-------ERAAPVIKRRIEPLEVA-LGHLAKFTCEIQGAPNVRFQWFKAGREIYESDKCSIRSSNYVSSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTV-----------------------TEAYPPT--------------------FLSRPKALTTFVGKAAK------FLCTVSGTPVIEIIWQKDGAALSPSPDCRVTDADNKHSLELSNLTVQDRGIYSCKASNKFGADICQAELTIID 4655          

HSP 23 Score: 62.3882 bits (150), Expect = 8.292e-9
Identity = 77/309 (24.92%), Postives = 129/309 (41.75%), Query Frame = 3
Query: 3924 SDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIK--NCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSP------------QRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCL--IGYPEPLIWWSYNTHFINNP-RFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPL 4799
            SD GE+ +  +N AG S++ + +TV    EA   +  P F++KL K +      ++ ++ + +GNPNP + W+KN + +    + +IR  G   E  +K  +    D+  Y A A N  G + ++C + V      V   +P  +P    IIP   Y+      +I++P            Q  +    +   +  P F    T   +K       +C L  IG P  ++ W ++   +    R  M  E     L        DSG  +  A N  G    SA +IV   ++   ++ SQ P   K L
Sbjct: 1529 SDSGEWTVVAQNRAGKSTISVTLTV----EAVEHQIKPAFVEKL-KNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPRIRIEGTRGEAALKIDSIISQDSAWYTATAINKAGRDTTRCKVNV-----EVEFAEP--EPERKLIIPRGTYR----AKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGAAYSRDSGVITCRATNKYGTDHTSATLIV--KDEKSLVEESQLPDGKKGL 1819          

HSP 24 Score: 62.3882 bits (150), Expect = 8.942e-9
Identity = 64/250 (25.60%), Postives = 101/250 (40.40%), Query Frame = 3
Query: 4011 EAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNT------TKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEP-LIWWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +++ +  +P FI+++    IS + +   +   V+G P P ++W  NG  L+ S   K    G+TH L+I   +  D G Y   ASN  G  V   HL+ I P G  +T       K LEKP                      P              PP F           G   V +  + G P P ++W+  +     +  + +    D     I+ + Q+GDSG Y   A+N  G +TC+A ++V
Sbjct: 3626 DSRQEGAAPVFIREISDVEIS-VEDVAKLSVTVTGCPKPKIQWFFNGMLLTPSADYKFVFDGDTHSLIILFTRFQDEGEYTCLASNEYGKAVCSAHLR-ISPRGERSTEMESGEKKALEKP--------------------KGP-------------CPPYFFKELKPVHCGPGIPAVFEYSVHGEPAPTVLWFKEDMPLYTSVCYTIIHSPDGSGTFIVNDPQRGDSGLYLCKAQNLWGESTCAAELLV 3840          

HSP 25 Score: 62.3882 bits (150), Expect = 9.483e-9
Identity = 156/795 (19.62%), Postives = 290/795 (36.48%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEI--NPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPAD----------------------------------------------DNSDISSPQ--RTQMIFSNTIV-----RSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPL-IWWSYNTHFINNPRFEMKRELDEYF---------LILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            + ++W+K +  ++      I L+        ++ +       +G Y C V N       S+     +F ++  T + + ++ +    + P+ L+    G      S  + N  P++    +C  +    + +++    ++  +D  QY   +   + +D+ +  + + E P F+       + +G+ + +   +    ++    I W K  T L +       + N+   LV  I K   + VG+YTC+  N  G       ++++  L+  +  +P    P  + +L D + T  +G  +  +          V W KD + L   D  +Q+ +      +L+I     +  G Y         T ++  ++  +  +  P     P S+      S +  C V        I W+         R +     YKM       L  N   + +    V   D G+Y     N AG  S    + V         +  P+FI+KLD+  I   +E     CK+ G+P   + W K+  E+ ES   ++        L + +    D+G Y  +A N  GS  S   L+V +P   V   KP          P E  + AD                                              D +DI   Q   T  + S+T V     ++PPQFV   TD     G +V L+  + G  EP+ + W  +       + E+ RE D  +         L     +  ++G+Y+   +N +G+  C A + V
Sbjct: 7876 FKVKWFKGSRELVSGEACTISLE----DFVTELELLEVEPGQSGDYSCLVTNDAG----SASCTTHLFVKEPATFVKRLADTSVETGS-PIVLEATYSGTPPISVS-WMKNEYPLS-QSPNCGITTTEKSSILEILESTI--EDYAQYACLIENEAGQDICEALVSVLEPPYFIEPLEHVEAAIGEPITLQCKVDGTPEIR---ISWYKEHTKLRSAPAYKMQFKNNVASLV--INKVDHSDVGEYTCKAENSVG------AVASSAVLVIKERKLP----PSFARKLKDVHET--LGFPVAFECRINGSEPLQVSWYKDGELLKD-DANLQMSFVHHV-ATLQILQTDQSHVGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGSFKCHVTGTAPIK-ITWA------KDNREIRPGGNYKMT------LVENTATLTVL--KVAKGDAGQYTCYASNVAGKDSCSAQLGV---------QEPPRFIKKLDQSRIVKQDEYTRYECKIGGSPEIKVLWYKDEVEIQESSKFRMSFEDSVAILEMHSLSVEDSGDYTCEARNAAGSASSSTSLKVKEP--PVFRKKPF---------PVETLKGADVHLECELQGTPPFQVSWHKDKRELRSGKKYKIMSENLLTSIHILNVDTADIGEYQCKATNDVGSDTCVGSVTMKAPPQFVKKLTDISTIIGKEVQLQTTIEGA-EPISVAWFKD-------KGEIVRESDNIWISYSENIATLQFSRAEPANAGKYTCQIKNDAGMQECYATLSV 8595          

HSP 26 Score: 61.2326 bits (147), Expect = 1.854e-8
Identity = 54/251 (21.51%), Postives = 104/251 (41.43%), Query Frame = 3
Query: 3993 TVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFT-IIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWW-SYNTHFINNPRFEMK--RELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVI 4733
            T    A A+   T P  +  L K +     E V + C +SG P+P + W +   ++  S   +I   G    L+I+     D+G +   A N  G+  + C+L       +V  ++  +K  + T    TE  +  +    + +        +     + P F++    + + EG  VV +C + G P+P ++W           R+++   ++  E  L++      D+G Y+I   N  G  + SA ++
Sbjct:  932 TARVPAPAEVPVTPPTLVSGL-KNVTVIEGESVTLECHISGYPSPKVTWYREDYQIESSIDFQITFQGGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYL-------AVQVSEEFDKETTLTEKFATEEKRFVESRDVVMTDTSITEEQAGPGEPAAPFFISKPVVQKLVEGGSVVFECQIGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECRLVISMTFADDAGEYTIVIRNKHGETSASASLL 1174          

HSP 27 Score: 57.7658 bits (138), Expect = 2.331e-7
Identity = 88/432 (20.37%), Postives = 155/432 (35.88%), Query Frame = 3
Query: 3489 VVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKV-SGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSI-DRSQY 4778
            V W+KD Q L   D RI+I   E+    L I    ++D+G Y  V      T    VE   ++   + ++    +  KQ   +      +   +    +W     DG      V      ++ + ++++         +      SD GEY       AG +   + + V       N    P+ +Q+L    +   + K    C V SG P P + W K  + LS     K    G+ + L++      DA +Y  +A N  G   +   L V  P                               ++ SP +   ++       PP  VT   D +  EG     +C + G    + W+  +     +  F M +  D Y L +      D G Y+  A N+ G  + +A + ++  +K+  +  +SQ+
Sbjct: 3094 VQWMKDGQELQIAD-RIKIQK-EKYVHRLLIPSTRMSDAGKYTVVAGGNMSTANLFVEGRDVRIRSIKKEV--QVIEKQRAVVEFEVNEDDVDA----HWY---KDGIEINFQVQERHQYVVERRIHRM---------FISETRHSDAGEYTF----VAGRNRSSVTLYV-------NAPEPPQVLQELQPVTVQ--SGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVP-------------------------------EVVSPDQEMPVY-------PPAIVTPLQDTVTSEGRPARFQCQVSGTDLKVSWYCKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYAFVANNAVGQVSSTATLRLEGFSKSEEVTSKSQW 3454          

HSP 28 Score: 56.6102 bits (135), Expect = 5.257e-7
Identity = 49/158 (31.01%), Postives = 64/158 (40.51%), Query Frame = 3
Query: 3906 FDNVTTS--DGGEYCLRV--EN--SAGWSSVMIPITVAALAEAQNKKTSP------KFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVID----PIGSVN 4331
             D V T    G  Y  RV  EN    G     IPI      E Q K   P      K I+ L  +  + +    I+R    G P P  KW  +G E+   DH  +     +  L IKNC + D G Y+   SN  G++    HL V+D    P G +N
Sbjct: 19379 LDCVVTGLQQGKTYRFRVKAENIIGLGLPDTTIPI------ECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIR----GVPVPTAKWTTDGTEIKTDDHYTVETDSFSSVLTIKNCLRKDTGEYQLTVSNAAGTKTVAVHLTVLDVPGPPTGPIN 19526          

HSP 29 Score: 54.6842 bits (130), Expect = 1.927e-6
Identity = 63/286 (22.03%), Postives = 112/286 (39.16%), Query Frame = 3
Query: 3927 DGGEYCLRV--ENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKE------GDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYF--LILKNIQ-KGDSGRYSITAENSSGLATCSALVIVDSHNK 4751
            +  EY  RV  EN  G S    P   A   + +        ++K   ++ + + E   + C++ G P P +KW + G+EL +S   K+   G TH L +   ++ D G+Y   A+N                +G V ++                                    S  ++++ PQF   +    +KE      G  + L    IG P P + W +    + N   ++  E  E++  L++KN+Q K  +G+Y +   N+ G  T  A + V+  +K
Sbjct: 32411 EATEYEFRVFAENETGLSR---PRRTAMSVKTKLTSGEAPGVRKEMADVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTDEQEDEGVYTCVATNE---------------VGEVESS------------------------------------SKLLLQAAPQFHPGYP---LKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSE-KITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNAFG--TVDATLDVEIQDK 32636          

HSP 30 Score: 53.9138 bits (128), Expect = 3.324e-6
Identity = 52/187 (27.81%), Postives = 79/187 (42.25%), Query Frame = 3
Query: 3894 IELYFDNVTTSDGGEYCLRV--ENSAGW----SSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPA------DDNSDIS 4418
            IE  F     ++   Y  RV  +N+AG     S    PIT     E       PKF       I+    E   +   V G P P ++W++  +E+ ES   +I+       L++K+  + D G Y  +ASN  GS+    +++V+D  G      P E P+  T +  E+   A      D  SDIS
Sbjct: 25490 IETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKF----RDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPG------PPEGPVQVTGVTAEKCTLAWSPPLQDGGSDIS 25666          

HSP 31 Score: 52.7582 bits (125), Expect = 6.180e-6
Identity = 35/144 (24.31%), Postives = 59/144 (40.97%), Query Frame = 3
Query: 3897 ELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQ--KLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG 4322
            E YF+    ++   Y  RV       SV  P         ++   +P+ +   K    II    E + +   ++G P P++ W K+G E+ E    +I     T  L +K+C + D G Y     N  G+     + +V+D  G
Sbjct: 27655 ETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPITVKDDVEAPRIMMDVKFRDVIIVKAGEVLKINADIAGRPLPVISWAKDGVEIEERAKTEIVSTDYTTTLTVKDCVRRDTGQYVLTLKNVAGTRTMAVNCKVLDKPG 27798          

HSP 32 Score: 52.7582 bits (125), Expect = 6.232e-6
Identity = 36/133 (27.07%), Postives = 62/133 (46.62%), Query Frame = 3
Query: 3990 ITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESD-HLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTER 4385
            IT     +A N    PK+       II    E  ++   + G P P + W K+G EL E+   ++I+   +   L++K+C ++D G Y  + SN  G++     ++V+D  G      P E P+  T +  E+
Sbjct: 26610 ITARDEIDAPNASLDPKY----RDVIIVHAGETFVLEADIRGKPIPDIIWSKDGNELEETAARMEIKSTLQKTTLIVKDCIRTDGGQYTLKLSNVGGTKTIPITVKVLDRPG------PPEGPLKVTGVTAEK 26732          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Mouse
Match: Ttn (titin [Source:MGI Symbol;Acc:MGI:98864])

HSP 1 Score: 124.405 bits (311), Expect = 1.637e-27
Identity = 174/773 (22.51%), Postives = 304/773 (39.33%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVAKTH---LEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTY--INDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE----KPISFT-------------------IIPTERYQPADDNS---------DISSPQRTQMIFSN----------TIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYN-THFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            I W KDN  I P  + ++ L  N+ +    + +    + DAGQY C   N     + S    L V  Q+    I K  +       E    +  + G   +PE  +++    + +  SS  +     + +      S+S++D G Y     +   + +    L++ E P F    F   +L G  + +   ++      P  + W K+K  L     S K Y  +++N      I     A +G+Y C+ +N+ G D            + S T+    A P    +L+D  ++  +G  ++L           V W KD   +      I I Y  E+  +L+ + A   ++G Y   +K     Q     ++ ++ A +++  P+SI+     +  + C V+  P   S  W     DG   + L ++ +YK+     NK++G      L   NV   D G Y   V+N  G  S  + I V+      ++   P F +KL KE        V++ CKV G+P   + W  +G E+S     +      T  L +   +++DAG Y   A+N  GS+     L V +P   V    P++      ++FT                   ++P  R   +  +S         D S       I SN            V++P  FV    D  +++G  ++L+    G P   + W  N  + I + R  +        L + +    DSG+Y+   EN+SG  +CSA +++
Sbjct: 7237 ITWAKDNREIRPGGNYKMTLVENTAT----LTVLKVAKGDAGQYTCYASNVAG--KDSCSAQLGV--QEPPRFIKKLDQSRIVKQDEYTRYECKIGG---SPEIKVLWYKDEVEIQESS-KFRMSFEDSVAILEMHSLSVEDSGDYTCEARNAAGSASSSTSLKVKEPPVFRKKPFPVETLKGADVHLECELQG---TPPFQVSWHKDKRELR----SGKKYKIMSENLLTSIHILNVDTADIGEYQCKATNDVGSD----------TCVGSVTM---KAPPQFVKKLTD--ISTIIGKEVQLQTTIEGAEPISVAWFKDKGEIVRESDNIWISY-SENIATLQFSRAEPANAGKYTCQIKNDAGMQECYATLSVLEPAAIVEK-PESIKVTTGDTCTLECTVSGTPEL-STKWF---KDG---KELTSDNKYKI--SFFNKVSG------LKIINVVPGDSGVYSFEVQNPVGKDSCKVSIQVS------DRIIPPSFTRKL-KETNGLSGSSVVMECKVYGSPPISVLWFHDGNEISSGRKYQTTLTDNTCALTVNMLEEADAGDYTCIATNVAGSDECSAPLTVREPPSFVQKPDPMDVLTGSNVTFTSIVKGSPPFTVSWFKGSTELVPGARCNVSLQDSVGELELFDVDTSQSGEYTCIVSNEAGRASCTTRLFVKAPAIFVKRLNDYSIEKGKPLILEGTFSGTPPISVTWKKNGINVIASQRCNITTTEKSAILEILSSTVEDSGQYNCYIENASGKDSCSAQILI 7951          

HSP 2 Score: 92.8189 bits (229), Expect = 5.032e-18
Identity = 163/762 (21.39%), Postives = 290/762 (38.06%), Query Frame = 3
Query: 2652 MHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLS---VFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHK-TYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQ-AVLKETGQTQTTIV-----EINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG--------SVNTTKPL--------EKPISFTIIPTERYQPADDNSDISSPQRTQM--IFSNTI------------------------VRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDR 4769
            + I+     D G Y CE  NG      S+ + +    VF+QK   V         A     + L+  + G    P  ++++      V  SS  +   S N     +  ++   D+G+Y  + +++   D     ++  E P FV      ++L+GD + +   ++ F    P +++W K+K  +     + + +++++   L    P+ +Q+  G Y CQ+ N+ G      + SA   ++   T++    KP          +T + G+   L+            W KD + L+S   R  I +   +  SLKI  A +ND G Y   V    G++  T+       + P  F   ++D   ++ A    S+ + C V+      S+ W +   DG+           ++I+ P  + +       L   ++  SD G Y     N AG       +TV         +  P F Q  D   + P    +     + G P   +KW K   EL   +   I       EL +   +   +G Y    +N  GS     HL V +P          SV T  P+          PIS + +  E       N  I++ +++ +  I  +TI                        V  PP F+          G+ + L+C + G PE  I W+  +T   + P ++M+ + +   L++  +   D G Y+  AENS G    SA++++       S  R
Sbjct: 6416 LTINEASAEDTGDYICEAHNGVGDASCSTALKVKAPPVFTQKPPPV--------GALKGSDVILQCEISG---TPPFEVVWVKDRKQV-RSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDTCACTVKFKEPPRFVKKLSDASTLIGDPVELQAVVEGFQ---PISVVWLKDKGEVIRESENVRISFVDNIATLQLGSPEASQS--GKYVCQIKNDAG----MRECSAVLTVLEPATIV---EKP--------EPMTVTTGNPFTLECVVAGTPELSAKWFKDGRELSSGS-RHHITF-VRNLASLKIPSAEMNDKGLYTFEVENRVGKSSCTVSVHVSDRVVPPSFVRRLKDTSATLGA----SVVLECRVSGSAPI-SVGWFL---DGN-----------EIISSPKCQSSFADNVCTLTLSSLEPSDTGAYTCVAANVAGQDESSAVLTV---------QEPPSFEQTPDSVEVLP-GMSLTFTSVIRGTPPFKVKWFKGSRELVSGEACTISLEDFVTELELLEVEPGQSGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADTSVETGSPIVLEATYSGTPPISVSWMKNEYPLSQSPNCGITTTEKSSILEILESTIEDYAQYACLIENEAGQDICEALVSVLEPPYFIEPLEHVEAAIGEPITLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYTCKAENSVGAVASSAVLVIKERKLPPSFAR 7114          

HSP 3 Score: 91.6633 bits (226), Expect = 1.174e-17
Identity = 112/501 (22.36%), Postives = 189/501 (37.72%), Query Frame = 3
Query: 3237 LVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +  EI  F  A VGDY C V+NE G    K    A   L    T +          +  D++ T   G ++ L           V+W+K  Q +   D +I++ +       L I    ++  G Y  + +    +QT++ E+   + A +I+   + I+        +   V+  P        +KP      R LV + +Y++          N+ +++ Y  +    D G+Y   + N  G SS     TV       ++  +P F + L + + S +     + CK++G+    + W K+G+EL+ SD  +I  V  T  L I     +DAG +  +A+N+ GS+ S   L V +P                                                   P FVT      V  G  V LK    G  P  + W+  +   ++     + +E  E  L L  ++  DSG Y+    N +G   CSA + V
Sbjct: 3892 VYLEISSFNSADVGDYECVVANEVG----KCGCVATHLLKEPPTFV----------KKVDDF-TALAGQTVTLQAAVRGSEPISVMWMK-GQEVIKEDGKIKMSF-SNGVAVLTIPDVQISLGGKYTCLAENEAGSQTSVGELIVKEPAKIIERA-ELIQVTAGDPATLEYTVSGTPE-------LKPKWYKDGRPLVASKKYRI------SFKNNIAQLKFY--SAELHDSGQYTFEISNEVGSSSCETTFTVL------DRDIAPLFTKPL-RNVDSVVGGACRLDCKIAGSLPMRVSWFKDGKELTASDRYQIAFVEGTASLEISRVDMNDAGNFTCRATNSVGSKDSSGALIVQEP---------------------------------------------------PSFVTKPGSRDVLPGSAVCLKSAFQGSAPLTIKWFKGDKELVSGGSCYITKETSESSLELYAVKTSDSGTYTCKVSNVAGSVECSADLFV 4301          

HSP 4 Score: 90.5077 bits (223), Expect = 2.539e-17
Identity = 177/796 (22.24%), Postives = 302/796 (37.94%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVN-HSSCPWSKVSSNEMIQFNHRS-------VSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELV-FEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDF---------PQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVI-VRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQ-----------------------PA-------DDNS----------------------DISSPQRTQMIFSNTIVRSPPQFVTTFTDEIV-KEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLI-LKNIQKGDSGRYSITAENSSGLATCS 4721
            I+W+K ++ ++      I  + +  S    + +   + SD+G Y C+V N    +  S+     +F ++  T I K          EP  L    DG + A +   +    PI +   ++    + SS   + F   +       V+++D G+Y+      +  D     + + E P F   +FK   +L +   +   +       P  I W K+ T L + +  +KT++ D  +LV  ++ KF  A  G+Y C+V+NE G      +++  E         P   K I ++       +   G +          +   V WLKDN  + + D  I++ + E +  SL ++G  V   G Y    K     Q     ++  + A ++++          P +++ K +G+  I           S  W     DG   + L    +YK+       +T  +  +++   +    D GEY   V+N  G SS    I V  L         P F +KL K  +  I    I + C V+G+    ++W K+ +E+S SD  K      T  L I   + +D+G Y   A+N  G      HL V +P   V      EKP S  + P  R Q                       P        DD S                      D+ +      IF    V+ PPQF+   +  +V + G     +C + G PE  + W  + + I + R      +D      + N +  +SG Y   A N +G A+CS
Sbjct: 4243 IKWFKGDKELVSGGSCYITKETSESS----LELYAVKTSDSGTYTCKVSNVAGSVECSA----DLFVKEPATFIEKL---------EPSQLLKKGDGTQLACK---VTGTPPIKITWFANDRELRESSKHKMSFAESTAVLRLTDVAIEDSGEYMCEAQNEAGSDHCTGIVIVKESPYFT-KEFKSIEVLKEYDVML--LAEVAGTPPFEITWFKDNTTLRSGR-KYKTFLQD--QLVSLQVLKFVAADAGEYQCRVTNEVGSSTCSARVTLREP--------PSFIKKIEAT-------SSLRGGTAAFQATLKGSLPITVTWLKDNDEI-TEDDNIRMTF-ENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATIMEEAVSIDVTQGDPATLQVKFSGTKEI-----------SAKWF---KDG---QELTLGPKYKI------SVTDTVSILKII--STEKKDSGEYTFEVQNDVGRSSCKASINVLDLI------IPPSFTKKLRK--MDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASDKHKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHSQCSGHLTVKEPPYFV------EKPQSQDVNPGTRVQLKALVGGTAPMTIKWFKDNKELHPGAARSVWKDDTSTILELFSAKAADSGTYICQLSNDVGTTSSKATIF----VKEPPQFIKKPSPVLVLRNGQSTTFECQVTGTPEIRVSWYLDGNEITDLRKYGISFVDGLATFQISNARVENSGTYVCEARNDAGTASCS 4952          

HSP 5 Score: 87.8113 bits (216), Expect = 1.515e-16
Identity = 178/733 (24.28%), Postives = 281/733 (38.34%), Query Frame = 3
Query: 2565 QWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYA--PESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLF---RVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVL-----KETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFT--DEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSA 4724
            +W+KD + +  D   +I    N  SG   + I N    D+G Y  EV+N   V + S  V + V  +    + P F+ K    N    S  +V++   Y   P S L F++   N   S   +    ++         +   D G Y      V+  D     L + E P FV      + L G ++  +  +K      P T+ W K  T L      + +  +  GEL  E+     +  G+YTC VSNE G               S  T + V A  I   +L+D  +    G  + L+  F       V W K+   + +   R  I   E+S   L+I  +TV DSG Y   +     K++   Q  I+E  P  F   ++     ++     S ++ C +   P    ++W        PT      A  KM  K  N +        L F  V +SD GEY  R ENS G  S    +TV      Q +K  P F ++L +++   +   V+  C VSG+    + W K+G+ L +S +++   +     L I    +S +G Y   A+N               PIGS ++   L        I TE                          ++PP F       D +V E  D  L+C + G  P  + W   N    +   +++    +   L +  + KGDSG+Y+  A N  G  +C+A
Sbjct: 7612 KWFKDGKELTSDNKYKISF-FNKVSG---LKIINVVPGDSGVYSFEVQN--PVGKDSCKVSIQVSDR---IIPPSFTRKLKETNGLSGS-SVVMECKVYGSPPISVLWFHDG--NEISSGRKYQTTLTDNTCALTVNMLEEADAGDYTCIATNVAGSDECSAPLTVREPPSFVQKPDPMDVLTGSNVTFTSIVKG---SPPFTVSWFKGSTELVPGARCNVSLQDSVGEL--ELFDVDTSQSGEYTCIVSNEAGR-------------ASCTTRLFVKAPAIFVKRLNDYSI--EKGKPLILEGTFSGTPPISVTWKKNGINVIASQ-RCNITTTEKSAI-LEILSSTVEDSGQYNCYIENASGKDSCSAQILILE--PPYFVKQLE----PVKVTVGDSASLQCQLAGTPEI-GVSWYKGDTKLRPT------ATCKMHFK--NNVA------TLVFTQVDSSDSGEYICRAENSVGEVSSSTFLTV------QEQKLPPSFSRQL-RDVQETVGLPVVFECAVSGSEPISVSWYKDGKPLKDSPNIQTSFLDNIATLNIFKTDRSLSGQYSCTATN---------------PIGSASSGAKL--------ILTEG-------------------------KNPPFFDIPLAPMDAVVGESAD--LECHVTGTQPIKVTWAKDNREIRSGGNYQISYLENSAHLTIVKVDKGDSGQYTCYAVNEVGKDSCTA 8232          

HSP 6 Score: 86.6557 bits (213), Expect = 3.876e-16
Identity = 172/767 (22.43%), Postives = 275/767 (35.85%), Query Frame = 3
Query: 2649 KMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFS------------EKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQ--FAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWS-----IKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKP------------LEKPISFT-------------IIPTERYQPADDNSDIS-------SP-------QRTQMIFSNTIV-----RSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFIN---NPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            ++ + N   S +G+Y C V N        +     +F ++  T + K S            E T+   T P+S+    DG    P          I     +C    +SS +            D G Y   +   + +D     +   E P FV       + +GDS+++   +    ++   T+ W K  T L +       + N+   LVF   K +    G+YTC   N  G    K         I  + L P  A+     QL D  +  +VG  + L           V W +D   L   D  +Q+ +  ++  +LKI    ++ SG Y         T ++   +   +   +P     P SI      S +  C V  + P    + WS     I+P  G+ T   V N  +  I K                  V   D G+Y  +  N  G       ++V         K  PKFI+KLD   ++   E + + CK+SG+P   + W +N  EL ES    +  V     L I      D G Y  +A N  G       L+V  P   V T KP            L+  IS T             +  +++++    N D S       +P       + T  + S+T       + PP+FV   +D     GD V L+  + G+ P  ++W       I    N R      +    L L + +   SG+Y    +N +G+  CSA++ V
Sbjct: 5943 ELELFNIDISQSGEYTCVVSNNAG----QASCTTRLFVKEPATFVKKLSDHSVEPGKSIILEGTYTG-TLPISVTWKKDGVSITPS-----ERCNIVTTEKTCILEILSSTK-----------GDAGHYSCEIENEAGRDACDALVSTLEPPYFVTELEPLEASVGDSVSLQCQVAGTPEI---TVSWFKGDTKLRSTPEYRTYFTNNVATLVFN--KVSINDSGEYTCMAENSIGTAASKTIFR-----IQERQLPPSFAR-----QLKD--IEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRD-DENLQMSF-VDNVATLKILQTDLSHSGQYSCSASNPLGTASSTARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQP--MRVTWSKDNKEIRPG-GNYTITCVGNTPHLRILK------------------VGKGDSGQYTCQATNDVGKDMCSAQLSV---------KEPPKFIKKLDASKVAKQGESIQLECKISGSPEIKVVWFRNDSELHESWKYNMSFVNSVALLTINEASAEDTGDYICEAHNGVGDASCSTALKVKAP--PVFTQKPPPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDTCACTVKFKEPPRFVKKLSDASTLIGDPVELQAVVEGFQPISVVWLKDKGEVIRESENVRISFVDNI--ATLQLGSPEASQSGKYVCQIKNDAGMRECSAVLTV 6635          

HSP 7 Score: 83.1889 bits (204), Expect = 4.879e-15
Identity = 164/772 (21.24%), Postives = 286/772 (37.05%), Query Frame = 3
Query: 2475 LLVNAESSCPTRLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVN--------HSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK----DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPL-NSRDPRIQIYYPEESKCSLKINGATVNDSGTYQ-AVLKETGQT--QTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            L++  ES+   RL   L+  P I      + W+K+N+ +      R+    NS++    + I + +  D+G Y CE  N              V S    T +      +F    EP     ++ G     + + I    P  VN         SS  +   +    +     S +  DVG Y   V+++        THL + E P FV       +L G ++ +   ++      P +++W K +  +  +     ++   NG  V  IP    +  G YTC   NE G      Q S  E ++         AK I  ++L    +  + GD   L+            W KD +PL  S+  RI     + +   LK   A ++DSG Y   +  E G +  +TT   ++    AP+     +++ +   G+  + C +  S P    ++W     DG   + L  + RY++      + T +++        V  +D G +  R  NS G       + V         +  P F+ K     + P    V ++    G+    +KW K  +EL       I K      L +   K SD+G Y  + SN  GS   +C   +            +++P +F     E+ +P+                                 +++K+GD   L C + G P   + W++ +     + + +M        L L ++   DSG Y   A+N +G   C+ +VIV
Sbjct: 3754 LMLPGESA---RLHCKLKGSPVIQ-----VTWFKNNKELSESNTVRMSF-VNSEA---ILDITDVKVDDSGTYSCEATN-------------DVGSDSCSTEVVIKEPPSFIKTLEPAD---IVRGANALLQCE-IAGTGPFEVNWFKDKKQIRSSKKYRLFTQKTFVYLEISSFNSADVGDYECVVANEVGKCGCVATHL-LKEPPTFVKKVDDFTALAGQTVTLQAAVRGSE---PISVMWMKGQEVIKEDGKIKMSF--SNGVAVLTIPDVQISLGGKYTCLAENEAGS-----QTSVGELIVKE------PAKIIERAEL----IQVTAGDPATLEYTVSGTPELKPKWYKDGRPLVASKKYRISF---KNNIAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDR-DIAPLFTKPLRNVDSVVGGACRLDCKIAGSLP--MRVSWF---KDG---KELTASDRYQIA---FVEGTASLE-----ISRVDMNDAGNFTCRATNSVGSKDSSGALIV---------QEPPSFVTKPGSRDVLP-GSAVCLKSAFQGSAPLTIKWFKGDKELVSGGSCYITKETSESSLELYAVKTSDSGTYTCKVSNVAGS--VECSADLF-----------VKEPATF----IEKLEPS---------------------------------QLLKKGDGTQLACKVTGTPPIKITWFANDRELRESSKHKMSFAESTAVLRLTDVAIEDSGEYMCEAQNEAGSDHCTGIVIV 4395          

HSP 8 Score: 82.8037 bits (203), Expect = 5.217e-15
Identity = 122/545 (22.39%), Postives = 202/545 (37.06%), Query Frame = 3
Query: 3255 KFTQAHV---GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSI---NIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVI--------DPIGSVNTTKPLEKPISFTIIPTERYQPA--DDNSDISSPQRTQMIFSNTIV----------------------------------RSPPQFVTTFTDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            KF  A +   G YT ++SNE G    +   +     +  + + P+  KP+ +       V   VG + +LD +    +   V W KD + L + D R QI +  E   SL+I+   +ND+G +           T  V       A ++Q+ P  +    +  +   + VC+ +++    S   +IK   G   + LV+     +  +       +   +ELY   V TSD G Y  +V N AG       + V         K    FI+KL+   +    +   + CKV+G P   + W  N  EL ES   K+     T  L + +    D+G Y  +A N  GS+   C   VI            S+   K  +  +   +  T  ++     DN+ + S ++ +    + +V                                  R PP F+          G     +  L G  P  + W   N     +    M  E +   L L  I+    G+Y   A+N +G+  CSAL+ V
Sbjct: 4081 KFYSAELHDSGQYTFEISNEVGSSSCETTFT-----VLDRDIAPLFTKPLRN-------VDSVVGGACRLDCKIAGSLPMRVSWFKDGKELTASD-RYQIAF-VEGTASLEISRVDMNDAGNFTC-------RATNSVGSKDSSGALIVQEPPSFVTKPGSRDVLPGSAVCLKSAFQG--SAPLTIKWFKGD--KELVSGGSCYITKE------TSESSLELY--AVKTSDSGTYTCKVSNVAGSVECSADLFV---------KEPATFIEKLEPSQLLKKGDGTQLACKVTGTPPIKITWFANDRELRESSKHKMSFAESTAVLRLTDVAIEDSGEYMCEAQNEAGSD--HCTGIVIVKESPYFTKEFKSIEVLKEYDVMLLAEVAGTPPFEITWFKDNTTLRSGRKYKTFLQDQLVSLQVLKFVAADAGEYQCRVTNEVGSSTCSARVTLREPPSFIKKIEATSSLRGGTAAFQATLKGSLPITVTWLKDNDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSV 4581          

HSP 9 Score: 78.1814 bits (191), Expect = 1.468e-13
Identity = 119/542 (21.96%), Postives = 203/542 (37.45%), Query Frame = 3
Query: 3243 FEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN-SRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE------KPISFTIIPTERYQPA--DDNSDISSPQRTQMIFSNTIV----------------------------------RSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
             EI +      G+YTC+ SNE+G       L+  EA   +    P               +T  VG + K           +++W KD   L+ S D R+      ++K SL+++  TV D G Y               E+  I     I++  +++++  N  I++ C V+      +I WS    DG   + L     YK+           +  +E+    +   D G Y     N AG SS    + V         +  P F++K+D   +    E   + CK+ G+P   + W KN +ELSES+ +++  V     L I + K  D+G Y  +A+N  GS+     + + +P   + T +P +        +   I  T  ++     D   I S ++ ++    T V                                  + PP FV    D     G  V L+  + G  P  ++W         + + +M        L + ++Q    G+Y+  AEN +G  T    +IV
Sbjct: 3519 LEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRP-------------KALTTFVGKAAKFLCTVSGTPVIEIIWQKDGAALSPSPDCRVT---DADNKHSLELSNLTVQDRGIYSCKASNKFGADICQAELTIIDKPHFIKEL-EAVQSAINKKIHLECQVDEDRKV-TITWS---KDG---QKLPAGKDYKIY------FEDKIASLEIPLAKL--KDSGTYTCTASNEAGSSSSSAAVAV---------REPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMSFVNSEAILDITDVKVDDSGTYSCEATNDVGSDSCSTEVVIKEPPSFIKTLEPADIVRGANALLQCEIAGTGPFEVNWFKDKKQIRSSKKYRLFTQKTFVYLEISSFNSADVGDYECVVANEVGKCGCVATHLLKEPPTFVKKVDDFTALAGQTVTLQAAVRGSEPISVMWMKGQEVIKEDGKIKMSFSNGVAVLTIPDVQISLGGKYTCLAENEAGSQTSVGELIV 4019          

HSP 10 Score: 77.411 bits (189), Expect = 2.214e-13
Identity = 151/764 (19.76%), Postives = 264/764 (34.55%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNG-------PSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNM-------------PINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYL-----FRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDR 4769
            + + W+KD   +      +I+    S++    +HI N   +D G+Y C+  N         SV  K+ P  +   +     +  +   +T     EP+S+    D  +   ESD I+ +              P N    +C   ++ ++  +Q  + ++S+ +    +      +V++ D       +   PE     FK+   L       I    F+K+S   II                    D+G   FE+    Q  VG  +C+VS +                  S  +IP    P  + +L +    G  G S+ ++ +        V+W  D   ++S   R       ++ C+L +N     D+G Y  +      +      +  ++  P     P  +      ++    +V   P   +++W      GS    LV  AR  +       L  ++  +EL+  +V TS  GEY   V N AG +S    + V A A          F+++L+   I    + +I+    SG P   + W KNG  +  S    I    ++  L I +    D+G Y     N +G +     + +++P                                                   P FV       V  GD   L+C L G PE  + W+  +T        +M  + +   L+   +   DSG Y   AENS G  + S  + V       S  R
Sbjct: 7422 FQVSWHKDKRELRSGKKYKIM----SENLLTSIHILNVDTADIGEYQCKATNDVGSDTCVGSVTMKAPPQFVKKLTDISTIIGKEVQLQTTIEGAEPISVAWFKDKGEIVRESDNIWISYSENIATLQFSRAEPANAGKYTC---QIKNDAGMQECYATLSVLEPAAIVEKPESIKVTTGDTCTLECTVSGTPELSTKWFKDGKELTSDNKYKISF--FNKVSGLKII---------------NVVPGDSGVYSFEV----QNPVGKDSCKVSIQV-----------------SDRIIP----PSFTRKLKET--NGLSGSSVVMECKVYGSPPISVLWFHDGNEISSG--RKYQTTLTDNTCALTVNMLEEADAGDYTCIATNVAGSDECSAPLT-VREPPSFVQKPDPMDVLTGSNVTFTSIVKGSPP-FTVSW----FKGS--TELVPGARCNV------SLQDSVGELELF--DVDTSQSGEYTCIVSNEAGRASCTTRLFVKAPA---------IFVKRLNDYSIEK-GKPLILEGTFSGTPPISVTWKKNGINVIASQRCNITTTEKSAILEILSSTVEDSGQYNCYIENASGKDSCSAQILILEP---------------------------------------------------PYFVKQLEPVKVTVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTATCKMHFKNNVATLVFTQVDSSDSGEYICRAENSVGEVSSSTFLTVQEQKLPPSFSR 8055          

HSP 11 Score: 77.411 bits (189), Expect = 2.388e-13
Identity = 172/801 (21.47%), Postives = 301/801 (37.58%), Query Frame = 3
Query: 2508 RLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLS---VFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHK-TYINDNGELVFEIPKFTQAHVGDYTCQVSNEFG--EDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQ-AVLKETGQTQ-TTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPI--------------------GSVNTTKPLE---KPISFTIIPTERYQPADDNSDISSPQRTQM--IFSNT----------------------IVRS--PPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSAL 4727
            RL+  +   P I      + WY+ NE  L   D   +   +S +    + +++    D+G + CE +N       S+ V++    VFS       P   E     NTE +SL+  L G    P  ++++      +  SS  +   S N     +  +V   D+G+Y  +  ++   D     +++ E P+F+    K NSL   +   +    +     P ++ W K K  +     + + +++N+   L F   K   A+ G Y CQV N+ G  E++  L +     +I                      +T +VG++  L+ +        V W KD + L S       +Y + S  SLKI      D+GTY   V    G++  T +V+++     P    F + ++    G +   C++             K A  SP      + + K+++    + T +     L  +++ +SD G Y     N AG       +TV         +  P F+++ +   + P  + +     + G P   + W +   EL + +   I       EL + N   S +G Y    SN  G       L V +P                     G+   T P+    K    +I P+ER        +I + ++T +  I S+T                      +V +  PP FVT         GD V L+C + G PE  + W+  +T   + P +      +   L+   +   DSG Y+  AENS G A    +
Sbjct: 5436 RLECKITGSPEIQ-----VVWYR-NEHELTASDKYQMTFIDSVA---VIQMNSLGTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSS-----FPPIVETL--KNTE-VSLECELSG---TPPFEVVWYKDKRQL-RSSKKYKVASKNFHASIHILNVESTDIGEYHCKAQNEVGSDACVCAVKLKEPPKFIS---KLNSLTVVAGEPAELQASIEGAQPISVQWLKEKEEVIRESENIRISFVNNVATLQFA--KVEPANAGKYICQVKNDGGVRENMATLTVLEPAVIIEKA-----------------GSMTVTVGETCALECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKIS--SLKILSVEKEDAGTYTFQVQNNVGKSSCTAVVDVSDRMVPP---SFTRRLK-DTGGVLGTSCILEC-----------KVAGSSPISIAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGSYTCVAANVAGSDECRALLTV---------QEPPSFVKEPEPLEVLP-GKNITFTSVIRGTPPFKVGWFRGARELVKGNRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPATFVKKLSDHSVEPGKSIILEGTYTGTLPISVTWKKDGVSITPSER-------CNIVTTEKTCILEILSSTKGDAGHYSCEIENEAGRDACDALVSTLEPPYFVTELEPLEASVGDSVSLQCQVAGTPEITVSWFKGDTKLRSTPEYRTYFTNNVATLVFNKVSINDSGEYTCMAENSIGTAASKTI 6159          

HSP 12 Score: 73.559 bits (179), Expect = 3.768e-12
Identity = 168/830 (20.24%), Postives = 323/830 (38.92%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV------SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSS----DVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIV-EINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRN---LVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDP---IGSVNT-----TKPLE--------KPIS------------------------FTIIPTERYQPADDNSDISSPQRTQMIFSNT---IVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNP---RFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLPPETYSNLVKTHINDESRVMQASP 4871
            I W KD++ IL + D    +  + +     + + +     +G+Y C+ +N   + R  + +L+    Q+   +I K ++       +P++L+ V+ G    PE  + +      +  S   +S    N +  F  +SV  +D GQY F+V      SS D     L+    P F     K + +LG S+ +   +     +S +   W K+   ++T+   ++   ++N  +  E+         +YTC+VSN  G++       A   +++ +       KP     + D+             VEF A +       + WLKD+  L S             KC + + G+T +    Y     +TGQ    +  ++ P +F   ++    S   K   S  + C +   P    + +          RN   L  + +Y+M          ++  I++  +++ T D G++    +N AG +S    + V    E     + P  ++ L        N +V + C++SG P   + W K+  +L  S   K+        + I N + +D G Y  +A N  GS+   C +++ +P   I  +N+      +P E        +PIS                           +   + +PA+    I   +    +  N     V  P   +       V  G+   L+C + G PE  + W  +   + +    +F    ++    L + +++K D+G Y+   +N+ G ++C+A+V V         DR   PS ++ L  +    ++ T    E +V  +SP
Sbjct: 5085 ITWLKDDQ-ILEENDN---VHISFEDSVATLQVRSVDNGHSGRYTCQAKNESGIERCYAFLLV----QEPAQIIEK-AKSVDVTEKDPVTLECVVAG---TPELKVKWLKDGKQIVPSRY-FSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQDIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQ---WFKDGKEISTSA-KYRLVCHEN-TVSLEVSNLELEDTANYTCKVSNVAGDN-------ACSGILTVKEPPSFLVKPERQQAIPDS------------TVEFKAVLKGTPPFKIKWLKDDVELVSG-----------PKCFIGLEGST-SFLNLYSVDSSKTGQYTCQVTNDVEPPKF---VKKLEASKIIKAGDSARLECKITGSPEIQVVWY----------RNEHELTASDKYQMT------FIDSVAVIQM--NSLGTEDSGDFICEAQNPAGSTSCSTKVIVK---EPPVFSSFPPIVETLK-------NTEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKVASKNFHASIHILNVESTDIGEYHCKAQNEVGSDACVCAVKLKEPPKFISKLNSLTVVAGEPAELQASIEGAQPISVQWLKEKEEVIRESENIRISFVNNVATLQFAKVEPANAGKYICQVKNDGGVRENMATLTVLEPAVIIEKAGSMTVTVGETCALECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISS--LKILSVEKEDAGTYTFQVQNNVGKSSCTAVVDVS--------DRMVPPSFTRRL--KDTGGVLGTSCILECKVAGSSP 5822          

HSP 13 Score: 73.559 bits (179), Expect = 3.799e-12
Identity = 139/669 (20.78%), Postives = 249/669 (37.22%), Query Frame = 3
Query: 2985 DVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVW-LKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPR-FEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLPPETYSNLVKTHINDESRVMQASPRGWQEFQFHSNASTLRSSKNDIFEQELPVDKDVS 4973
            D G Y    ++K        HL + E P FV     ++   G  + +   +      +P TI W K+   L     + ++   D+   + E+     A  G Y CQ+SN+ G               SS+  I V   P    + S   V  + G S   + +        V W L  N+  + R   I      +   + +I+ A V +SGTY    +    T +  +E+  ++  P+     + +   ++  + + C V+ + P    + W            L NN   +   K    ++  M    L+      SD GEY   + N  G  +    + +         K  P FI+K++  + + +      +  V+G+P   + W+K+ + L E+D++ I        L +++     +G Y  QA N +G  + +C+                    +F ++                             + P Q +       V E D V L+C + G PE  + W  +   I   R F M  E +     ++++ K DSG+Y+   EN  G ++C A + V        +D+   PS +K L       ++ + I+ E +V  + P   Q F+     ST  S+K  +   E  V  +VS
Sbjct: 4747 DSGTYTCSATNKAGHSQCSGHLTVKEPPYFVEKPQSQDVNPGTRVQLKALVGG---TAPMTIKWFKDNKELHPG--AARSVWKDDTSTILELFSAKAADSGTYICQLSNDVG-------------TTSSKATIFVKEPPQFIKKPSPVLVLRN-GQSTTFECQVTGTPEIRVSWYLDGNEITDLRKYGISFV---DGLATFQISNARVENSGTYVCEARNDAGTASCSIELK-VKEPPIFIRELEPVEVVKDSDVELECEVMGTTP--FEVTW------------LKNNKEIRSGKK--YTMSEKMSVFYLHITKCDPSDVGEYQCIIANEGGSCACSARVAL---------KEPPSFIKKIEN-VTTVLKSSATFQSTVAGSPPISITWLKDDQILEENDNVHISFEDSVATLQVRSVDNGHSGRYTCQAKNESG--IERCY--------------------AFLLV-----------------------------QEPAQIIEKAKSVDVTEKDPVTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRV--------LDQDIPPSFTKKL--TKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEIST--SAKYRLVCHENTVSLEVS 5303          

HSP 14 Score: 71.2478 bits (173), Expect = 1.932e-11
Identity = 48/162 (29.63%), Postives = 79/162 (48.77%), Query Frame = 3
Query: 3843 YKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRV--ENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG 4322
            Y+  ++P ++ T      +L        +G +Y  RV   N+ G   V +P     + EA+ +   PK +  + ++I     +K+ V   V G PNPI KW K  +E+  S HL I K   +  L+IK+  + D+G Y   A N++GS+  K  + V+D  G
Sbjct: 18880 YREEDQPADRWTEYSVVKDLSLIVTGLKEGKKYKFRVAARNAVG---VSMPREAEGVYEAKEQLLPPKIL--MPEQITIKAGKKLRVEAHVYGKPNPICKWKKGDDEVVTSSHLAIHKADGSSVLIIKDVTRKDSGYYSLTAENSSGSDTQKIKVTVMDAPG 19036          

HSP 15 Score: 69.3218 bits (168), Expect = 6.517e-11
Identity = 81/325 (24.92%), Postives = 134/325 (41.23%), Query Frame = 3
Query: 3768 SCHSINWSIKPADG-SPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRV--ENSAG---WSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRK---VGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI-NNPRFEMKRELDEYFLILKN-IQKGDSGRYSITAENSSGL 4709
            SC  + W    +DG +  RN     R K  NK +   T  ++       N+   +G EY  RV  EN  G   WS +  P+T  +    Q    +P F ++L    +   +   +V CKV+G+P PI+KW + G+E+  +D LK R     G  H+L+I +    DA +Y+ +A+N  GS      L+V  P                              + I  P+  + + +   +R                G+ V +K    G P+P+I W      I NN  +++        L+  N +++ D+G Y + A+N  G+
Sbjct: 30883 SC-VVAWKPPASDGGAKIRNYYLERREKKQNKWIAVTTEEIRETVFSVQNLI--EGLEYEFRVKCENLGGESEWSEISEPVTPKSDVPIQ----APHFKEELRNLNVRYQSNATLV-CKVTGHPKPIVKWYRQGKEII-ADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVP------------------------------AKIHLPKTLEGMGAVHALR----------------GEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFSNGVERKDAGFYVVCAKNRFGI 31152          

HSP 16 Score: 68.5514 bits (166), Expect = 1.060e-10
Identity = 181/855 (21.17%), Postives = 308/855 (36.02%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCN--SQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKL---VLDGFKYAPESDLIFNNMPINVNHSSCP-WSKVSSNEMIQFNHRSVSLKDVGQYLFRVS---SKDVAKTHLEIGEK---PEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN----------SRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-----VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSV----NTTKPLEKPISFTIIPTERYQP--------------ADDNSDIS-----------SPQRTQ----------------------MIFSNTIVRSP-PQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLPPETYSNLVKTHINDESRVMQASP--RGW 4880
            + W KD  +I P        +CN  +      + I +  + DAG Y CE+ N     R +   L+S       T+ P +    F    EPL   +   V    + A   ++  +    +    S P +    +N +       VS+ D G+Y            +KT   I E+   P F          +G  + ++      +  +P  + W ++   L  ++    +++++   L  +I +   +H G Y+C  SN  G      +L+A E   S    I    KP+S   ++        G+S   +          V W KDN+ +              P ++I         LK+      DSG Y       V K+    Q ++ E  P +F   I+    S  AKQ  SI + C ++  P    + W    ++      L  + +Y M    +N +        L  +  +  D G+Y     N  G +S    + V         K  P F QK    + +     VI++C++SG P   + W+K+ +++  S   KI        L I N +  D G Y  +A+N  GS+   C ++  +P   V    + +  +  P+    +  E +QP                +N  IS           SP+ +Q                      ++   TIV  P P  VTT        G+   L+C + G PE    W+       +  R  +    +   L + + +  D G Y+   EN  G ++C+  V        H  DR   PS  + L  +  S  +   +  E RV  ++P   GW
Sbjct: 6011 VTWKKDGVSITPS------ERCNIVTTEKTCILEILSSTKGDAGHYSCEIEN--EAGRDACDALVS-------TLEPPY----FVTELEPLEASVGDSVSLQCQVAGTPEITVSWFKGDTKLRSTPEYRTYFTNNVATLVFNKVSINDSGEYTCMAENSIGTAASKTIFRIQERQLPPSFARQLKDIEQTVGLPVTLTC---RLNGSAPIQVCWYRDGVLLRDDENLQMSFVDNVATL--KILQTDLSHSGQYSCSASNPLGTASSTARLTAREPKKSPFFDI----KPVSIDVIA--------GESADFECHVTGAQPMRVTWSKDNKEIRPGGNYTITCVGNTPHLRI---------LKVGKG---DSGQYTCQATNDVGKDMCSAQLSVKE--PPKF---IKKLDASKVAKQGESIQLECKISGSPEIKVV-WFRNDSE------LHESWKYNM--SFVNSVA------LLTINEASAEDTGDYICEAHNGVGDASCSTALKV---------KAPPVFTQK-PPPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDTCACTVKFKEPPRFVKKLSDASTLIGDPVELQAV-VEGFQPISVVWLKDKGEVIRESENVRISFVDNIATLQLGSPEASQSGKYVCQIKNDAGMRECSAVLTVLEPATIVEKPEPMTVTT--------GNPFTLECVVAGTPELSAKWFKDGRELSSGSRHHITFVRNLASLKIPSAEMNDKGLYTFEVENRVGKSSCTVSV--------HVSDRVVPPSFVRRL--KDTSATLGASVVLECRVSGSAPISVGW 6768          

HSP 17 Score: 65.855 bits (159), Expect = 8.476e-10
Identity = 45/138 (32.61%), Postives = 64/138 (46.38%), Query Frame = 3
Query: 3897 ELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVG-ETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV 4307
            +L  ++VTT D  EY +   N  G  S    +TV            P F ++L         + V    +VSG P P LKW K+G+ LS   H++I   G + + L I++    D G Y   A+NT GS   + HLQV
Sbjct: 31791 QLTINSVTTDDDAEYTVVARNKHGEDSCKAKLTVTLHPPPTETTLRPMF-KRLLANAECHEGQSVCFEIRVSGIPAPTLKWEKDGQPLSLGPHIEIVHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 31927          

HSP 18 Score: 65.0846 bits (157), Expect = 1.156e-9
Identity = 116/512 (22.66%), Postives = 183/512 (35.74%), Query Frame = 3
Query: 3276 GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-----VLKETGQTQTTIVE-INPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWSIKPADGSPTRN----LVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVID--PIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNT--HFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSID 4766
            G Y+C  +N  G        S A+ +++     P    P++        +   VG+S  L+          V W KDN+ + S     QI Y E S   L I      DSG Y       V K++   Q  I E + P  F    +   +++   +  S  +   V  S P   ++ W     +  PT N      NNA                  + L     + +D G Y  +  N AG +     I +      +  K  P F Q L   + +   + V + C V G+    ++W+K G E+  SD         T  L +K   K+D+G Y  +ASN  GS+ SKC + + +            ++  + F                +S PQ  +++   T          TF   I K G D          P P + W+           R  + ++ DE  L +++  K DSG Y   A N  G    +  + VD   K   I+
Sbjct: 8119 GQYSCTATNPIGS-----ASSGAKLILTEGKNPPFFDIPLAP-------MDAVVGESADLECHVTGTQPIKVTWAKDNREIRSGG-NYQISYLENS-AHLTIVKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFT---KKLSETVEETEGNSFKLEGRVAGSQPI--TVAWYKNNVEIHPTSNCEIMFKNNA------------------LLLQVKRASMADAGLYTCKATNDAGSALCTSSIVI------KEPKKPPVFDQHL-APVTASEGDSVQLSCHVQGSEPIRIQWLKAGREVKPSDRCSFSFASGTAMLELKETAKADSGDYVCKASNVAGSDTSKCKVTIKEKPAAAPAAKKAAVDGKLFF----------------VSEPQSIRVVEKTT---------ATF---IAKVGGD----------PIPNVKWTKGKWRQLNQGGRILIHQKGDEAKLEIRDTTKTDSGLYRCVAFNKHGEIESNVNLQVDERKKQEKIE 8548          

HSP 19 Score: 63.1586 bits (152), Expect = 4.971e-9
Identity = 38/139 (27.34%), Postives = 66/139 (47.48%), Query Frame = 3
Query: 3891 RIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV 4307
            R  L    VT ++ G Y LR  N +G ++    + V A      +   P F Q+L    +     +V ++ +V+G P P++K+ ++G E+  S   +I + G+ + L+I      D+G Y   A+N+ G   S   L V
Sbjct:   62 RARLMIPAVTKANSGRYSLRATNGSGQATSTAELLVTA------ETAPPNFSQRLQSMTVRQ-GSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELVV 193          

HSP 20 Score: 62.7734 bits (151), Expect = 6.130e-9
Identity = 81/383 (21.15%), Postives = 139/383 (36.29%), Query Frame = 3
Query: 3657 VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQN----------KKTSPKFIQKLDKEIISP-------INEKVIVRCKVSGNPNPILKWMKNGEELSESDHLK---IRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRE-LDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVD 4739
            V++  I+  PV      +I  ++ G +  VC + +Y     + W          R L N+ +Y+        +T       +Y  ++T  D G Y  +V N  G  S    + V  + E  +          ++T    + +   E   P       + E V     ++ +P P + W K+G+++   D  K          ++L I +    D   Y   A N +G +  K  L V            L  P      PTE                       T +R  P F     +    EG  V  +  + G P P + W  +   ++  P  E+  E LD Y L +++    D+G Y +TA N++G  +C A + V+
Sbjct: 31603 VKVASIEIGPVSGQIMHAI-GEEGGYVKYVCKIENYDQSTQVTWYFG------VRQLENSEKYE--------ITYEDGVATMYVKDITKFDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTKKVKRRTDAMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPRVTWYKSGQKIKPGDDEKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKHGEDSCKAKLTVT-----------LHPP------PTE-----------------------TTLR--PMFKRLLANAECHEGQSVCFEIRVSGIPAPTLKWEKDGQPLSLGPHIEIVHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVE 31928          

HSP 21 Score: 62.3882 bits (150), Expect = 9.014e-9
Identity = 77/309 (24.92%), Postives = 129/309 (41.75%), Query Frame = 3
Query: 3924 SDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIK--NCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSP------------QRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCL--IGYPEPLIWWSYNTHFINNP-RFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPL 4799
            SD GE+ +  +N AG S++ + +TV    EA   +  P F++KL K +      ++ ++ + +GNPNP + W+KN + +    + +IR  G   E  +K  +    D+  Y A A N  G + ++C + V      V   +P  +P    IIP   Y+      +I++P            Q  +    +   +  P F    T   +K       +C L  IG P  ++ W ++   +    R  M  E     L        DSG  +  A N  G    SA +IV   ++   ++ SQ P   K L
Sbjct: 1529 SDSGEWTVVAQNRAGKSTISVTLTV----EAVEHQIKPAFVEKL-KNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPRIRIEGTRGEAALKIDSIISQDSAWYTATAINKAGRDTTRCKVNV-----EVEFAEP--EPERKLIIPRGTYR----AKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGAAYSRDSGVITCRATNKYGTDHTSATLIV--KDEKSLVEESQLPDGKKGL 1819          

HSP 22 Score: 61.6178 bits (148), Expect = 1.491e-8
Identity = 154/794 (19.40%), Postives = 287/794 (36.15%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEI--NPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPAD----------------------------------------------DNSDISSPQ--RTQMIFSNTIV-----RSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYF---------LILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            + ++W+K +  ++      I L+        ++ +       +G Y C V N       S+     +F ++  T + + ++ +    + P+ L+    G      S  + N  P++    +C  +    + +++    ++  +D  QY   +   + +D+ +  + + E P F+       + +G+ + +   +    ++    I W K  T L +       + N+   LV  I K   + VG+YTC+  N  G       ++++  L+  +  +P    P  + +L D + T  +G  +  +          V W KD + L   D  +Q+ +      +L+I     +  G Y         T ++  ++  +  +  P     P S+      S +  C V        I W+         R +     YKM       L  N   + +    V   D G+Y     N AG  S    + V         +  P+FI+KLD+  I   +E     CK+ G+P   + W K+  E+ ES   ++        L + +    D+G Y  +A N  GS  S   L+V +P   V   KP          P E  + AD                                              D +DI   Q   T  + S+T V     ++PPQFV   TD     G +V L+  + G     + W  +       + E+ RE D  +         L     +  ++G+Y+   +N +G+  C A + V
Sbjct: 6857 FKVKWFKGSRELVSGEACTISLE----DFVTELELLEVEPGQSGDYSCLVTNDAG----SASCTTHLFVKEPATFVKRLADTSVETGS-PIVLEATYSGTPPISVS-WMKNEYPLS-QSPNCGITTTEKSSILEILESTI--EDYAQYACLIENEAGQDICEALVSVLEPPYFIEPLEHVEAAIGEPITLQCKVDGTPEIR---ISWYKEHTKLRSAPAYKMQFKNNVASLV--INKVDHSDVGEYTCKAENSVG------AVASSAVLVIKERKLP----PSFARKLKDVHET--LGFPVAFECRINGSEPLQVSWYKDGELLKD-DANLQMSFVHHV-ATLQILQTDQSHVGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGSFKCHVTGTAPIK-ITWA------KDNREIRPGGNYKMT------LVENTATLTVL--KVAKGDAGQYTCYASNVAGKDSCSAQLGV---------QEPPRFIKKLDQSRIVKQDEYTRYECKIGGSPEIKVLWYKDEVEIQESSKFRMSFEDSVAILEMHSLSVEDSGDYTCEARNAAGSASSSTSLKVKEP--PVFRKKPF---------PVETLKGADVHLECELQGTPPFQVSWHKDKRELRSGKKYKIMSENLLTSIHILNVDTADIGEYQCKATNDVGSDTCVGSVTMKAPPQFVKKLTDISTIIGKEVQLQTTIEGAEPISVAWFKD-------KGEIVRESDNIWISYSENIATLQFSRAEPANAGKYTCQIKNDAGMQECYATLSV 7576          

HSP 23 Score: 61.2326 bits (147), Expect = 1.808e-8
Identity = 54/251 (21.51%), Postives = 104/251 (41.43%), Query Frame = 3
Query: 3993 TVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFT-IIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWW-SYNTHFINNPRFEMK--RELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVI 4733
            T    A A+   T P  +  L K +     E V + C +SG P+P + W +   ++  S   +I   G    L+I+     D+G +   A N  G+  + C+L       +V  ++  +K  + T    TE  +  +    + +        +     + P F++    + + EG  VV +C + G P+P ++W           R+++   ++  E  L++      D+G Y+I   N  G  + SA ++
Sbjct:  932 TARVPAPAEVPVTPPTLVSGL-KNVTVIEGESVTLECHISGYPSPKVTWYREDYQIESSIDFQITFQGGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYL-------AVQVSEEFDKETTLTEKFATEEKRFVESRDVVMTDTSITEEQAGPGEPAAPFFISKPVVQKLVEGGSVVFECQIGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECRLVISMTFADDAGEYTIVIRNKHGETSASASLL 1174          

HSP 24 Score: 60.8474 bits (146), Expect = 2.680e-8
Identity = 116/527 (22.01%), Postives = 205/527 (38.90%), Query Frame = 3
Query: 3372 IPVSAKPISSSQLSDNYVTGSVGDSIKLD--VEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPV-------------IQDFPQSIRAKQNGSIN----------IVCVVNSYPSCHSI-NWSIKPADGSPTRNLVNNARYKMINKPLN-KLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAG------IYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTI--------------IP-TERYQPADDNSDIS-----SPQRTQMIF------SNTIVRS------------PPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +PVSA P    +++ +    +  D  KL   VE  A  + +V W KD + L   +   Q +Y  +    LKI+  + +D G Y   +   G T  T  +     F  +             +Q   +S  AK++  I           +  + ++  S  S+  ++IK   G P   +      K I +    KL+ N +   L      TSDGG Y   V NSAG  S    +T+ A+ + + +K S +   ++  +  +   E++  +   S      +K      E+   + L I++   +  L+ +  K+S A       ++E     +  SE  K H ++      +N TK     +   I              +P +E Y+     SD +     +  R + I       S  +V+              P F+T    + + EG +V+  C + G P P I W+  N     +    + R  + Y L ++N    DSG+Y+I A+N  G  + +A + V
Sbjct: 32755 LPVSAPP----KITQSLKAEASKDIAKLTCAVESSALCAKEVAWYKDGKKLK-ENGHFQFHYSADGTYELKIHNLSESDCGEYVCEVSGEGGTSKTSFQFTGQSFKSIHEQVSSISETTKSVQKTAESAEAKKSEPIAPESISSKPVIVTGLRDTTVSSDSVAKFTIK-VTGEPQPTITWTKDGKAIAQGSKYKLSSNKEEFILEILKTETSDGGLYACTVTNSAGSVSSSCKLTIKAVKDTEAQKVSTQKTSEVTSQKKASAQEEISQKALTSEE----IKM----SEVKSHETLAIKEEA-SKVLIAEEVKRSAAASLEKSIVHEEVTKTSQASEEVKTHAEIKTLSTQMNITKGQRATLKANIAGATDVKWVLNGTELPNSEEYRYGVSGSDQTLTIKQASHREEGILSCIGKTSQGVVKCQFDLTLSEELSDAPSFITQPRSQNINEGQNVLFSCEVSGEPSPEIEWFKNNLPISISSNISVSRSRNVYTLEIRNAAVSDSGKYTIKAKNFHGQCSATASLTV 33266          

HSP 25 Score: 56.225 bits (134), Expect = 5.573e-7
Identity = 49/158 (31.01%), Postives = 64/158 (40.51%), Query Frame = 3
Query: 3906 FDNVTTS--DGGEYCLRV--EN--SAGWSSVMIPITVAALAEAQNKKTSP------KFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVID----PIGSVN 4331
             D V T    G  Y  RV  EN    G     IPI      E Q K   P      K I+ L  +  + +    I+R    G P P  KW  +G E+   DH  +     +  L IKNC + D G Y+   SN  G++    HL V+D    P G +N
Sbjct: 17508 LDCVVTGLQQGKTYRFRVKAENIIGLGLPDTTIPI------ECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIR----GVPVPTAKWTTDGTEIKTDDHYTVETDSFSSVLTIKNCLRKDTGEYQLTVSNAAGTKTVAVHLTVLDVPGPPTGPIN 17655          

HSP 26 Score: 55.4546 bits (132), Expect = 1.054e-6
Identity = 48/206 (23.30%), Postives = 91/206 (44.17%), Query Frame = 3
Query: 4131 LKWMKNGEELSESDHLKIRKVGE-THELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI-NNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDS 4742
            + W K+G++L E+ H +     + T+EL I N  +SD G Y  + S   G+  SK   Q         + K + + +S     T+  Q   ++++    ++++ I   +I  S P  VT   D  V           + G P+P I W+ +   I    ++++    +E+ L +   +  D G Y+ T  NS+G  + S  + + +
Sbjct: 32792 VAWYKDGKKLKENGHFQFHYSADGTYELKIHNLSESDCGEYVCEVSGEGGT--SKTSFQFTG-----QSFKSIHEQVSSISETTKSVQKTAESAEA---KKSEPIAPESI-SSKPVIVTGLRDTTVSSDSVAKFTIKVTGEPQPTITWTKDGKAIAQGSKYKLSSNKEEFILEILKTETSDGGLYACTVTNSAGSVSSSCKLTIKA 32986          

HSP 27 Score: 54.299 bits (129), Expect = 2.317e-6
Identity = 63/286 (22.03%), Postives = 112/286 (39.16%), Query Frame = 3
Query: 3927 DGGEYCLRV--ENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKE------GDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYF--LILKNIQ-KGDSGRYSITAENSSGLATCSALVIVDSHNK 4751
            +  EY  RV  EN  G S    P   A   + +        ++K   ++ + + E   + C++ G P P +KW + G+EL +S   K+   G TH L +   ++ D G+Y   A+N                +G V ++                                    S  ++++ PQF   +    +KE      G  + L    IG P P + W +    + N   ++  E  E++  L++KN+Q K  +G+Y +   N+ G  T  A + V+  +K
Sbjct: 30540 EATEYEFRVFAENETGLSR---PRRTAMSVKTKLTSGEAPGVRKEMADVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTDEQEDEGVYTCVATNE---------------VGEVESS------------------------------------SKLLLQAAPQFHPGYP---LKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSE-KITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNAFG--TVDATLDVEIQDK 30765          

HSP 28 Score: 54.299 bits (129), Expect = 2.672e-6
Identity = 85/419 (20.29%), Postives = 148/419 (35.32%), Query Frame = 3
Query: 3489 VVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKV-SGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDS 4742
            V W+KD Q L   D RI+I   E+    L I    ++D+G Y  V      T    VE   ++   + ++    +  KQ   +      +   +    +W     DG      V      ++ + ++++         +      SD GEY       AG +   + + V       N    P+ +Q+L    +   + K    C V SG P P + W K  + LS     K    G+ + L++      DA +Y  +A N  G   +   L V  P                               ++ SP +   ++       PP  VT   D +  EG     +C + G    + W+  +     +  F M +  D Y L +      D G Y+  A N+ G  + +A + +++
Sbjct: 3094 VQWMKDGQELQIAD-RIKIQK-EKYVHRLLIPSTRMSDAGKYTVVAGGNMSTANLFVEGRDVRIRSIKKEV--QVIEKQRAVVEFEVNEDDVDA----HWY---KDGIEINFQVQERHQYVVERRIHRM---------FISETRHSDAGEYTF----VAGRNRSSVTLYV-------NAPEPPQVLQELQPVTVQ--SGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVP-------------------------------EVVSPDQEMPVY-------PPAIVTPLQDTVTSEGRPARFQCQVSGTDLKVSWYCKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYAFVANNAVGQVSSTATLRLEA 3441          

HSP 29 Score: 53.9138 bits (128), Expect = 3.159e-6
Identity = 52/187 (27.81%), Postives = 79/187 (42.25%), Query Frame = 3
Query: 3894 IELYFDNVTTSDGGEYCLRV--ENSAGW----SSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPA------DDNSDIS 4418
            IE  F     ++   Y  RV  +N+AG     S    PIT     E       PKF       I+    E   +   V G P P ++W++  +E+ ES   +I+       L++K+  + D G Y  +ASN  GS+    +++V+D  G      P E P+  T +  E+   A      D  SDIS
Sbjct: 23619 IETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKF----RDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPG------PPEGPVQVTGVTAEKCTLAWSPPLQDGGSDIS 23795          

HSP 30 Score: 53.1434 bits (126), Expect = 5.681e-6
Identity = 36/133 (27.07%), Postives = 62/133 (46.62%), Query Frame = 3
Query: 3990 ITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESD-HLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTER 4385
            IT     +A N    PK+       II    E  ++   + G P P + W K+G EL E+   ++I+   +   L++K+C ++D G Y  + SN  G++     ++V+D  G      P E P+  T +  E+
Sbjct: 24739 ITARDEIDAPNASLDPKY----RDVIIVHAGETFVLEADIRGKPIPDIIWSKDGNELEETAARMEIKSTLQKTTLIVKDCIRTDGGQYTLKLSNVGGTKTIPITVKVLDRPG------PPEGPLKVTGVTAEK 24861          

HSP 31 Score: 52.7582 bits (125), Expect = 6.230e-6
Identity = 35/144 (24.31%), Postives = 59/144 (40.97%), Query Frame = 3
Query: 3897 ELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQ--KLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG 4322
            E YF+    ++   Y  RV       SV  P         ++   +P+ +   K    II    E + +   ++G P P++ W K+G E+ E    +I     T  L +K+C + D G Y     N  G+     + +V+D  G
Sbjct: 25784 ETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPITVKDDVEAPRIMMDVKFRDVIIVKAGEVLKINADIAGRPLPVISWAKDGVEIEERAKTEIVSTDYTTTLTVKDCVRRDTGQYVLTLKNVAGTRTMAVNCKVLDKPG 25927          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Mouse
Match: Ttn (titin [Source:MGI Symbol;Acc:MGI:98864])

HSP 1 Score: 124.02 bits (310), Expect = 1.781e-27
Identity = 174/773 (22.51%), Postives = 304/773 (39.33%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVAKTH---LEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTY--INDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE----KPISFT-------------------IIPTERYQPADDNS---------DISSPQRTQMIFSN----------TIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYN-THFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            I W KDN  I P  + ++ L  N+ +    + +    + DAGQY C   N     + S    L V  Q+    I K  +       E    +  + G   +PE  +++    + +  SS  +     + +      S+S++D G Y     +   + +    L++ E P F    F   +L G  + +   ++      P  + W K+K  L     S K Y  +++N      I     A +G+Y C+ +N+ G D            + S T+    A P    +L+D  ++  +G  ++L           V W KD   +      I I Y  E+  +L+ + A   ++G Y   +K     Q     ++ ++ A +++  P+SI+     +  + C V+  P   S  W     DG   + L ++ +YK+     NK++G      L   NV   D G Y   V+N  G  S  + I V+      ++   P F +KL KE        V++ CKV G+P   + W  +G E+S     +      T  L +   +++DAG Y   A+N  GS+     L V +P   V    P++      ++FT                   ++P  R   +  +S         D S       I SN            V++P  FV    D  +++G  ++L+    G P   + W  N  + I + R  +        L + +    DSG+Y+   EN+SG  +CSA +++
Sbjct: 7237 ITWAKDNREIRPGGNYKMTLVENTAT----LTVLKVAKGDAGQYTCYASNVAG--KDSCSAQLGV--QEPPRFIKKLDQSRIVKQDEYTRYECKIGG---SPEIKVLWYKDEVEIQESS-KFRMSFEDSVAILEMHSLSVEDSGDYTCEARNAAGSASSSTSLKVKEPPVFRKKPFPVETLKGADVHLECELQG---TPPFQVSWHKDKRELR----SGKKYKIMSENLLTSIHILNVDTADIGEYQCKATNDVGSD----------TCVGSVTM---KAPPQFVKKLTD--ISTIIGKEVQLQTTIEGAEPISVAWFKDKGEIVRESDNIWISY-SENIATLQFSRAEPANAGKYTCQIKNDAGMQECYATLSVLEPAAIVEK-PESIKVTTGDTCTLECTVSGTPEL-STKWF---KDG---KELTSDNKYKI--SFFNKVSG------LKIINVVPGDSGVYSFEVQNPVGKDSCKVSIQVS------DRIIPPSFTRKL-KETNGLSGSSVVMECKVYGSPPISVLWFHDGNEISSGRKYQTTLTDNTCALTVNMLEEADAGDYTCIATNVAGSDECSAPLTVREPPSFVQKPDPMDVLTGSNVTFTSIVKGSPPFTVSWFKGSTELVPGARCNVSLQDSVGELELFDVDTSQSGEYTCIVSNEAGRASCTTRLFVKAPAIFVKRLNDYSIEKGKPLILEGTFSGTPPISVTWKKNGINVIASQRCNITTTEKSAILEILSSTVEDSGQYNCYIENASGKDSCSAQILI 7951          

HSP 2 Score: 92.8189 bits (229), Expect = 5.519e-18
Identity = 163/762 (21.39%), Postives = 290/762 (38.06%), Query Frame = 3
Query: 2652 MHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLS---VFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHK-TYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQ-AVLKETGQTQTTIV-----EINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG--------SVNTTKPL--------EKPISFTIIPTERYQPADDNSDISSPQRTQM--IFSNTI------------------------VRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDR 4769
            + I+     D G Y CE  NG      S+ + +    VF+QK   V         A     + L+  + G    P  ++++      V  SS  +   S N     +  ++   D+G+Y  + +++   D     ++  E P FV      ++L+GD + +   ++ F    P +++W K+K  +     + + +++++   L    P+ +Q+  G Y CQ+ N+ G      + SA   ++   T++    KP          +T + G+   L+            W KD + L+S   R  I +   +  SLKI  A +ND G Y   V    G++  T+       + P  F   ++D   ++ A    S+ + C V+      S+ W +   DG+           ++I+ P  + +       L   ++  SD G Y     N AG       +TV         +  P F Q  D   + P    +     + G P   +KW K   EL   +   I       EL +   +   +G Y    +N  GS     HL V +P          SV T  P+          PIS + +  E       N  I++ +++ +  I  +TI                        V  PP F+          G+ + L+C + G PE  I W+  +T   + P ++M+ + +   L++  +   D G Y+  AENS G    SA++++       S  R
Sbjct: 6416 LTINEASAEDTGDYICEAHNGVGDASCSTALKVKAPPVFTQKPPPV--------GALKGSDVILQCEISG---TPPFEVVWVKDRKQV-RSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDTCACTVKFKEPPRFVKKLSDASTLIGDPVELQAVVEGFQ---PISVVWLKDKGEVIRESENVRISFVDNIATLQLGSPEASQS--GKYVCQIKNDAG----MRECSAVLTVLEPATIV---EKP--------EPMTVTTGNPFTLECVVAGTPELSAKWFKDGRELSSGS-RHHITF-VRNLASLKIPSAEMNDKGLYTFEVENRVGKSSCTVSVHVSDRVVPPSFVRRLKDTSATLGA----SVVLECRVSGSAPI-SVGWFL---DGN-----------EIISSPKCQSSFADNVCTLTLSSLEPSDTGAYTCVAANVAGQDESSAVLTV---------QEPPSFEQTPDSVEVLP-GMSLTFTSVIRGTPPFKVKWFKGSRELVSGEACTISLEDFVTELELLEVEPGQSGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADTSVETGSPIVLEATYSGTPPISVSWMKNEYPLSQSPNCGITTTEKSSILEILESTIEDYAQYACLIENEAGQDICEALVSVLEPPYFIEPLEHVEAAIGEPITLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYTCKAENSVGAVASSAVLVIKERKLPPSFAR 7114          

HSP 3 Score: 91.6633 bits (226), Expect = 1.255e-17
Identity = 112/501 (22.36%), Postives = 189/501 (37.72%), Query Frame = 3
Query: 3237 LVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +  EI  F  A VGDY C V+NE G    K    A   L    T +          +  D++ T   G ++ L           V+W+K  Q +   D +I++ +       L I    ++  G Y  + +    +QT++ E+   + A +I+   + I+        +   V+  P        +KP      R LV + +Y++          N+ +++ Y  +    D G+Y   + N  G SS     TV       ++  +P F + L + + S +     + CK++G+    + W K+G+EL+ SD  +I  V  T  L I     +DAG +  +A+N+ GS+ S   L V +P                                                   P FVT      V  G  V LK    G  P  + W+  +   ++     + +E  E  L L  ++  DSG Y+    N +G   CSA + V
Sbjct: 3892 VYLEISSFNSADVGDYECVVANEVG----KCGCVATHLLKEPPTFV----------KKVDDF-TALAGQTVTLQAAVRGSEPISVMWMK-GQEVIKEDGKIKMSF-SNGVAVLTIPDVQISLGGKYTCLAENEAGSQTSVGELIVKEPAKIIERA-ELIQVTAGDPATLEYTVSGTPE-------LKPKWYKDGRPLVASKKYRI------SFKNNIAQLKFY--SAELHDSGQYTFEISNEVGSSSCETTFTVL------DRDIAPLFTKPL-RNVDSVVGGACRLDCKIAGSLPMRVSWFKDGKELTASDRYQIAFVEGTASLEISRVDMNDAGNFTCRATNSVGSKDSSGALIVQEP---------------------------------------------------PSFVTKPGSRDVLPGSAVCLKSAFQGSAPLTIKWFKGDKELVSGGSCYITKETSESSLELYAVKTSDSGTYTCKVSNVAGSVECSADLFV 4301          

HSP 4 Score: 90.5077 bits (223), Expect = 2.808e-17
Identity = 177/796 (22.24%), Postives = 302/796 (37.94%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVN-HSSCPWSKVSSNEMIQFNHRS-------VSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELV-FEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDF---------PQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVI-VRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQ-----------------------PA-------DDNS----------------------DISSPQRTQMIFSNTIVRSPPQFVTTFTDEIV-KEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLI-LKNIQKGDSGRYSITAENSSGLATCS 4721
            I+W+K ++ ++      I  + +  S    + +   + SD+G Y C+V N    +  S+     +F ++  T I K          EP  L    DG + A +   +    PI +   ++    + SS   + F   +       V+++D G+Y+      +  D     + + E P F   +FK   +L +   +   +       P  I W K+ T L + +  +KT++ D  +LV  ++ KF  A  G+Y C+V+NE G      +++  E         P   K I ++       +   G +          +   V WLKDN  + + D  I++ + E +  SL ++G  V   G Y    K     Q     ++  + A ++++          P +++ K +G+  I           S  W     DG   + L    +YK+       +T  +  +++   +    D GEY   V+N  G SS    I V  L         P F +KL K  +  I    I + C V+G+    ++W K+ +E+S SD  K      T  L I   + +D+G Y   A+N  G      HL V +P   V      EKP S  + P  R Q                       P        DD S                      D+ +      IF    V+ PPQF+   +  +V + G     +C + G PE  + W  + + I + R      +D      + N +  +SG Y   A N +G A+CS
Sbjct: 4243 IKWFKGDKELVSGGSCYITKETSESS----LELYAVKTSDSGTYTCKVSNVAGSVECSA----DLFVKEPATFIEKL---------EPSQLLKKGDGTQLACK---VTGTPPIKITWFANDRELRESSKHKMSFAESTAVLRLTDVAIEDSGEYMCEAQNEAGSDHCTGIVIVKESPYFT-KEFKSIEVLKEYDVML--LAEVAGTPPFEITWFKDNTTLRSGR-KYKTFLQD--QLVSLQVLKFVAADAGEYQCRVTNEVGSSTCSARVTLREP--------PSFIKKIEAT-------SSLRGGTAAFQATLKGSLPITVTWLKDNDEI-TEDDNIRMTF-ENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATIMEEAVSIDVTQGDPATLQVKFSGTKEI-----------SAKWF---KDG---QELTLGPKYKI------SVTDTVSILKII--STEKKDSGEYTFEVQNDVGRSSCKASINVLDLI------IPPSFTKKLRK--MDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASDKHKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHSQCSGHLTVKEPPYFV------EKPQSQDVNPGTRVQLKALVGGTAPMTIKWFKDNKELHPGAARSVWKDDTSTILELFSAKAADSGTYICQLSNDVGTTSSKATIF----VKEPPQFIKKPSPVLVLRNGQSTTFECQVTGTPEIRVSWYLDGNEITDLRKYGISFVDGLATFQISNARVENSGTYVCEARNDAGTASCS 4952          

HSP 5 Score: 87.8113 bits (216), Expect = 1.690e-16
Identity = 178/733 (24.28%), Postives = 281/733 (38.34%), Query Frame = 3
Query: 2565 QWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYA--PESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLF---RVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVL-----KETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFT--DEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSA 4724
            +W+KD + +  D   +I    N  SG   + I N    D+G Y  EV+N   V + S  V + V  +    + P F+ K    N    S  +V++   Y   P S L F++   N   S   +    ++         +   D G Y      V+  D     L + E P FV      + L G ++  +  +K      P T+ W K  T L      + +  +  GEL  E+     +  G+YTC VSNE G               S  T + V A  I   +L+D  +    G  + L+  F       V W K+   + +   R  I   E+S   L+I  +TV DSG Y   +     K++   Q  I+E  P  F   ++     ++     S ++ C +   P    ++W        PT      A  KM  K  N +        L F  V +SD GEY  R ENS G  S    +TV      Q +K  P F ++L +++   +   V+  C VSG+    + W K+G+ L +S +++   +     L I    +S +G Y   A+N               PIGS ++   L        I TE                          ++PP F       D +V E  D  L+C + G  P  + W   N    +   +++    +   L +  + KGDSG+Y+  A N  G  +C+A
Sbjct: 7612 KWFKDGKELTSDNKYKISF-FNKVSG---LKIINVVPGDSGVYSFEVQN--PVGKDSCKVSIQVSDR---IIPPSFTRKLKETNGLSGS-SVVMECKVYGSPPISVLWFHDG--NEISSGRKYQTTLTDNTCALTVNMLEEADAGDYTCIATNVAGSDECSAPLTVREPPSFVQKPDPMDVLTGSNVTFTSIVKG---SPPFTVSWFKGSTELVPGARCNVSLQDSVGEL--ELFDVDTSQSGEYTCIVSNEAGR-------------ASCTTRLFVKAPAIFVKRLNDYSI--EKGKPLILEGTFSGTPPISVTWKKNGINVIASQ-RCNITTTEKSAI-LEILSSTVEDSGQYNCYIENASGKDSCSAQILILE--PPYFVKQLE----PVKVTVGDSASLQCQLAGTPEI-GVSWYKGDTKLRPT------ATCKMHFK--NNVA------TLVFTQVDSSDSGEYICRAENSVGEVSSSTFLTV------QEQKLPPSFSRQL-RDVQETVGLPVVFECAVSGSEPISVSWYKDGKPLKDSPNIQTSFLDNIATLNIFKTDRSLSGQYSCTATN---------------PIGSASSGAKL--------ILTEG-------------------------KNPPFFDIPLAPMDAVVGESAD--LECHVTGTQPIKVTWAKDNREIRSGGNYQISYLENSAHLTIVKVDKGDSGQYTCYAVNEVGKDSCTA 8232          

HSP 6 Score: 86.6557 bits (213), Expect = 4.111e-16
Identity = 172/767 (22.43%), Postives = 275/767 (35.85%), Query Frame = 3
Query: 2649 KMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFS------------EKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQ--FAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWS-----IKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKP------------LEKPISFT-------------IIPTERYQPADDNSDIS-------SP-------QRTQMIFSNTIV-----RSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFIN---NPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            ++ + N   S +G+Y C V N        +     +F ++  T + K S            E T+   T P+S+    DG    P          I     +C    +SS +            D G Y   +   + +D     +   E P FV       + +GDS+++   +    ++   T+ W K  T L +       + N+   LVF   K +    G+YTC   N  G    K         I  + L P  A+     QL D  +  +VG  + L           V W +D   L   D  +Q+ +  ++  +LKI    ++ SG Y         T ++   +   +   +P     P SI      S +  C V  + P    + WS     I+P  G+ T   V N  +  I K                  V   D G+Y  +  N  G       ++V         K  PKFI+KLD   ++   E + + CK+SG+P   + W +N  EL ES    +  V     L I      D G Y  +A N  G       L+V  P   V T KP            L+  IS T             +  +++++    N D S       +P       + T  + S+T       + PP+FV   +D     GD V L+  + G+ P  ++W       I    N R      +    L L + +   SG+Y    +N +G+  CSA++ V
Sbjct: 5943 ELELFNIDISQSGEYTCVVSNNAG----QASCTTRLFVKEPATFVKKLSDHSVEPGKSIILEGTYTG-TLPISVTWKKDGVSITPS-----ERCNIVTTEKTCILEILSSTK-----------GDAGHYSCEIENEAGRDACDALVSTLEPPYFVTELEPLEASVGDSVSLQCQVAGTPEI---TVSWFKGDTKLRSTPEYRTYFTNNVATLVFN--KVSINDSGEYTCMAENSIGTAASKTIFR-----IQERQLPPSFAR-----QLKD--IEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRD-DENLQMSF-VDNVATLKILQTDLSHSGQYSCSASNPLGTASSTARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQP--MRVTWSKDNKEIRPG-GNYTITCVGNTPHLRILK------------------VGKGDSGQYTCQATNDVGKDMCSAQLSV---------KEPPKFIKKLDASKVAKQGESIQLECKISGSPEIKVVWFRNDSELHESWKYNMSFVNSVALLTINEASAEDTGDYICEAHNGVGDASCSTALKVKAP--PVFTQKPPPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDTCACTVKFKEPPRFVKKLSDASTLIGDPVELQAVVEGFQPISVVWLKDKGEVIRESENVRISFVDNI--ATLQLGSPEASQSGKYVCQIKNDAGMRECSAVLTV 6635          

HSP 7 Score: 82.8037 bits (203), Expect = 5.305e-15
Identity = 164/772 (21.24%), Postives = 286/772 (37.05%), Query Frame = 3
Query: 2475 LLVNAESSCPTRLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVN--------HSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK----DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPL-NSRDPRIQIYYPEESKCSLKINGATVNDSGTYQ-AVLKETGQT--QTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            L++  ES+   RL   L+  P I      + W+K+N+ +      R+    NS++    + I + +  D+G Y CE  N              V S    T +      +F    EP     ++ G     + + I    P  VN         SS  +   +    +     S +  DVG Y   V+++        THL + E P FV       +L G ++ +   ++      P +++W K +  +  +     ++   NG  V  IP    +  G YTC   NE G      Q S  E ++         AK I  ++L    +  + GD   L+            W KD +PL  S+  RI     + +   LK   A ++DSG Y   +  E G +  +TT   ++    AP+     +++ +   G+  + C +  S P    ++W     DG   + L  + RY++      + T +++        V  +D G +  R  NS G       + V         +  P F+ K     + P    V ++    G+    +KW K  +EL       I K      L +   K SD+G Y  + SN  GS   +C   +            +++P +F     E+ +P+                                 +++K+GD   L C + G P   + W++ +     + + +M        L L ++   DSG Y   A+N +G   C+ +VIV
Sbjct: 3754 LMLPGESA---RLHCKLKGSPVIQ-----VTWFKNNKELSESNTVRMSF-VNSEA---ILDITDVKVDDSGTYSCEATN-------------DVGSDSCSTEVVIKEPPSFIKTLEPAD---IVRGANALLQCE-IAGTGPFEVNWFKDKKQIRSSKKYRLFTQKTFVYLEISSFNSADVGDYECVVANEVGKCGCVATHL-LKEPPTFVKKVDDFTALAGQTVTLQAAVRGSE---PISVMWMKGQEVIKEDGKIKMSF--SNGVAVLTIPDVQISLGGKYTCLAENEAGS-----QTSVGELIVKE------PAKIIERAEL----IQVTAGDPATLEYTVSGTPELKPKWYKDGRPLVASKKYRISF---KNNIAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDR-DIAPLFTKPLRNVDSVVGGACRLDCKIAGSLP--MRVSWF---KDG---KELTASDRYQIA---FVEGTASLE-----ISRVDMNDAGNFTCRATNSVGSKDSSGALIV---------QEPPSFVTKPGSRDVLP-GSAVCLKSAFQGSAPLTIKWFKGDKELVSGGSCYITKETSESSLELYAVKTSDSGTYTCKVSNVAGS--VECSADLF-----------VKEPATF----IEKLEPS---------------------------------QLLKKGDGTQLACKVTGTPPIKITWFANDRELRESSKHKMSFAESTAVLRLTDVAIEDSGEYMCEAQNEAGSDHCTGIVIV 4395          

HSP 8 Score: 82.8037 bits (203), Expect = 5.579e-15
Identity = 122/545 (22.39%), Postives = 202/545 (37.06%), Query Frame = 3
Query: 3255 KFTQAHV---GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSI---NIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVI--------DPIGSVNTTKPLEKPISFTIIPTERYQPA--DDNSDISSPQRTQMIFSNTIV----------------------------------RSPPQFVTTFTDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            KF  A +   G YT ++SNE G    +   +     +  + + P+  KP+ +       V   VG + +LD +    +   V W KD + L + D R QI +  E   SL+I+   +ND+G +           T  V       A ++Q+ P  +    +  +   + VC+ +++    S   +IK   G   + LV+     +  +       +   +ELY   V TSD G Y  +V N AG       + V         K    FI+KL+   +    +   + CKV+G P   + W  N  EL ES   K+     T  L + +    D+G Y  +A N  GS+   C   VI            S+   K  +  +   +  T  ++     DN+ + S ++ +    + +V                                  R PP F+          G     +  L G  P  + W   N     +    M  E +   L L  I+    G+Y   A+N +G+  CSAL+ V
Sbjct: 4081 KFYSAELHDSGQYTFEISNEVGSSSCETTFT-----VLDRDIAPLFTKPLRN-------VDSVVGGACRLDCKIAGSLPMRVSWFKDGKELTASD-RYQIAF-VEGTASLEISRVDMNDAGNFTC-------RATNSVGSKDSSGALIVQEPPSFVTKPGSRDVLPGSAVCLKSAFQG--SAPLTIKWFKGD--KELVSGGSCYITKE------TSESSLELY--AVKTSDSGTYTCKVSNVAGSVECSADLFV---------KEPATFIEKLEPSQLLKKGDGTQLACKVTGTPPIKITWFANDRELRESSKHKMSFAESTAVLRLTDVAIEDSGEYMCEAQNEAGSD--HCTGIVIVKESPYFTKEFKSIEVLKEYDVMLLAEVAGTPPFEITWFKDNTTLRSGRKYKTFLQDQLVSLQVLKFVAADAGEYQCRVTNEVGSSTCSARVTLREPPSFIKKIEATSSLRGGTAAFQATLKGSLPITVTWLKDNDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSV 4581          

HSP 9 Score: 78.1814 bits (191), Expect = 1.597e-13
Identity = 119/542 (21.96%), Postives = 203/542 (37.45%), Query Frame = 3
Query: 3243 FEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN-SRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE------KPISFTIIPTERYQPA--DDNSDISSPQRTQMIFSNTIV----------------------------------RSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
             EI +      G+YTC+ SNE+G       L+  EA   +    P               +T  VG + K           +++W KD   L+ S D R+      ++K SL+++  TV D G Y               E+  I     I++  +++++  N  I++ C V+      +I WS    DG   + L     YK+           +  +E+    +   D G Y     N AG SS    + V         +  P F++K+D   +    E   + CK+ G+P   + W KN +ELSES+ +++  V     L I + K  D+G Y  +A+N  GS+     + + +P   + T +P +        +   I  T  ++     D   I S ++ ++    T V                                  + PP FV    D     G  V L+  + G  P  ++W         + + +M        L + ++Q    G+Y+  AEN +G  T    +IV
Sbjct: 3519 LEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRP-------------KALTTFVGKAAKFLCTVSGTPVIEIIWQKDGAALSPSPDCRVT---DADNKHSLELSNLTVQDRGIYSCKASNKFGADICQAELTIIDKPHFIKEL-EAVQSAINKKIHLECQVDEDRKV-TITWS---KDG---QKLPAGKDYKIY------FEDKIASLEIPLAKL--KDSGTYTCTASNEAGSSSSSAAVAV---------REPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMSFVNSEAILDITDVKVDDSGTYSCEATNDVGSDSCSTEVVIKEPPSFIKTLEPADIVRGANALLQCEIAGTGPFEVNWFKDKKQIRSSKKYRLFTQKTFVYLEISSFNSADVGDYECVVANEVGKCGCVATHLLKEPPTFVKKVDDFTALAGQTVTLQAAVRGSEPISVMWMKGQEVIKEDGKIKMSFSNGVAVLTIPDVQISLGGKYTCLAENEAGSQTSVGELIV 4019          

HSP 10 Score: 77.411 bits (189), Expect = 2.408e-13
Identity = 151/764 (19.76%), Postives = 264/764 (34.55%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNG-------PSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNM-------------PINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYL-----FRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDR 4769
            + + W+KD   +      +I+    S++    +HI N   +D G+Y C+  N         SV  K+ P  +   +     +  +   +T     EP+S+    D  +   ESD I+ +              P N    +C   ++ ++  +Q  + ++S+ +    +      +V++ D       +   PE     FK+   L       I    F+K+S   II                    D+G   FE+    Q  VG  +C+VS +                  S  +IP    P  + +L +    G  G S+ ++ +        V+W  D   ++S   R       ++ C+L +N     D+G Y  +      +      +  ++  P     P  +      ++    +V   P   +++W      GS    LV  AR  +       L  ++  +EL+  +V TS  GEY   V N AG +S    + V A A          F+++L+   I    + +I+    SG P   + W KNG  +  S    I    ++  L I +    D+G Y     N +G +     + +++P                                                   P FV       V  GD   L+C L G PE  + W+  +T        +M  + +   L+   +   DSG Y   AENS G  + S  + V       S  R
Sbjct: 7422 FQVSWHKDKRELRSGKKYKIM----SENLLTSIHILNVDTADIGEYQCKATNDVGSDTCVGSVTMKAPPQFVKKLTDISTIIGKEVQLQTTIEGAEPISVAWFKDKGEIVRESDNIWISYSENIATLQFSRAEPANAGKYTC---QIKNDAGMQECYATLSVLEPAAIVEKPESIKVTTGDTCTLECTVSGTPELSTKWFKDGKELTSDNKYKISF--FNKVSGLKII---------------NVVPGDSGVYSFEV----QNPVGKDSCKVSIQV-----------------SDRIIP----PSFTRKLKET--NGLSGSSVVMECKVYGSPPISVLWFHDGNEISSG--RKYQTTLTDNTCALTVNMLEEADAGDYTCIATNVAGSDECSAPLT-VREPPSFVQKPDPMDVLTGSNVTFTSIVKGSPP-FTVSW----FKGS--TELVPGARCNV------SLQDSVGELELF--DVDTSQSGEYTCIVSNEAGRASCTTRLFVKAPA---------IFVKRLNDYSIEK-GKPLILEGTFSGTPPISVTWKKNGINVIASQRCNITTTEKSAILEILSSTVEDSGQYNCYIENASGKDSCSAQILILEP---------------------------------------------------PYFVKQLEPVKVTVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTATCKMHFKNNVATLVFTQVDSSDSGEYICRAENSVGEVSSSTFLTVQEQKLPPSFSR 8055          

HSP 11 Score: 77.411 bits (189), Expect = 2.641e-13
Identity = 172/801 (21.47%), Postives = 301/801 (37.58%), Query Frame = 3
Query: 2508 RLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLS---VFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHK-TYINDNGELVFEIPKFTQAHVGDYTCQVSNEFG--EDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQ-AVLKETGQTQ-TTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPI--------------------GSVNTTKPLE---KPISFTIIPTERYQPADDNSDISSPQRTQM--IFSNT----------------------IVRS--PPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSAL 4727
            RL+  +   P I      + WY+ NE  L   D   +   +S +    + +++    D+G + CE +N       S+ V++    VFS       P   E     NTE +SL+  L G    P  ++++      +  SS  +   S N     +  +V   D+G+Y  +  ++   D     +++ E P+F+    K NSL   +   +    +     P ++ W K K  +     + + +++N+   L F   K   A+ G Y CQV N+ G  E++  L +     +I                      +T +VG++  L+ +        V W KD + L S       +Y + S  SLKI      D+GTY   V    G++  T +V+++     P    F + ++    G +   C++             K A  SP      + + K+++    + T +     L  +++ +SD G Y     N AG       +TV         +  P F+++ +   + P  + +     + G P   + W +   EL + +   I       EL + N   S +G Y    SN  G       L V +P                     G+   T P+    K    +I P+ER        +I + ++T +  I S+T                      +V +  PP FVT         GD V L+C + G PE  + W+  +T   + P +      +   L+   +   DSG Y+  AENS G A    +
Sbjct: 5436 RLECKITGSPEIQ-----VVWYR-NEHELTASDKYQMTFIDSVA---VIQMNSLGTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSS-----FPPIVETL--KNTE-VSLECELSG---TPPFEVVWYKDKRQL-RSSKKYKVASKNFHASIHILNVESTDIGEYHCKAQNEVGSDACVCAVKLKEPPKFIS---KLNSLTVVAGEPAELQASIEGAQPISVQWLKEKEEVIRESENIRISFVNNVATLQFA--KVEPANAGKYICQVKNDGGVRENMATLTVLEPAVIIEKA-----------------GSMTVTVGETCALECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKIS--SLKILSVEKEDAGTYTFQVQNNVGKSSCTAVVDVSDRMVPP---SFTRRLK-DTGGVLGTSCILEC-----------KVAGSSPISIAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGSYTCVAANVAGSDECRALLTV---------QEPPSFVKEPEPLEVLP-GKNITFTSVIRGTPPFKVGWFRGARELVKGNRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPATFVKKLSDHSVEPGKSIILEGTYTGTLPISVTWKKDGVSITPSER-------CNIVTTEKTCILEILSSTKGDAGHYSCEIENEAGRDACDALVSTLEPPYFVTELEPLEASVGDSVSLQCQVAGTPEITVSWFKGDTKLRSTPEYRTYFTNNVATLVFNKVSINDSGEYTCMAENSIGTAASKTI 6159          

HSP 12 Score: 73.1738 bits (178), Expect = 4.097e-12
Identity = 168/830 (20.24%), Postives = 323/830 (38.92%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV------SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSS----DVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIV-EINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRN---LVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDP---IGSVNT-----TKPLE--------KPIS------------------------FTIIPTERYQPADDNSDISSPQRTQMIFSNT---IVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNP---RFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLPPETYSNLVKTHINDESRVMQASP 4871
            I W KD++ IL + D    +  + +     + + +     +G+Y C+ +N   + R  + +L+    Q+   +I K ++       +P++L+ V+ G    PE  + +      +  S   +S    N +  F  +SV  +D GQY F+V      SS D     L+    P F     K + +LG S+ +   +     +S +   W K+   ++T+   ++   ++N  +  E+         +YTC+VSN  G++       A   +++ +       KP     + D+             VEF A +       + WLKD+  L S             KC + + G+T +    Y     +TGQ    +  ++ P +F   ++    S   K   S  + C +   P    + +          RN   L  + +Y+M          ++  I++  +++ T D G++    +N AG +S    + V    E     + P  ++ L        N +V + C++SG P   + W K+  +L  S   K+        + I N + +D G Y  +A N  GS+   C +++ +P   I  +N+      +P E        +PIS                           +   + +PA+    I   +    +  N     V  P   +       V  G+   L+C + G PE  + W  +   + +    +F    ++    L + +++K D+G Y+   +N+ G ++C+A+V V         DR   PS ++ L  +    ++ T    E +V  +SP
Sbjct: 5085 ITWLKDDQ-ILEENDN---VHISFEDSVATLQVRSVDNGHSGRYTCQAKNESGIERCYAFLLV----QEPAQIIEK-AKSVDVTEKDPVTLECVVAG---TPELKVKWLKDGKQIVPSRY-FSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQDIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQ---WFKDGKEISTSA-KYRLVCHEN-TVSLEVSNLELEDTANYTCKVSNVAGDN-------ACSGILTVKEPPSFLVKPERQQAIPDS------------TVEFKAVLKGTPPFKIKWLKDDVELVSG-----------PKCFIGLEGST-SFLNLYSVDSSKTGQYTCQVTNDVEPPKF---VKKLEASKIIKAGDSARLECKITGSPEIQVVWY----------RNEHELTASDKYQMT------FIDSVAVIQM--NSLGTEDSGDFICEAQNPAGSTSCSTKVIVK---EPPVFSSFPPIVETLK-------NTEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKVASKNFHASIHILNVESTDIGEYHCKAQNEVGSDACVCAVKLKEPPKFISKLNSLTVVAGEPAELQASIEGAQPISVQWLKEKEEVIRESENIRISFVNNVATLQFAKVEPANAGKYICQVKNDGGVRENMATLTVLEPAVIIEKAGSMTVTVGETCALECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISS--LKILSVEKEDAGTYTFQVQNNVGKSSCTAVVDVS--------DRMVPPSFTRRL--KDTGGVLGTSCILECKVAGSSP 5822          

HSP 13 Score: 73.1738 bits (178), Expect = 4.308e-12
Identity = 139/669 (20.78%), Postives = 249/669 (37.22%), Query Frame = 3
Query: 2985 DVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVW-LKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPR-FEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLPPETYSNLVKTHINDESRVMQASPRGWQEFQFHSNASTLRSSKNDIFEQELPVDKDVS 4973
            D G Y    ++K        HL + E P FV     ++   G  + +   +      +P TI W K+   L     + ++   D+   + E+     A  G Y CQ+SN+ G               SS+  I V   P    + S   V  + G S   + +        V W L  N+  + R   I      +   + +I+ A V +SGTY    +    T +  +E+  ++  P+     + +   ++  + + C V+ + P    + W            L NN   +   K    ++  M    L+      SD GEY   + N  G  +    + +         K  P FI+K++  + + +      +  V+G+P   + W+K+ + L E+D++ I        L +++     +G Y  QA N +G  + +C+                    +F ++                             + P Q +       V E D V L+C + G PE  + W  +   I   R F M  E +     ++++ K DSG+Y+   EN  G ++C A + V        +D+   PS +K L       ++ + I+ E +V  + P   Q F+     ST  S+K  +   E  V  +VS
Sbjct: 4747 DSGTYTCSATNKAGHSQCSGHLTVKEPPYFVEKPQSQDVNPGTRVQLKALVGG---TAPMTIKWFKDNKELHPG--AARSVWKDDTSTILELFSAKAADSGTYICQLSNDVG-------------TTSSKATIFVKEPPQFIKKPSPVLVLRN-GQSTTFECQVTGTPEIRVSWYLDGNEITDLRKYGISFV---DGLATFQISNARVENSGTYVCEARNDAGTASCSIELK-VKEPPIFIRELEPVEVVKDSDVELECEVMGTTP--FEVTW------------LKNNKEIRSGKK--YTMSEKMSVFYLHITKCDPSDVGEYQCIIANEGGSCACSARVAL---------KEPPSFIKKIEN-VTTVLKSSATFQSTVAGSPPISITWLKDDQILEENDNVHISFEDSVATLQVRSVDNGHSGRYTCQAKNESG--IERCY--------------------AFLLV-----------------------------QEPAQIIEKAKSVDVTEKDPVTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRV--------LDQDIPPSFTKKL--TKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEIST--SAKYRLVCHENTVSLEVS 5303          

HSP 14 Score: 71.2478 bits (173), Expect = 1.965e-11
Identity = 48/162 (29.63%), Postives = 79/162 (48.77%), Query Frame = 3
Query: 3843 YKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRV--ENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG 4322
            Y+  ++P ++ T      +L        +G +Y  RV   N+ G   V +P     + EA+ +   PK +  + ++I     +K+ V   V G PNPI KW K  +E+  S HL I K   +  L+IK+  + D+G Y   A N++GS+  K  + V+D  G
Sbjct: 18880 YREEDQPADRWTEYSVVKDLSLIVTGLKEGKKYKFRVAARNAVG---VSMPREAEGVYEAKEQLLPPKIL--MPEQITIKAGKKLRVEAHVYGKPNPICKWKKGDDEVVTSSHLAIHKADGSSVLIIKDVTRKDSGYYSLTAENSSGSDTQKIKVTVMDAPG 19036          

HSP 15 Score: 69.3218 bits (168), Expect = 6.740e-11
Identity = 81/325 (24.92%), Postives = 134/325 (41.23%), Query Frame = 3
Query: 3768 SCHSINWSIKPADG-SPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRV--ENSAG---WSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRK---VGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI-NNPRFEMKRELDEYFLILKN-IQKGDSGRYSITAENSSGL 4709
            SC  + W    +DG +  RN     R K  NK +   T  ++       N+   +G EY  RV  EN  G   WS +  P+T  +    Q    +P F ++L    +   +   +V CKV+G+P PI+KW + G+E+  +D LK R     G  H+L+I +    DA +Y+ +A+N  GS      L+V  P                              + I  P+  + + +   +R                G+ V +K    G P+P+I W      I NN  +++        L+  N +++ D+G Y + A+N  G+
Sbjct: 30883 SC-VVAWKPPASDGGAKIRNYYLERREKKQNKWIAVTTEEIRETVFSVQNLI--EGLEYEFRVKCENLGGESEWSEISEPVTPKSDVPIQ----APHFKEELRNLNVRYQSNATLV-CKVTGHPKPIVKWYRQGKEII-ADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVP------------------------------AKIHLPKTLEGMGAVHALR----------------GEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFSNGVERKDAGFYVVCAKNRFGI 31152          

HSP 16 Score: 68.5514 bits (166), Expect = 1.192e-10
Identity = 181/855 (21.17%), Postives = 308/855 (36.02%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCN--SQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKL---VLDGFKYAPESDLIFNNMPINVNHSSCP-WSKVSSNEMIQFNHRSVSLKDVGQYLFRVS---SKDVAKTHLEIGEK---PEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN----------SRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-----VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSV----NTTKPLEKPISFTIIPTERYQP--------------ADDNSDIS-----------SPQRTQ----------------------MIFSNTIVRSP-PQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLPPETYSNLVKTHINDESRVMQASP--RGW 4880
            + W KD  +I P        +CN  +      + I +  + DAG Y CE+ N     R +   L+S       T+ P +    F    EPL   +   V    + A   ++  +    +    S P +    +N +       VS+ D G+Y            +KT   I E+   P F          +G  + ++      +  +P  + W ++   L  ++    +++++   L  +I +   +H G Y+C  SN  G      +L+A E   S    I    KP+S   ++        G+S   +          V W KDN+ +              P ++I         LK+      DSG Y       V K+    Q ++ E  P +F   I+    S  AKQ  SI + C ++  P    + W    ++      L  + +Y M    +N +        L  +  +  D G+Y     N  G +S    + V         K  P F QK    + +     VI++C++SG P   + W+K+ +++  S   KI        L I N +  D G Y  +A+N  GS+   C ++  +P   V    + +  +  P+    +  E +QP                +N  IS           SP+ +Q                      ++   TIV  P P  VTT        G+   L+C + G PE    W+       +  R  +    +   L + + +  D G Y+   EN  G ++C+  V        H  DR   PS  + L  +  S  +   +  E RV  ++P   GW
Sbjct: 6011 VTWKKDGVSITPS------ERCNIVTTEKTCILEILSSTKGDAGHYSCEIEN--EAGRDACDALVS-------TLEPPY----FVTELEPLEASVGDSVSLQCQVAGTPEITVSWFKGDTKLRSTPEYRTYFTNNVATLVFNKVSINDSGEYTCMAENSIGTAASKTIFRIQERQLPPSFARQLKDIEQTVGLPVTLTC---RLNGSAPIQVCWYRDGVLLRDDENLQMSFVDNVATL--KILQTDLSHSGQYSCSASNPLGTASSTARLTAREPKKSPFFDI----KPVSIDVIA--------GESADFECHVTGAQPMRVTWSKDNKEIRPGGNYTITCVGNTPHLRI---------LKVGKG---DSGQYTCQATNDVGKDMCSAQLSVKE--PPKF---IKKLDASKVAKQGESIQLECKISGSPEIKVV-WFRNDSE------LHESWKYNM--SFVNSVA------LLTINEASAEDTGDYICEAHNGVGDASCSTALKV---------KAPPVFTQK-PPPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDTCACTVKFKEPPRFVKKLSDASTLIGDPVELQAV-VEGFQPISVVWLKDKGEVIRESENVRISFVDNIATLQLGSPEASQSGKYVCQIKNDAGMRECSAVLTVLEPATIVEKPEPMTVTT--------GNPFTLECVVAGTPELSAKWFKDGRELSSGSRHHITFVRNLASLKIPSAEMNDKGLYTFEVENRVGKSSCTVSV--------HVSDRVVPPSFVRRL--KDTSATLGASVVLECRVSGSAPISVGW 6768          

HSP 17 Score: 65.4698 bits (158), Expect = 8.620e-10
Identity = 45/138 (32.61%), Postives = 64/138 (46.38%), Query Frame = 3
Query: 3897 ELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVG-ETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV 4307
            +L  ++VTT D  EY +   N  G  S    +TV            P F ++L         + V    +VSG P P LKW K+G+ LS   H++I   G + + L I++    D G Y   A+NT GS   + HLQV
Sbjct: 31791 QLTINSVTTDDDAEYTVVARNKHGEDSCKAKLTVTLHPPPTETTLRPMF-KRLLANAECHEGQSVCFEIRVSGIPAPTLKWEKDGQPLSLGPHIEIVHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 31927          

HSP 18 Score: 65.0846 bits (157), Expect = 1.236e-9
Identity = 116/512 (22.66%), Postives = 183/512 (35.74%), Query Frame = 3
Query: 3276 GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-----VLKETGQTQTTIVE-INPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWSIKPADGSPTRN----LVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVID--PIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNT--HFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSID 4766
            G Y+C  +N  G        S A+ +++     P    P++        +   VG+S  L+          V W KDN+ + S     QI Y E S   L I      DSG Y       V K++   Q  I E + P  F    +   +++   +  S  +   V  S P   ++ W     +  PT N      NNA                  + L     + +D G Y  +  N AG +     I +      +  K  P F Q L   + +   + V + C V G+    ++W+K G E+  SD         T  L +K   K+D+G Y  +ASN  GS+ SKC + + +            ++  + F                +S PQ  +++   T          TF   I K G D          P P + W+           R  + ++ DE  L +++  K DSG Y   A N  G    +  + VD   K   I+
Sbjct: 8119 GQYSCTATNPIGS-----ASSGAKLILTEGKNPPFFDIPLAP-------MDAVVGESADLECHVTGTQPIKVTWAKDNREIRSGG-NYQISYLENS-AHLTIVKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFT---KKLSETVEETEGNSFKLEGRVAGSQPI--TVAWYKNNVEIHPTSNCEIMFKNNA------------------LLLQVKRASMADAGLYTCKATNDAGSALCTSSIVI------KEPKKPPVFDQHL-APVTASEGDSVQLSCHVQGSEPIRIQWLKAGREVKPSDRCSFSFASGTAMLELKETAKADSGDYVCKASNVAGSDTSKCKVTIKEKPAAAPAAKKAAVDGKLFF----------------VSEPQSIRVVEKTT---------ATF---IAKVGGD----------PIPNVKWTKGKWRQLNQGGRILIHQKGDEAKLEIRDTTKTDSGLYRCVAFNKHGEIESNVNLQVDERKKQEKIE 8548          

HSP 19 Score: 63.1586 bits (152), Expect = 5.055e-9
Identity = 38/139 (27.34%), Postives = 66/139 (47.48%), Query Frame = 3
Query: 3891 RIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV 4307
            R  L    VT ++ G Y LR  N +G ++    + V A      +   P F Q+L    +     +V ++ +V+G P P++K+ ++G E+  S   +I + G+ + L+I      D+G Y   A+N+ G   S   L V
Sbjct:   62 RARLMIPAVTKANSGRYSLRATNGSGQATSTAELLVTA------ETAPPNFSQRLQSMTVRQ-GSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELVV 193          

HSP 20 Score: 62.7734 bits (151), Expect = 6.500e-9
Identity = 81/383 (21.15%), Postives = 139/383 (36.29%), Query Frame = 3
Query: 3657 VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQN----------KKTSPKFIQKLDKEIISP-------INEKVIVRCKVSGNPNPILKWMKNGEELSESDHLK---IRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRE-LDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVD 4739
            V++  I+  PV      +I  ++ G +  VC + +Y     + W          R L N+ +Y+        +T       +Y  ++T  D G Y  +V N  G  S    + V  + E  +          ++T    + +   E   P       + E V     ++ +P P + W K+G+++   D  K          ++L I +    D   Y   A N +G +  K  L V            L  P      PTE                       T +R  P F     +    EG  V  +  + G P P + W  +   ++  P  E+  E LD Y L +++    D+G Y +TA N++G  +C A + V+
Sbjct: 31603 VKVASIEIGPVSGQIMHAI-GEEGGYVKYVCKIENYDQSTQVTWYFG------VRQLENSEKYE--------ITYEDGVATMYVKDITKFDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTKKVKRRTDAMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPRVTWYKSGQKIKPGDDEKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKHGEDSCKAKLTVT-----------LHPP------PTE-----------------------TTLR--PMFKRLLANAECHEGQSVCFEIRVSGIPAPTLKWEKDGQPLSLGPHIEIVHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVE 31928          

HSP 21 Score: 62.3882 bits (150), Expect = 9.479e-9
Identity = 77/309 (24.92%), Postives = 129/309 (41.75%), Query Frame = 3
Query: 3924 SDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIK--NCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSP------------QRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCL--IGYPEPLIWWSYNTHFINNP-RFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPL 4799
            SD GE+ +  +N AG S++ + +TV    EA   +  P F++KL K +      ++ ++ + +GNPNP + W+KN + +    + +IR  G   E  +K  +    D+  Y A A N  G + ++C + V      V   +P  +P    IIP   Y+      +I++P            Q  +    +   +  P F    T   +K       +C L  IG P  ++ W ++   +    R  M  E     L        DSG  +  A N  G    SA +IV   ++   ++ SQ P   K L
Sbjct: 1529 SDSGEWTVVAQNRAGKSTISVTLTV----EAVEHQIKPAFVEKL-KNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPRIRIEGTRGEAALKIDSIISQDSAWYTATAINKAGRDTTRCKVNV-----EVEFAEP--EPERKLIIPRGTYR----AKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGAAYSRDSGVITCRATNKYGTDHTSATLIV--KDEKSLVEESQLPDGKKGL 1819          

HSP 22 Score: 61.6178 bits (148), Expect = 1.635e-8
Identity = 154/794 (19.40%), Postives = 287/794 (36.15%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEI--NPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPAD----------------------------------------------DNSDISSPQ--RTQMIFSNTIV-----RSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYF---------LILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            + ++W+K +  ++      I L+        ++ +       +G Y C V N       S+     +F ++  T + + ++ +    + P+ L+    G      S  + N  P++    +C  +    + +++    ++  +D  QY   +   + +D+ +  + + E P F+       + +G+ + +   +    ++    I W K  T L +       + N+   LV  I K   + VG+YTC+  N  G       ++++  L+  +  +P    P  + +L D + T  +G  +  +          V W KD + L   D  +Q+ +      +L+I     +  G Y         T ++  ++  +  +  P     P S+      S +  C V        I W+         R +     YKM       L  N   + +    V   D G+Y     N AG  S    + V         +  P+FI+KLD+  I   +E     CK+ G+P   + W K+  E+ ES   ++        L + +    D+G Y  +A N  GS  S   L+V +P   V   KP          P E  + AD                                              D +DI   Q   T  + S+T V     ++PPQFV   TD     G +V L+  + G     + W  +       + E+ RE D  +         L     +  ++G+Y+   +N +G+  C A + V
Sbjct: 6857 FKVKWFKGSRELVSGEACTISLE----DFVTELELLEVEPGQSGDYSCLVTNDAG----SASCTTHLFVKEPATFVKRLADTSVETGS-PIVLEATYSGTPPISVS-WMKNEYPLS-QSPNCGITTTEKSSILEILESTI--EDYAQYACLIENEAGQDICEALVSVLEPPYFIEPLEHVEAAIGEPITLQCKVDGTPEIR---ISWYKEHTKLRSAPAYKMQFKNNVASLV--INKVDHSDVGEYTCKAENSVG------AVASSAVLVIKERKLP----PSFARKLKDVHET--LGFPVAFECRINGSEPLQVSWYKDGELLKD-DANLQMSFVHHV-ATLQILQTDQSHVGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGSFKCHVTGTAPIK-ITWA------KDNREIRPGGNYKMT------LVENTATLTVL--KVAKGDAGQYTCYASNVAGKDSCSAQLGV---------QEPPRFIKKLDQSRIVKQDEYTRYECKIGGSPEIKVLWYKDEVEIQESSKFRMSFEDSVAILEMHSLSVEDSGDYTCEARNAAGSASSSTSLKVKEP--PVFRKKPF---------PVETLKGADVHLECELQGTPPFQVSWHKDKRELRSGKKYKIMSENLLTSIHILNVDTADIGEYQCKATNDVGSDTCVGSVTMKAPPQFVKKLTDISTIIGKEVQLQTTIEGAEPISVAWFKD-------KGEIVRESDNIWISYSENIATLQFSRAEPANAGKYTCQIKNDAGMQECYATLSV 7576          

HSP 23 Score: 61.2326 bits (147), Expect = 1.869e-8
Identity = 54/251 (21.51%), Postives = 104/251 (41.43%), Query Frame = 3
Query: 3993 TVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFT-IIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWW-SYNTHFINNPRFEMK--RELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVI 4733
            T    A A+   T P  +  L K +     E V + C +SG P+P + W +   ++  S   +I   G    L+I+     D+G +   A N  G+  + C+L       +V  ++  +K  + T    TE  +  +    + +        +     + P F++    + + EG  VV +C + G P+P ++W           R+++   ++  E  L++      D+G Y+I   N  G  + SA ++
Sbjct:  932 TARVPAPAEVPVTPPTLVSGL-KNVTVIEGESVTLECHISGYPSPKVTWYREDYQIESSIDFQITFQGGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYL-------AVQVSEEFDKETTLTEKFATEEKRFVESRDVVMTDTSITEEQAGPGEPAAPFFISKPVVQKLVEGGSVVFECQIGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECRLVISMTFADDAGEYTIVIRNKHGETSASASLL 1174          

HSP 24 Score: 60.4622 bits (145), Expect = 3.447e-8
Identity = 116/527 (22.01%), Postives = 204/527 (38.71%), Query Frame = 3
Query: 3372 IPVSAKPISSSQLSDNYVTGSVGDSIKLD--VEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPV-------------IQDFPQSIRAKQNGSIN----------IVCVVNSYPSCHSI-NWSIKPADGSPTRNLVNNARYKMINKPLN-KLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAG------IYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTI--------------IP-TERYQPADDNSDIS-----SPQRTQMIF------SNTIVRS------------PPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +PVSA P    +++ +    +  D  KL   VE  A  + +V W KD + L   +   Q +Y  +    LKI+  + +D G Y   +   G T  T  +     F  +             +Q   +S  AK+   I           +  + ++  S  S+  ++IK   G P   +      K I +    KL+ N +   L      TSDGG Y   V NSAG  S    +T+ A+ + + +K S +   ++  +  +   E++  +   S      +K      E+   + L I++   +  L+ +  K+S A       ++E     +  SE  K H ++      +N TK     +   I              +P +E Y+     SD +     +  R + I       S  +V+              P F+T    + + EG +V+  C + G P P I W+  N     +    + R  + Y L ++N    DSG+Y+I A+N  G  + +A + V
Sbjct: 32755 LPVSAPP----KITQSLKAEASKDIAKLTCAVESSALCAKEVAWYKDGKKLK-ENGHFQFHYSADGTYELKIHNLSESDCGEYVCEVSGEGGTSKTSFQFTGQSFKSIHEQVSSISETTKSVQKTAESAEAKKQEPIAPESISSKPVIVTGLRDTTVSSDSVAKFTIK-VTGEPQPTITWTKDGKAIAQGSKYKLSSNKEEFILEILKTETSDGGLYACTVTNSAGSVSSSCKLTIKAVKDTEAQKVSTQKTSEVTSQKKASAQEEISQKALTSEE----IKM----SEVKSHETLAIKEEA-SKVLIAEEVKRSAAASLEKSIVHEEVTKTSQASEEVKTHAEIKTLSTQMNITKGQRATLKANIAGATDVKWVLNGTELPNSEEYRYGVSGSDQTLTIKQASHREEGILSCIGKTSQGVVKCQFDLTLSEELSDAPSFITQPRSQNINEGQNVLFSCEVSGEPSPEIEWFKNNLPISISSNISVSRSRNVYTLEIRNAAVSDSGKYTIKAKNFHGQCSATASLTV 33266          

HSP 25 Score: 56.225 bits (134), Expect = 5.763e-7
Identity = 49/158 (31.01%), Postives = 64/158 (40.51%), Query Frame = 3
Query: 3906 FDNVTTS--DGGEYCLRV--EN--SAGWSSVMIPITVAALAEAQNKKTSP------KFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVID----PIGSVN 4331
             D V T    G  Y  RV  EN    G     IPI      E Q K   P      K I+ L  +  + +    I+R    G P P  KW  +G E+   DH  +     +  L IKNC + D G Y+   SN  G++    HL V+D    P G +N
Sbjct: 17508 LDCVVTGLQQGKTYRFRVKAENIIGLGLPDTTIPI------ECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIR----GVPVPTAKWTTDGTEIKTDDHYTVETDSFSSVLTIKNCLRKDTGEYQLTVSNAAGTKTVAVHLTVLDVPGPPTGPIN 17655          

HSP 26 Score: 55.4546 bits (132), Expect = 9.449e-7
Identity = 47/206 (22.82%), Postives = 88/206 (42.72%), Query Frame = 3
Query: 4131 LKWMKNGEELSESDHLKIRKVGE-THELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI-NNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDS 4742
            + W K+G++L E+ H +     + T+EL I N  +SD G Y  + S   G+  SK   Q         + K + + +S     T+  Q   ++++     + Q   +   + S P  VT   D  V           + G P+P I W+ +   I    ++++    +E+ L +   +  D G Y+ T  NS+G  + S  + + +
Sbjct: 32792 VAWYKDGKKLKENGHFQFHYSADGTYELKIHNLSESDCGEYVCEVSGEGGT--SKTSFQFTG-----QSFKSIHEQVSSISETTKSVQKTAESAE----AKKQEPIAPESISSKPVIVTGLRDTTVSSDSVAKFTIKVTGEPQPTITWTKDGKAIAQGSKYKLSSNKEEFILEILKTETSDGGLYACTVTNSAGSVSSSCKLTIKA 32986          

HSP 27 Score: 54.299 bits (129), Expect = 2.499e-6
Identity = 63/286 (22.03%), Postives = 112/286 (39.16%), Query Frame = 3
Query: 3927 DGGEYCLRV--ENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKE------GDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYF--LILKNIQ-KGDSGRYSITAENSSGLATCSALVIVDSHNK 4751
            +  EY  RV  EN  G S    P   A   + +        ++K   ++ + + E   + C++ G P P +KW + G+EL +S   K+   G TH L +   ++ D G+Y   A+N                +G V ++                                    S  ++++ PQF   +    +KE      G  + L    IG P P + W +    + N   ++  E  E++  L++KN+Q K  +G+Y +   N+ G  T  A + V+  +K
Sbjct: 30540 EATEYEFRVFAENETGLSR---PRRTAMSVKTKLTSGEAPGVRKEMADVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTDEQEDEGVYTCVATNE---------------VGEVESS------------------------------------SKLLLQAAPQFHPGYP---LKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSE-KITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNAFG--TVDATLDVEIQDK 30765          

HSP 28 Score: 53.9138 bits (128), Expect = 2.786e-6
Identity = 59/282 (20.92%), Postives = 100/282 (35.46%), Query Frame = 3
Query: 3900 LYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKV-SGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDS 4742
            ++      SD GEY       AG +   + + V       N    P+ +Q+L    +   + K    C V SG P P + W K  + LS     K    G+ + L++      DA +Y  +A N  G   +   L V  P                               ++ SP +   ++       PP  VT   D +  EG     +C + G    + W+  +     +  F M +  D Y L +      D G Y+  A N+ G  + +A + +++
Sbjct: 3211 MFISETRHSDAGEYTF----VAGRNRSSVTLYV-------NAPEPPQVLQELQPVTVQ--SGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVP-------------------------------EVVSPDQEMPVY-------PPAIVTPLQDTVTSEGRPARFQCQVSGTDLKVSWYCKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYAFVANNAVGQVSSTATLRLEA 3441          

HSP 29 Score: 53.9138 bits (128), Expect = 3.350e-6
Identity = 52/187 (27.81%), Postives = 79/187 (42.25%), Query Frame = 3
Query: 3894 IELYFDNVTTSDGGEYCLRV--ENSAGW----SSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPA------DDNSDIS 4418
            IE  F     ++   Y  RV  +N+AG     S    PIT     E       PKF       I+    E   +   V G P P ++W++  +E+ ES   +I+       L++K+  + D G Y  +ASN  GS+    +++V+D  G      P E P+  T +  E+   A      D  SDIS
Sbjct: 23619 IETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKF----RDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPG------PPEGPVQVTGVTAEKCTLAWSPPLQDGGSDIS 23795          

HSP 30 Score: 53.1434 bits (126), Expect = 5.924e-6
Identity = 36/133 (27.07%), Postives = 62/133 (46.62%), Query Frame = 3
Query: 3990 ITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESD-HLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTER 4385
            IT     +A N    PK+       II    E  ++   + G P P + W K+G EL E+   ++I+   +   L++K+C ++D G Y  + SN  G++     ++V+D  G      P E P+  T +  E+
Sbjct: 24739 ITARDEIDAPNASLDPKY----RDVIIVHAGETFVLEADIRGKPIPDIIWSKDGNELEETAARMEIKSTLQKTTLIVKDCIRTDGGQYTLKLSNVGGTKTIPITVKVLDRPG------PPEGPLKVTGVTAEK 24861          

HSP 31 Score: 52.7582 bits (125), Expect = 6.442e-6
Identity = 35/144 (24.31%), Postives = 59/144 (40.97%), Query Frame = 3
Query: 3897 ELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQ--KLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG 4322
            E YF+    ++   Y  RV       SV  P         ++   +P+ +   K    II    E + +   ++G P P++ W K+G E+ E    +I     T  L +K+C + D G Y     N  G+     + +V+D  G
Sbjct: 25784 ETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPITVKDDVEAPRIMMDVKFRDVIIVKAGEVLKINADIAGRPLPVISWAKDGVEIEERAKTEIVSTDYTTTLTVKDCVRRDTGQYVLTLKNVAGTRTMAVNCKVLDKPG 25927          
BLAST of Fibronectin type III domain-containing protein vs. Ensembl Mouse
Match: Ttn (titin [Source:MGI Symbol;Acc:MGI:98864])

HSP 1 Score: 122.479 bits (306), Expect = 4.787e-27
Identity = 175/773 (22.64%), Postives = 304/773 (39.33%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTY--INDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE----KPISFT-------------------IIPTERYQPADDNS---------DISSPQRTQMIFSN----------TIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYN-THFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            I W KDN  I P  + ++ L  N+ +    + +    + DAGQY C   N     + S    L V  Q+    I K  +       E    +  + G   +PE  +++    + +  SS  +     + +      S+S++D G Y       +    + T L++ E P F    F   +L G  + +   ++      P  + W K+K  L     S K Y  +++N      I     A +G+Y C+ +N+ G D            + S T+    A P    +L+D  ++  +G  ++L           V W KD   +      I I Y  E+  +L+ + A   ++G Y   +K     Q     ++ ++ A +++  P+SI+     +  + C V+  P   S  W     DG   + L ++ +YK+     NK++G      L   NV   D G Y   V+N  G  S  + I V+      ++   P F +KL KE        V++ CKV G+P   + W  +G E+S     +      T  L +   +++DAG Y   A+N  GS+     L V +P   V    P++      ++FT                   ++P  R   +  +S         D S       I SN            V++P  FV    D  +++G  ++L+    G P   + W  N  + I + R  +        L + +    DSG+Y+   EN+SG  +CSA +++
Sbjct: 3908 ITWAKDNREIRPGGNYKMTLVENTAT----LTVLKVAKGDAGQYTCYASNVAG--KDSCSAQLGV--QEPPRFIKKLDQSRIVKQDEYTRYECKIGG---SPEIKVLWYKDEVEIQESS-KFRMSFEDSVAILEMHSLSVEDSGDYTCEARNAAGSASSSTSLKVKEPPVFRKKPFPVETLKGADVHLECELQG---TPPFQVSWHKDKRELR----SGKKYKIMSENLLTSIHILNVDTADIGEYQCKATNDVGSDTC----------VGSVTM---KAPPQFVKKLTD--ISTIIGKEVQLQTTIEGAEPISVAWFKDKGEIVRESDNIWISY-SENIATLQFSRAEPANAGKYTCQIKNDAGMQECYATLSVLEPAAIVEK-PESIKVTTGDTCTLECTVSGTPEL-STKWF---KDG---KELTSDNKYKISF--FNKVSG------LKIINVVPGDSGVYSFEVQNPVGKDSCKVSIQVS------DRIIPPSFTRKL-KETNGLSGSSVVMECKVYGSPPISVLWFHDGNEISSGRKYQTTLTDNTCALTVNMLEEADAGDYTCIATNVAGSDECSAPLTVREPPSFVQKPDPMDVLTGSNVTFTSIVKGSPPFTVSWFKGSTELVPGARCNVSLQDSVGELELFDVDTSQSGEYTCIVSNEAGRASCTTRLFVKAPAIFVKRLNDYSIEKGKPLILEGTFSGTPPISVTWKKNGINVIASQRCNITTTEKSAILEILSSTVEDSGQYNCYIENASGKDSCSAQILI 4622          

HSP 2 Score: 105.531 bits (262), Expect = 6.572e-22
Identity = 189/840 (22.50%), Postives = 321/840 (38.21%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQ-FNHRSVSLKDVGQYLFRVSSKDVAKTH-------LEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKE---TGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNG-SINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDK-EIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSV----NTTKPLEK------------PISFTIIPTERYQPADDNSDIS--------------------------SPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPR-FEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLPPETYSNLVKTHINDESRVMQASPRGWQEFQFHSNAST 4913
            + W KDN+ I  D + R+  + N  S    +++        G+Y C+ +N   + R S+  LLSV   K+   I + +        +P +L++   G K    +    +   + +     P  K+S  + +      S   KD G+Y F V + DV ++        L++   P F     K +S+ G  + +   +   H   P +I W K+   ++ +   HK   +DN     EI +      G YTC  +N+ G       L+  E     +        P +  QL    V G+   +IK              W KDN+ L+    R    + +++   L++  A   DSGTY   L     T  ++ TI    P QF       P  +   +NG S    C V   P    ++W +   DG    N + + R   I+         +   ++   N    + G Y     N AG +S  I + V         K  P FI++L+  E++   +  V + C+V G     + W+KN +E+       + +      L I  C  SD G Y+   +N  GS      + + +P   +    N T  L+             PIS T +  ++    +DN  IS                          +    +  ++  +V+ P Q +       V E D V L+C + G PE  + W  +   I   R F M  E +     ++++ K DSG+Y+   EN  G ++C A + V        +D+   PS +K L       ++ + I+ E +V  + P   Q F+     ST
Sbjct: 1182 VTWLKDNDEITEDDNIRMTFENNVAS----LYLSGIEVKHDGKYVCQAKNDAGIQRCSA--LLSV---KEPATIMEEAVSIDVTQGDPATLQVKFSGTKEI-SAKWFKDGQELTLG----PKYKISVTDTVSILKIISTEKKDSGEYTFEVQN-DVGRSSCKASINVLDLIIPPSFTKKLRKMDSIKGSFIDLECIVAGSH---PISIQWFKDDQEISASD-KHKFSFHDNTAF-LEISQLEGTDSGTYTCSATNKAGHSQCSGHLTVKEPPYFVEKPQSQDVNPGTRVQLK-ALVGGTAPMTIK--------------WFKDNKELHPGAARS--VWKDDTSTILELFSAKAADSGTYICQLSNDVGTTSSKATIFVKEPPQFI----KKPSPVLVLRNGQSTTFECQVTGTPEIR-VSWYL---DG----NEITDLRKYGIS-----FVDGLATFQI--SNARVENSGTYVCEARNDAGTASCSIELKV---------KEPPIFIRELEPVEVVK--DSDVELECEVMGTTPFEVTWLKNNKEIRSGKKYTMSEKMSVFYLHITKCDPSDVGEYQCIIANEGGSCACSARVALKEPPSFIKKIENVTTVLKSSATFQSTVAGSPPISITWLKDDQILEENDNVHISFEDSVATLQVRSVDNGHSGRYTCQAKNESGIERCYAFLLVQEPAQIIEKAKSVDVTEKDPVTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRV--------LDQDIPPSFTKKL--TKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEIST 1944          

HSP 3 Score: 93.2041 bits (230), Expect = 3.962e-18
Identity = 165/763 (21.63%), Postives = 291/763 (38.14%), Query Frame = 3
Query: 2652 MHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLS---VFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHK-TYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQ-AVLKETGQTQTTIV-----EINPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG--------SVNTTKPL--------EKPISFTIIPTERYQPADDNSDISSPQRTQM--IFSNTI------------------------VRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDR 4769
            + I+     D G Y CE  NG      S+ + +    VF+QK   V         A     + L+  + G    P  ++++      V  SS  +   S N     +  ++   D+G+Y  + +++   D     ++  E P FV      ++L+GD + +   ++ F    P +++W K+K  +     + + +++++   L    P+ +Q+  G Y CQ+ N+ G      + SA   ++   T++    KP          +T + G+   L+            W KD + L+S   R  I +   +  SLKI  A +ND G Y   V    G++  T+       + P  F   ++D   ++ A    S+ + C V  S P   S+ W +   DG+           ++I+ P  + +       L   ++  SD G Y     N AG       +TV         +  P F Q  D   + P    +     + G P   +KW K   EL   +   I       EL +   +   +G Y    +N  GS     HL V +P          SV T  P+          PIS + +  E       N  I++ +++ +  I  +TI                        V  PP F+          G+ + L+C + G PE  I W+  +T   + P ++M+ + +   L++  +   D G Y+  AENS G    SA++++       S  R
Sbjct: 3087 LTINEASAEDTGDYICEAHNGVGDASCSTALKVKAPPVFTQKPPPV--------GALKGSDVILQCEISG---TPPFEVVWVKDRKQV-RSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDTCACTVKFKEPPRFVKKLSDASTLIGDPVELQAVVEGFQ---PISVVWLKDKGEVIRESENVRISFVDNIATLQLGSPEASQS--GKYVCQIKNDAG----MRECSAVLTVLEPATIV---EKP--------EPMTVTTGNPFTLECVVAGTPELSAKWFKDGRELSSGS-RHHITF-VRNLASLKIPSAEMNDKGLYTFEVENRVGKSSCTVSVHVSDRVVPPSFVRRLKDTSATLGA----SVVLECRVSGSAP--ISVGWFL---DGN-----------EIISSPKCQSSFADNVCTLTLSSLEPSDTGAYTCVAANVAGQDESSAVLTV---------QEPPSFEQTPDSVEVLP-GMSLTFTSVIRGTPPFKVKWFKGSRELVSGEACTISLEDFVTELELLEVEPGQSGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADTSVETGSPIVLEATYSGTPPISVSWMKNEYPLSQSPNCGITTTEKSSILEILESTIEDYAQYACLIENEAGQDICEALVSVLEPPYFIEPLEHVEAAIGEPITLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYTCKAENSVGAVASSAVLVIKERKLPPSFAR 3785          

HSP 4 Score: 90.5077 bits (223), Expect = 2.232e-17
Identity = 113/499 (22.65%), Postives = 189/499 (37.88%), Query Frame = 3
Query: 3243 FEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
             EI  F  A VGDY C V+NE G    K    A   L    T +          +  D++ T   G ++ L           V+W+K  Q +   D +I++ +       L I    ++  G Y  + +    +QT++ E+   + A +I+   + I+        +   V+  P        +KP      R LV + +Y++  K       N+ +++ Y  +    D G+Y   + N  G SS     TV       ++  +P F + L + + S +     + CK++G+    + W K+G+EL+ SD  +I  V  T  L I     +DAG +  +A+N+ GS+ S   L V +P                                                   P FVT      V  G  V LK    G  P  + W+  +   ++     + +E  E  L L  ++  DSG Y+    N +G   CSA + V
Sbjct:  553 LEISSFNSADVGDYECVVANEVG----KCGCVATHLLKEPPTFV----------KKVDDF-TALAGQTVTLQAAVRGSEPISVMWMK-GQEVIKEDGKIKMSF-SNGVAVLTIPDVQISLGGKYTCLAENEAGSQTSVGELIVKEPAKIIERA-ELIQVTAGDPATLEYTVSGTPE-------LKPKWYKDGRPLVASKKYRISFK------NNIAQLKFY--SAELHDSGQYTFEISNEVGSSSCETTFTVL------DRDIAPLFTKPL-RNVDSVVGGACRLDCKIAGSLPMRVSWFKDGKELTASDRYQIAFVEGTASLEISRVDMNDAGNFTCRATNSVGSKDSSGALIVQEP---------------------------------------------------PSFVTKPGSRDVLPGSAVCLKSAFQGSAPLTIKWFKGDKELVSGGSCYITKETSESSLELYAVKTSDSGTYTCKVSNVAGSVECSADLFV 960          

HSP 5 Score: 89.3521 bits (220), Expect = 5.479e-17
Identity = 182/802 (22.69%), Postives = 305/802 (38.03%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPW------SKVSSNEMIQFNHRS-------VSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELV-FEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDF---------PQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVI-VRCKVSGNPNPI-LKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQ-----------------------PA-------DDNS----------------------DISSPQRTQMIFSNTIVRSPPQFVTTFTDEIV-KEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLI-LKNIQKGDSGRYSITAENSSGLATCS 4721
            I+W+K ++ ++      I  + +  S    + +   + SD+G Y C+V N    +  S+     +F ++  T I K          EP  L    DG + A +   +    PI +      W       + SS   + F   +       V+++D G+Y+      +  D     + + E P F   +FK   +L +   +   +       P  I W K+ T L + +  +KT++ D  +LV  ++ KF  A  G+Y C+V+NE G      +++  E         P S   I   + + +   G+      L    P  V+    WLKDN  +   D  I++ + E +  SL ++G  V   G Y    K     Q     ++  + A ++++          P +++ K +G+  I           S  W     DG   + L    +YK+       +T  +  +++   +    D GEY   V+N  G SS    I V  L         P F +KL K  +  I    I + C V+G+ +PI ++W K+ +E+S SD  K      T  L I   + +D+G Y   A+N  G      HL V +P   V      EKP S  + P  R Q                       P        DD S                      D+ +      IF    V+ PPQF+   +  +V + G     +C + G PE  + W  + + I + R      +D      + N +  +SG Y   A N +G A+CS
Sbjct:  902 IKWFKGDKELVSGGSCYITKETSESS----LELYAVKTSDSGTYTCKVSNVAGSVECSA----DLFVKEPATFIEKL---------EPSQLLKKGDGTQLACK---VTGTPPIKIT-----WFANDRELRESSKHKMSFAESTAVLRLTDVAIEDSGEYMCEAQNEAGSDHCTGIVIVKESPYFT-KEFKSIEVLKEYDVML--LAEVAGTPPFEITWFKDNTTLRSGR-KYKTFLQD--QLVSLQVLKFVAADAGEYQCRVTNEVGSSTCSARVTLRE---------PPSF--IKKIEATSSLRGGTAAFQATLKGSLPITVT----WLKDNDEITEDD-NIRMTF-ENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATIMEEAVSIDVTQGDPATLQVKFSGTKEI-----------SAKWF---KDG---QELTLGPKYKI------SVTDTVSILKII--STEKKDSGEYTFEVQNDVGRSSCKASINVLDLI------IPPSFTKKLRK--MDSIKGSFIDLECIVAGS-HPISIQWFKDDQEISASDKHKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHSQCSGHLTVKEPPYFV------EKPQSQDVNPGTRVQLKALVGGTAPMTIKWFKDNKELHPGAARSVWKDDTSTILELFSAKAADSGTYICQLSNDVGTTSSKATIF----VKEPPQFIKKPSPVLVLRNGQSTTFECQVTGTPEIRVSWYLDGNEITDLRKYGISFVDGLATFQISNARVENSGTYVCEARNDAGTASCS 1611          

HSP 6 Score: 86.2705 bits (212), Expect = 4.579e-16
Identity = 174/737 (23.61%), Postives = 281/737 (38.13%), Query Frame = 3
Query: 2553 QYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYA--PESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLF---RVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVL-----KETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFT--DEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSA 4724
            +   +W+KD + +  D   +I    N  SG   + I N    D+G Y  EV+N   V + S  V + V  +    + P F+ K    N    S  +V++   Y   P S L F++   N   S   +    ++         +   D G Y      V+  D     L + E P FV      + L G ++  +  +K      P T+ W K  T L      + +  +  GEL  E+     +  G+YTC VSNE G               S  T + V A  I   +L+D  +    G  + L+  F       V W K+   + +   R  I   E+S   L+I  +TV DSG Y   +     K++   Q  I+E  P  F   ++     ++     S ++ C +   P    ++W        PT      A  KM          N+    L F  V +SD GEY  R ENS G  S    +TV      Q +K  P F ++L +++   +   V+  C VSG+    + W K+G+ L +S +++   +     L I    +S +G Y   A+N               PIGS ++                                 ++I +    ++PP F       D +V E  D  L+C + G  P  + W   N    +   +++    +   L +  + KGDSG+Y+  A N  G  +C+A
Sbjct: 4279 ELSTKWFKDGKELTSDNKYKISF-FNKVSG---LKIINVVPGDSGVYSFEVQN--PVGKDSCKVSIQVSDR---IIPPSFTRKLKETNGLSGS-SVVMECKVYGSPPISVLWFHDG--NEISSGRKYQTTLTDNTCALTVNMLEEADAGDYTCIATNVAGSDECSAPLTVREPPSFVQKPDPMDVLTGSNVTFTSIVKG---SPPFTVSWFKGSTELVPGARCNVSLQDSVGEL--ELFDVDTSQSGEYTCIVSNEAGR-------------ASCTTRLFVKAPAIFVKRLNDYSIEK--GKPLILEGTFSGTPPISVTWKKNGINVIASQ-RCNITTTEKSAI-LEILSSTVEDSGQYNCYIENASGKDSCSAQILILE--PPYFVKQLE----PVKVTVGDSASLQCQLAGTPEI-GVSWYKGDTKLRPT------ATCKM------HFKNNVAT--LVFTQVDSSDSGEYICRAENSVGEVSSSTFLTV------QEQKLPPSFSRQL-RDVQETVGLPVVFECAVSGSEPISVSWYKDGKPLKDSPNIQTSFLDNIATLNIFKTDRSLSGQYSCTATN---------------PIGSASSG-------------------------------AKLILTEG--KNPPFFDIPLAPMDAVVGESAD--LECHVTGTQPIKVTWAKDNREIRSGGNYQISYLENSAHLTIVKVDKGDSGQYTCYAVNEVGKDSCTA 4903          

HSP 7 Score: 85.5001 bits (210), Expect = 7.326e-16
Identity = 178/764 (23.30%), Postives = 276/764 (36.13%), Query Frame = 3
Query: 2631 SQSGKMKMHIDNCRESDAGQYWCEVR---NGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQ--FAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWS-----IKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKP------------LEKPISFT-------------IIPTERYQPADDNSDIS-------SP-------QRTQMIFSNTIV-----RSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFIN---NPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            SQSG+    + N    +AGQ  C  R     P+   K     LS  S + G  I    E T+   T P+S+    DG    P          I     +C    +SS +            D G Y   +   + +D     +   E P FV       + +GDS+++   +    ++   T+ W K  T L +       + N+   LVF   K +    G+YTC   N  G    K         I  + L P  A+     QL D  +  +VG  + L           V W +D   L   D  +Q+ +  ++  +LKI    ++ SG Y         T ++   +   +   +P     P SI      S +  C V  + P    + WS     I+P  G+ T   V N  +  I K                  V   D G+Y  +  N  G       ++V         K  PKFI+KLD   ++   E + + CK+SG+P   + W +N  EL ES    +  V     L I      D G Y  +A N  G       L+V  P   V T KP            L+  IS T             +  +++++    N D S       +P       + T  + S+T       + PP+FV   +D     GD V L+  + G+ P  ++W       I    N R      +    L L + +   SG+Y    +N +G+  CSA++ V
Sbjct: 2623 SQSGEYTCVVSN----NAGQASCTTRLFVKEPATFVKK----LSDHSVEPGKSI--ILEGTYTG-TLPISVTWKKDGVSITPS-----ERCNIVTTEKTCILEILSSTK-----------GDAGHYSCEIENEAGRDACDALVSTLEPPYFVTELEPLEASVGDSVSLQCQVAGTPEI---TVSWFKGDTKLRSTPEYRTYFTNNVATLVFN--KVSINDSGEYTCMAENSIGTAASKTIFR-----IQERQLPPSFAR-----QLKD--IEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRD-DENLQMSF-VDNVATLKILQTDLSHSGQYSCSASNPLGTASSTARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQP--MRVTWSKDNKEIRPG-GNYTITCVGNTPHLRILK------------------VGKGDSGQYTCQATNDVGKDMCSAQLSV---------KEPPKFIKKLDASKVAKQGESIQLECKISGSPEIKVVWFRNDSELHESWKYNMSFVNSVALLTINEASAEDTGDYICEAHNGVGDASCSTALKVKAP--PVFTQKPPPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDTCACTVKFKEPPRFVKKLSDASTLIGDPVELQAVVEGFQPISVVWLKDKGEVIRESENVRISFVDNI--ATLQLGSPEASQSGKYVCQIKNDAGMRECSAVLTV 3306          

HSP 8 Score: 82.0333 bits (201), Expect = 8.856e-15
Identity = 165/772 (21.37%), Postives = 284/772 (36.79%), Query Frame = 3
Query: 2475 LLVNAESSCPTRLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVN--------HSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK----DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPL-NSRDPRIQIYYPEESKCSLKINGATVNDSGTYQ-AVLKETGQT--QTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            L++  ES+   RL   L+  P I      + W+K+N+ +      R+    NS++    + I + +  D+G Y CE  N              V S    T +      +F    EP     ++ G     + + I    P  VN         SS  +   +    +     S +  DVG Y   V+++        THL + E P FV       +L G ++ +   ++      P +++W K +  +  +     ++   NG  V  IP    +  G YTC   NE G      Q S  E ++         AK I  ++L    +  + GD   L+            W KD +PL  S+  RI     + +   LK   A ++DSG Y   +  E G +  +TT   ++    AP+     +++ +   G+  + C +  S P    ++W     DG   + L  + RY++       + G      L    V  +D G +  R  NS G       + V         +  P F+ K     + P    V ++    G+    +KW K  +EL       I K      L +   K SD+G Y  + SN  GS   +C   +            +++P +F     E+ +P+                                 +++K+GD   L C + G P   + W++ +     + + +M        L L ++   DSG Y   A+N +G   C+ +VIV
Sbjct:  413 LMLPGESA---RLHCKLKGSPVIQ-----VTWFKNNKELSESNTVRMSF-VNSEA---ILDITDVKVDDSGTYSCEATN-------------DVGSDSCSTEVVIKEPPSFIKTLEPAD---IVRGANALLQCE-IAGTGPFEVNWFKDKKQIRSSKKYRLFTQKTFVYLEISSFNSADVGDYECVVANEVGKCGCVATHL-LKEPPTFVKKVDDFTALAGQTVTLQAAVRGSE---PISVMWMKGQEVIKEDGKIKMSF--SNGVAVLTIPDVQISLGGKYTCLAENEAGS-----QTSVGELIVKE------PAKIIERAEL----IQVTAGDPATLEYTVSGTPELKPKWYKDGRPLVASKKYRISF---KNNIAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLD-RDIAPLFTKPLRNVDSVVGGACRLDCKIAGSLP--MRVSWF---KDG---KELTASDRYQIAF-----VEGTAS---LEISRVDMNDAGNFTCRATNSVGSKDSSGALIV---------QEPPSFVTKPGSRDVLP-GSAVCLKSAFQGSAPLTIKWFKGDKELVSGGSCYITKETSESSLELYAVKTSDSGTYTCKVSNVAGS--VECSADLF-----------VKEPATF----IEKLEPS---------------------------------QLLKKGDGTQLACKVTGTPPIKITWFANDRELRESSKHKMSFAESTAVLRLTDVAIEDSGEYMCEAQNEAGSDHCTGIVIV 1054          

HSP 9 Score: 79.337 bits (194), Expect = 6.470e-14
Identity = 116/503 (23.06%), Postives = 190/503 (37.77%), Query Frame = 3
Query: 3255 KFTQAHV---GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSI---NIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTD-EIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQ--KGDSGRYSITAENSSGLATCSALVIV 4736
            KF  A +   G YT ++SNE G    +   +     +  + + P+  KP+ +       V   VG + +LD +    +   V W KD + L + D R QI +  E   SL+I+   +ND+G +           T  V       A ++Q+ P  +    +  +   + VC+ +++    S   +IK   G   + LV+     +  +       +   +ELY   V TSD G Y  +V N AG       + V         K    FI+KL+   +    +   + CKV+G P   + W  N  EL ES   K+     T  L + +    D+G Y  +A N  GS+    H   I                                                IV+  P F   F   E++KE D ++L       P  + W+  NT   +  ++  K  L +  + L+ ++    D+G Y     N  G +TCSA V +
Sbjct:  740 KFYSAELHDSGQYTFEISNEVGSSSCETTFT-----VLDRDIAPLFTKPLRN-------VDSVVGGACRLDCKIAGSLPMRVSWFKDGKELTASD-RYQIAF-VEGTASLEISRVDMNDAGNFTC-------RATNSVGSKDSSGALIVQEPPSFVTKPGSRDVLPGSAVCLKSAFQG--SAPLTIKWFKGD--KELVSGGSCYITKE------TSESSLELY--AVKTSDSGTYTCKVSNVAGSVECSADLFV---------KEPATFIEKLEPSQLLKKGDGTQLACKVTGTPPIKITWFANDRELRESSKHKMSFAESTAVLRLTDVAIEDSGEYMCEAQNEAGSD----HCTGI-----------------------------------------------VIVKESPYFTKEFKSIEVLKEYDVMLLAEVAGTPPFEITWFKDNTTLRSGRKY--KTFLQDQLVSLQVLKFVAADAGEYQCRVTNEVGSSTCSARVTL 1147          

HSP 10 Score: 77.411 bits (189), Expect = 2.415e-13
Identity = 120/547 (21.94%), Postives = 204/547 (37.29%), Query Frame = 3
Query: 3243 FEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN-SRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE------KPISFTIIPTERYQP--ADDNSDISSPQRTQMIFSNTIV----------------------------------RSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNK 4751
             EI +      G+YTC+ SNE+G       L+  EA   +    P               +T  VG + K           +++W KD   L+ S D R+      ++K SL+++  TV D G Y               E+  I     I++  +++++  N  I++ C V+      +I WS    DG   + L     YK+           +  +E+    +   D G Y     N AG SS    + V         +  P F++K+D   +    E   + CK+ G+P   + W KN +ELSES+ +++  V     L I + K  D+G Y  +A+N  GS+     + + +P   + T +P +        +   I  T  ++     D   I S ++ ++    T V                                  + PP FV    D     G  V L+  + G  P  ++W         + + +M        L + ++Q    G+Y+  AEN +G  T    +IV    K
Sbjct:  178 LEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRP-------------KALTTFVGKAAKFLCTVSGTPVIEIIWQKDGAALSPSPDCRVT---DADNKHSLELSNLTVQDRGIYSCKASNKFGADICQAELTIIDKPHFIKEL-EAVQSAINKKIHLECQVDEDRKV-TITWS---KDG---QKLPAGKDYKIY------FEDKIASLEIPLAKL--KDSGTYTCTASNEAGSSSSSAAVAV---------REPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMSFVNSEAILDITDVKVDDSGTYSCEATNDVGSDSCSTEVVIKEPPSFIKTLEPADIVRGANALLQCEIAGTGPFEVNWFKDKKQIRSSKKYRLFTQKTFVYLEISSFNSADVGDYECVVANEVGKCGCVATHLLKEPPTFVKKVDDFTALAGQTVTLQAAVRGSEPISVMWMKGQEVIKEDGKIKMSFSNGVAVLTIPDVQISLGGKYTCLAENEAGSQTSVGELIVKEPAK 683          

HSP 11 Score: 76.6406 bits (187), Expect = 3.583e-13
Identity = 160/767 (20.86%), Postives = 284/767 (37.03%), Query Frame = 3
Query: 2652 MHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLS---VFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHK-TYINDNGELVFEIPKFTQAHVGDYTCQVSNEFG--EDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQ-AVLKETGQTQ-TTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPI--------------------GSVNTTKPLE---KPISFTIIPTERYQPADDNSDISSPQRTQM--IFSNT----------------------IVRS--PPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDR 4769
            + +++    D+G + CE +N       S+ V++    VFS       P   E     NTE +SL+  L G    P  ++++      +  SS  +   S N     +  +V   D+G+Y  +  ++   D     +++ E P+F+        + G+   +     +     P ++ W K K  +     + + +++N+   L F   K   A+ G Y CQV N+ G  E++  L +     +I                      +T +VG++  L+ +        V W KD + L S       +Y + S  SLKI      D+GTY   V    G++  T +V+++     P    F + ++    G +   C++             K A  SP      + + K+++    + T +     L  +++ +SD G Y     N AG       +TV         +  P F+++ +   + P  + +     + G P   + W +   EL + +   I       EL + N   S +G Y    SN  G       L V +P                     G+   T P+    K    +I P+ER        +I + ++T +  I S+T                      +V +  PP FVT         GD V L+C + G PE  + W+  +T   + P +      +   L+   +   DSG Y+  AENS G A    +  +       S  R
Sbjct: 2146 IQMNSLGTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSS-----FPPIVETL--KNTE-VSLECELSG---TPPFEVVWYKDKRQL-RSSKKYKVASKNFHASIHILNVESTDIGEYHCKAQNEVGSDACVCAVKLKEPPKFISKLNSLTVVAGEPAEL---QASIEGAQPISVQWLKEKEEVIRESENIRISFVNNVATLQFA--KVEPANAGKYICQVKNDGGVRENMATLTVLEPAVIIEKA-----------------GSMTVTVGETCALECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKIS--SLKILSVEKEDAGTYTFQVQNNVGKSSCTAVVDVSDRMVPP---SFTRRLK-DTGGVLGTSCILEC-----------KVAGSSPISIAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGSYTCVAANVAGSDECRALLTV---------QEPPSFVKEPEPLEVLP-GKNITFTSVIRGTPPFKVGWFRGARELVKGNRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPATFVKKLSDHSVEPGKSIILEGTYTGTLPISVTWKKDGVSITPSER-------CNIVTTEKTCILEILSSTKGDAGHYSCEIENEAGRDACDALVSTLEPPYFVTELEPLEASVGDSVSLQCQVAGTPEITVSWFKGDTKLRSTPEYRTYFTNNVATLVFNKVSINDSGEYTCMAENSIGTAASKTIFRIQERQLPPSFAR 2844          

HSP 12 Score: 76.6406 bits (187), Expect = 3.897e-13
Identity = 151/764 (19.76%), Postives = 263/764 (34.42%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNG-------PSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIF-------------NNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYL-----FRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDR 4769
            + + W+KD   +      +I+    S++    +HI N   +D G+Y C+  N         SV  K+ P  +   +     +  +   +T     EP+S+    D  +   ESD I+                P N    +C   ++ ++  +Q  + ++S+ +    +      +V++ D       +   PE     FK+   L       I    F+K+S   II                    D+G   FE+    Q  VG  +C+VS +                  S  +IP    P  + +L +    G  G S+ ++ +        V+W  D   ++S   R       ++ C+L +N     D+G Y  +      +      +  ++  P     P  +      ++    +V   P   +++W      GS    LV  AR  +       L  ++  +EL+  +V TS  GEY   V N AG +S    + V A A          F+++L+   I    + +I+    SG P   + W KNG  +  S    I    ++  L I +    D+G Y     N +G +     + +++P                                                   P FV       V  GD   L+C L G PE  + W+  +T        +M  + +   L+   +   DSG Y   AENS G  + S  + V       S  R
Sbjct: 4093 FQVSWHKDKRELRSGKKYKIM----SENLLTSIHILNVDTADIGEYQCKATNDVGSDTCVGSVTMKAPPQFVKKLTDISTIIGKEVQLQTTIEGAEPISVAWFKDKGEIVRESDNIWISYSENIATLQFSRAEPANAGKYTC---QIKNDAGMQECYATLSVLEPAAIVEKPESIKVTTGDTCTLECTVSGTPELSTKWFKDGKELTSDNKYKISF--FNKVSGLKII---------------NVVPGDSGVYSFEV----QNPVGKDSCKVSIQV-----------------SDRIIP----PSFTRKLKET--NGLSGSSVVMECKVYGSPPISVLWFHDGNEISSG--RKYQTTLTDNTCALTVNMLEEADAGDYTCIATNVAGSDECSAPLT-VREPPSFVQKPDPMDVLTGSNVTFTSIVKGSPP-FTVSW----FKGS--TELVPGARCNV------SLQDSVGELELF--DVDTSQSGEYTCIVSNEAGRASCTTRLFVKAPA---------IFVKRLNDYSIEK-GKPLILEGTFSGTPPISVTWKKNGINVIASQRCNITTTEKSAILEILSSTVEDSGQYNCYIENASGKDSCSAQILILEP---------------------------------------------------PYFVKQLEPVKVTVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTATCKMHFKNNVATLVFTQVDSSDSGEYICRAENSVGEVSSSTFLTVQEQKLPPSFSR 4726          

HSP 13 Score: 70.4774 bits (171), Expect = 3.162e-11
Identity = 175/862 (20.30%), Postives = 331/862 (38.40%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV------SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSS----DVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGAT-------VNDSGTYQAVLKETG-----QTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRN---LVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDP---IGSVNT-----TKPLE--------KPIS------------------------FTIIPTERYQPADDNSDISSPQRTQMIFSNT---IVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNP---RFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLPPETYSNLVKTHINDESRVMQASP--RGWQEFQFHSNASTLRSSK 4928
            I W KD++ +  + +  I  + +S +      +DN     +G+Y C+ +N   + R  + +L+    Q+   +I K ++       +P++L+ V+ G    PE  + +      +  S   +S    N +  F  +SV  +D GQY F+V      SS D     L+    P F     K + +LG S+ +   +     +S +   W K+   ++T+   ++   ++N  +  E+         +YTC+VSN  G++       A   +++ +       KP     + D+             VEF A +       + WLKD+  L S             KC + + G+T       V+ S T Q   + T         T ++   P +F   ++    S   K   S  + C +   P    + +          RN   L  + +Y+M          ++  I++  +++ T D G++    +N AG +S    + V    E     + P  ++ L        N +V + C++SG P   + W K+  +L  S   K+        + I N + +D G Y  +A N  GS+   C +++ +P   I  +N+      +P E        +PIS                           +   + +PA+    I   +    +  N     V  P   +       V  G+   L+C + G PE  + W  +   + +    +F    ++    L + +++K D+G Y+   +N+ G ++C+A+V V         DR   PS ++ L  +    ++ T    E +V  +SP    W    FH     +  +K
Sbjct: 1744 ITWLKDDQILEENDNVHISFE-DSVATLQVRSVDN---GHSGRYTCQAKNESGIERCYAFLLV----QEPAQIIEK-AKSVDVTEKDPVTLECVVAG---TPELKVKWLKDGKQIVPSRY-FSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQDIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQ---WFKDGKEISTSA-KYRLVCHENT-VSLEVSNLELEDTANYTCKVSNVAGDN-------ACSGILTVKEPPSFLVKPERQQAIPDS------------TVEFKAVLKGTPPFKIKWLKDDVELVSG-----------PKCFIGLEGSTSFLNLYSVDSSKTGQYTCQVTNDVGSDSCTTMLLVTEPPKF---VKKLEASKIIKAGDSARLECKITGSPEIQVVWY----------RNEHELTASDKYQMT------FIDSVAVIQM--NSLGTEDSGDFICEAQNPAGSTSCSTKVIVK---EPPVFSSFPPIVETLK-------NTEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKVASKNFHASIHILNVESTDIGEYHCKAQNEVGSDACVCAVKLKEPPKFISKLNSLTVVAGEPAELQASIEGAQPISVQWLKEKEEVIRESENIRISFVNNVATLQFAKVEPANAGKYICQVKNDGGVRENMATLTVLEPAVIIEKAGSMTVTVGETCALECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISS--LKILSVEKEDAGTYTFQVQNNVGKSSCTAVVDVS--------DRMVPPSFTRRL--KDTGGVLGTSCILECKVAGSSPISIAW----FHEKTKIVSGAK 2510          

HSP 14 Score: 68.5514 bits (166), Expect = 1.241e-10
Identity = 183/858 (21.33%), Postives = 308/858 (35.90%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCN--SQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKL---VLDGFKYAPESDLIFNNMPINVNHSSCP-WSKVSSNEMIQFNHRSVSLKDVGQYLFRVS---SKDVAKTHLEIGEK---PEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN----------SRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-----VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRN---LVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSV----NTTKPLEKPISFTIIPTERYQP--------------ADDNSDIS-----------SPQRTQ----------------------MIFSNTIVRSP-PQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLPPETYSNLVKTHINDESRVMQASP--RGW 4880
            + W KD  +I P        +CN  +      + I +  + DAG Y CE+ N     R +   L+S       T+ P +    F    EPL   +   V    + A   ++  +    +    S P +    +N +       VS+ D G+Y            +KT   I E+   P F          +G  + ++      +  +P  + W ++   L  ++    +++++   L  +I +   +H G Y+C  SN  G      +L+A E   S    I    KP+S   ++        G+S   +          V W KDN+ +              P ++I         LK+      DSG Y       V K+    Q ++ E  P +F   I+    S  AKQ  SI + C ++  P    + W          RN   L  + +Y M    +N +        L  +  +  D G+Y     N  G +S    + V         K  P F QK    + +     VI++C++SG P   + W+K+ +++  S   KI        L I N +  D G Y  +A+N  GS+   C ++  +P   V    + +  +  P+    +  E +QP                +N  IS           SP+ +Q                      ++   TIV  P P  VTT        G+   L+C + G PE    W+       +  R  +    +   L + + +  D G Y+   EN  G ++C+  V        H  DR   PS  + L  +  S  +   +  E RV  ++P   GW
Sbjct: 2682 VTWKKDGVSITPS------ERCNIVTTEKTCILEILSSTKGDAGHYSCEIEN--EAGRDACDALVS-------TLEPPY----FVTELEPLEASVGDSVSLQCQVAGTPEITVSWFKGDTKLRSTPEYRTYFTNNVATLVFNKVSINDSGEYTCMAENSIGTAASKTIFRIQERQLPPSFARQLKDIEQTVGLPVTLTC---RLNGSAPIQVCWYRDGVLLRDDENLQMSFVDNVATL--KILQTDLSHSGQYSCSASNPLGTASSTARLTAREPKKSPFFDI----KPVSIDVIA--------GESADFECHVTGAQPMRVTWSKDNKEIRPGGNYTITCVGNTPHLRI---------LKVGKG---DSGQYTCQATNDVGKDMCSAQLSVKE--PPKF---IKKLDASKVAKQGESIQLECKISGSPEIKVV-W---------FRNDSELHESWKYNMSF--VNSVA------LLTINEASAEDTGDYICEAHNGVGDASCSTALKV---------KAPPVFTQK-PPPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDTCACTVKFKEPPRFVKKLSDASTLIGDPVELQAV-VEGFQPISVVWLKDKGEVIRESENVRISFVDNIATLQLGSPEASQSGKYVCQIKNDAGMRECSAVLTVLEPATIVEKPEPMTVTT--------GNPFTLECVVAGTPELSAKWFKDGRELSSGSRHHITFVRNLASLKIPSAEMNDKGLYTFEVENRVGKSSCTVSV--------HVSDRVVPPSFVRRL--KDTSATLGASVVLECRVSGSAPISVGW 3439          

HSP 15 Score: 64.6994 bits (156), Expect = 1.701e-9
Identity = 116/512 (22.66%), Postives = 183/512 (35.74%), Query Frame = 3
Query: 3276 GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-----VLKETGQTQTTIVE-INPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWSIKPADGSPTRN----LVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVID--PIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNT--HFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSID 4766
            G Y+C  +N  G        S A+ +++     P    P++        +   VG+S  L+          V W KDN+ + S     QI Y E S   L I      DSG Y       V K++   Q  I E + P  F    +   +++   +  S  +   V  S P   ++ W     +  PT N      NNA                  + L     + +D G Y  +  N AG +     I +      +  K  P F Q L   + +   + V + C V G+    ++W+K G E+  SD         T  L +K   K+D+G Y  +ASN  GS+ SKC + + +            ++  + F                +S PQ  +++   T          TF   I K G D          P P + W+           R  + ++ DE  L +++  K DSG Y   A N  G    +  + VD   K   I+
Sbjct: 4790 GQYSCTATNPIGS-----ASSGAKLILTEGKNPPFFDIPLAP-------MDAVVGESADLECHVTGTQPIKVTWAKDNREIRSGG-NYQISYLENS-AHLTIVKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFT---KKLSETVEETEGNSFKLEGRVAGSQP--ITVAWYKNNVEIHPTSNCEIMFKNNA------------------LLLQVKRASMADAGLYTCKATNDAGSALCTSSIVI------KEPKKPPVFDQHL-APVTASEGDSVQLSCHVQGSEPIRIQWLKAGREVKPSDRCSFSFASGTAMLELKETAKADSGDYVCKASNVAGSDTSKCKVTIKEKPAAAPAAKKAAVDGKLFF----------------VSEPQSIRVVEKTT---------ATF---IAKVGGD----------PIPNVKWTKGKWRQLNQGGRILIHQKGDEAKLEIRDTTKTDSGLYRCVAFNKHGEIESNVNLQVDERKKQEKIE 5219          

HSP 16 Score: 60.8474 bits (146), Expect = 2.272e-8
Identity = 143/661 (21.63%), Postives = 242/661 (36.61%), Query Frame = 3
Query: 2976 SLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEI--NPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIR-----KVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPAD----------------------------------------------DNSDISSPQ--RTQMIFSNTIV-----RSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPL-IWWSYNTHFINNPRFEMKRELDEYF---------LILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +++D  QY   +   + +D+ +  + + E P F+       + +G+ + +   +    ++    I W K  T L +       + N+   LV  I K   + VG+YTC+  N  G        S+A  +I  + L P  A+     +L D + T  +G  +  +          V W KD + L   D  +Q+ +      +L+I     +  G Y         T ++  ++  +  +  P     P S+      S +  C V  + P    I W+         R +     YKM       L  N   + +    V   D G+Y     N AG  S    + V         +  P+FI+KLD+  I   +E     CK+ G+P   + W K+  E+ ES   ++       + E H L ++     D+G Y  +A N  GS  S   L+V +P   V   KP          P E  + AD                                              D +DI   Q   T  + S+T V     ++PPQFV   TD     G +V L+  + G  EP+ + W  +       + E+ RE D  +         L     +  ++G+Y+   +N +G+  C A + V
Sbjct: 3655 TIEDYAQYACLIENEAGQDICEALVSVLEPPYFIEPLEHVEAAIGEPITLQCKVDGTPEIR---ISWYKEHTKLRSAPAYKMQFKNNVASLV--INKVDHSDVGEYTCKAENSVG-----AVASSAVLVIKERKLPPSFAR-----KLKDVHET--LGFPVAFECRINGSEPLQVSWYKDGELLKD-DANLQMSFVHHV-ATLQILQTDQSHVGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGSFKCHVTGTAP--IKITWA------KDNREIRPGGNYKMT------LVENTATLTVL--KVAKGDAGQYTCYASNVAGKDSCSAQLGV---------QEPPRFIKKLDQSRIVKQDEYTRYECKIGGSPEIKVLWYKDEVEIQESSKFRMSFEDSVAILEMHSLSVE-----DSGDYTCEARNAAGSASSSTSLKVKEP--PVFRKKPF---------PVETLKGADVHLECELQGTPPFQVSWHKDKRELRSGKKYKIMSENLLTSIHILNVDTADIGEYQCKATNDVGSDTCVGSVTMKAPPQFVKKLTDISTIIGKEVQLQTTIEGA-EPISVAWFKD-------KGEIVRESDNIWISYSENIATLQFSRAEPANAGKYTCQIKNDAGMQECYATLSV 4247          
BLAST of Fibronectin type III domain-containing protein vs. UniProt/SwissProt
Match: sp|O01761|UNC89_CAEEL (Muscle M-line assembly protein unc-89 OS=Caenorhabditis elegans OX=6239 GN=unc-89 PE=1 SV=3)

HSP 1 Score: 124.79 bits (312), Expect = 6.951e-27
Identity = 169/772 (21.89%), Postives = 291/772 (37.69%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTF---AANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK-DVAKTHLEIG-----EKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA--------------------------VLKETGQTQ----------TTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGE-THELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            ++W+KD+  I    D   ++Q  +  G   + I++ R+ D G Y C  RN          +  + F   + ++ P+F++K         E L LK+ + G    P  +   ++ PIN+++S   ++K   +       +    +DVG Y  + +++   AKT   +      E P FV          G    + + ++   K  P+ + W K+  P+  +         +NG     I     A  G YTCQ +N+ G+D    +L   +     QT   V  KP+    L + +     GD++ L+ +   +    + + K++QP+      +Q+   E+    L I  A   D G Y+                           V  E+GQ +          T   + +  + AP   +  +S    +     + C V   P    I W+ +       + +  +AR +  +K    LT       L FDNVT +D GEY    EN  G +    PI V      +    +P F+Q +   +++ + E  ++  K+SG P P +KW KNGEEL  SD +KI  + + T  L + N K  D   Y  +ASN  G   S   L V +P                                                +  P F    +   VKE +    +C + G    + W+   T    + R   +   D    L++++ +  D G Y I   N +G+A     + V
Sbjct: 3415 VEWFKDDTPI--SIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRARN-----EAGEALTTANFGIIRDSIPPEFTQKLRPLEVREQETLDLKVTVIGTP-VPNVEWFKDDKPINIDNSHI-FAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAPLFVQGLKPYEVEQGKPAELVVRVEG--KPEPE-VKWFKDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEV--KPLFIEPLKETFAVE--GDTVVLECKVNKESHPQIKFFKNDQPVEIGQ-HMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPR-PKIKWTKE------GKEVEMSARVRAEHKDDGTLT-------LTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAVVT-VGETAVLEGKISGKPKPSVKWYKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEP-----------------------------------------------AQVAPGFFKELSAIQVKETETAKFECKVSGTKPDVKWFKDGTPLKEDKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTV 4107          

HSP 2 Score: 124.405 bits (311), Expect = 9.484e-27
Identity = 183/800 (22.88%), Postives = 306/800 (38.25%), Query Frame = 3
Query: 2481 VNAESSCPTRLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFS---EKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK--------DVAKTHLEIGE---KPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYIND--NGELVFEIPKFTQAHVGDYTCQVSNEFGED--VLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAV-LKETGQTQTT----------IVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGE-THELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTH-FINNPRFEMKRELDE--YFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYP 4781
            V+ E   P  L   +E +P++      I+WYK+ + + PD D     +   +SG+  + I + ++SD G Y   + N    +   S V +      + T    F    + T     + L+L+  + G    P  ++I+    + +        +V+ +       RS    D+GQY  RV++K        D   T  E GE   KP+FV       +L GD    ++ ++   K    T+ W  N  P+       +  ++D  +G     I    +   G   C   NE G D  V + Q  A     S   L      P  +  L D  +   VGD + ++    A+ +++V W KD + +       +I    +  C +KI     +D G Y  V + E GQ +T           + E    ++AP I    +         I + C V++ P   S+ W     DG P R    ++R  +  +     T       L  ++ T  D G Y     N+ G  +    + V    +   K+    F  K   ++ +   +   ++C V+G+P P +KW +NG+ L       I    + +  L +     SD GIY  +A N +G   ++    V   +G        EKP              D+                     PP+F+   +D  V  G+ + L+C + G P P + WS +    I + RFE   E  +  Y L +KN    D G Y   A N +G AT  + V +D    +  +  SQ P
Sbjct: 4977 VDVEEPQPVELKVKVEGIPKV------IKWYKNGQELKPDAD-GFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHVKSAKSSEPTSGANFLSPLKDTEVEEGDMLTLQCTIAG---EPFPEVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQY--RVTAKNEAGSATSDCKVTVTEQGEQPSKPKFVIPLKTGAALPGDKKEFNVKVRGLPK---PTLQWFLNGIPIKF---DDRITLDDMADGNYCLTIRDVREEDFGTLKCIAKNENGTDETVCEFQQGAGHDDGSRDDL---RYPPRFNVPLWDRRI--PVGDPMFIECHVDANPTAEVEWFKDGKKIE-HTAHTEIRNTVDGACRIKIIPFEESDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTVNGGQPIRLSCKVDAIPRA-SVVWY---KDGLPLRA---DSRTSIQYEEDGTAT-------LAINDSTEEDIGAYRCVATNAHGTINTSCSVNVKVPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHVQMALGKT------EKP------------KMDEG-------------------KPPKFILELSDMSVSLGNVIDLECKVTGLPNPSVKWSKDGGPLIEDSRFEWSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTASQPP 5701          

HSP 3 Score: 105.531 bits (262), Expect = 5.035e-21
Identity = 161/760 (21.18%), Postives = 288/760 (37.89%), Query Frame = 3
Query: 2559 DIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSS-KDVAKTHLEIGE-----KPEFVYH------QFKENSLLG---------------DSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQTQTTI-VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVM--IPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETH-ELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRELDEYF-LILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            D++W+KD++ +  D +    ++ N ++G   + +     +DAG+Y  +  N P+   +SS       S ++ T + +        N E  +L + + G    P  + + +  P+  + S    +KV  +       +   L+D G+Y  R ++    AKT            PEFV        + KE++ L                D   ISI   N H +  +T +                      G     I    Q  VG Y+C+  NE GE      L+ A   I   ++ P   + +   ++ +        +++ L V        +V W KD++P+N  +  I          +L I  A   D G Y      E G+ +TT  + +     AP+     +    +Q     +V  V   P    + W     DG P           + N+ + +  G      L   +   +D G+Y  +  N AG    +  + I   +  +   ++  P FI+ L KE  +   + V++ CKV+   +P +K+ KN + +    H+++  + + + +L I+N KK D G Y  +A N  G   +   L++            +E+ ++      E     +   D +S +           R  P+FV       V E    +LKC + G P P I W+     +  + R   + + D    L   N+ + D+G Y   AEN  G A     +IV
Sbjct: 3218 DVEWFKDDKPVSEDGNHE--MKKNPETGVFTLVVKQAATTDAGKYTAKASN-PAGTAESSAEAEVTQSLEKPTFVRELVTTEVKIN-ETATLSVTVKGVP-DPSVEWLKDGQPVQTDSSHV-IAKVEGSGSYSITIKDARLEDSGKYACRATNPAGEAKTEANFAVVKNLVPPEFVEKLSPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISI--DNVHVIQKQTAV----------------------GSFSLTINDARQGDVGIYSCRARNEAGE-----ALTTANFGIIRDSIPPEFTQKLRPLEVREQ-------ETLDLKVTVIGTPVPNVEWFKDDKPINIDNSHIFAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAPLFVQGLKPYEVEQGKPAELVVRVEGKPEPE-VKWF---KDGVP---------IAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEVKPLFIEPL-KETFAVEGDTVVLECKVNKESHPQIKFFKNDQPVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKI-------QFAAKVEEHVTDESGQLEEIGQFETVGDTASSK-------TDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIV 3907          

HSP 4 Score: 99.7525 bits (247), Expect = 2.760e-19
Identity = 181/828 (21.86%), Postives = 298/828 (35.99%), Query Frame = 3
Query: 2559 DIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWC----EVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFS---EKTFAANTEPLSLKLVLDGFKYAPESDLIF--NNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYL-----------------FRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKN-------------FHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPV---SAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKC--SLKINGATVNDSGTYQAVLKETGQTQTT--------------IVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTT--------SDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTS-----------PKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLK-IRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLP 4802
            +++W+KD + I       I    N+  G  ++ I    ESD G Y C    E+    +       +L  V  +K+    PK +   E       +P+ L   +D     P + +++  + +P+  +  +    +      +  N  +   +D+G Y                   +V  ++V K     GE+P F        +  GDS  +   +                 +  P+T+I                   + +G     + + T +  G Y C+  N  G+   K Q +A   +   +T  P       P    +LSD  V  S+G+ I L+ +     +  V W KD  PL   D R + +  E SK    L+I  ATV+D GTY+ V      + TT              +    P +F   + D    +R  +   + + C V++ P    + +     DG+             I  P +++     +I L  D V T         D G Y +   N +G +      TV  L      + S           PK ++ L+  I  P  +   +RCK SG+P P +KW K+GE +     L+ I       ELV+ +  + DAG Y   A NT GS  + C + VI                          +P D +S I   +              P F T  T    K GD V  +C   G P P I W        ++ + +M+   D    LIL ++     G +   A N  G A+  A ++++        DR+     S+PLP
Sbjct: 5307 EVEWFKDGKKIEHTAHTEIR---NTVDGACRIKIIPFEESDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTVNGGQPIRLSCKVDAI---PRASVVWYKDGLPLRADSRTSIQYEEDGTATLAINDST--EEDIGAYRCVATNAHGTINTSCSVNVKVPKQEVKKE----GEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVI-----------------ETSPDGSCSLTVNESTMSDEGIYRCEAENAHGK--AKTQATAHVQMALGKTEKPKMDEGKPPKFILELSDMSV--SLGNVIDLECKVTGLPNPSVKWSKDGGPL-IEDSRFE-WSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTASQPPRFTLKMGD----VRTTEGQPLKLECKVDASPLPEMVWYK----DGA-------------IVTPSDRI-----QISLSPDGVATLLIPSCVYDDDGIYRVIATNPSGTAQDKGTATVKKLPRDSGARRSADRDVFDANKAPKLMEPLEN-IRIPEKQSFRLRCKFSGDPKPTIKWFKDGERVFPYGRLQLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVI----------------------RGDRKPRDIDSSIREGKA-------------PGFTTPLTIRRAKPGDSVTFECLPFGNPFPSIKWLKDGLELFSDEKIKMEAAADGTQRLILSDVTFLSEGYFRCVATNEHGTASTKAELVIEG-------DRT---IGSRPLP 6027          

HSP 5 Score: 90.5077 bits (223), Expect = 1.876e-16
Identity = 168/787 (21.35%), Postives = 301/787 (38.25%), Query Frame = 3
Query: 2547 KDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGT---VIPKFSE---KTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPI--------------------------NVNHSSCPWSKVS------SNEMIQFNHR--------SVSLKDVGQYLFRVSSKDVAKTHLEIGE-KPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFG----EDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQ--TQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGET-HELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDS 4742
            K + +++W+KD   I    D + +++   ++G   + I +   +D G+Y C+  N          + +  +S ++ T   V P F E   +TFA   + + L+  ++   + P+     N+ P+                          +V    C    V+      ++  IQF  +        S  L+++GQ+    +  D A +  + G   PEFV    +  ++     AI   +K   K  P+  I    +          +    D+G L       TQA  G+Y C+  NE+G    E  + + L  A  +       P   +P+  + +       +VG++  L+ +        V W K+ + L   D R++I   ++    L +  A ++D   Y+     E G   +  T+    P Q AP       +I+ K+  +    C V+   +   + W     DG+P   L  + R               QR  L  ++  T D G Y + V N AG ++  +P+TV      +        I+K   ++      K+++  +V G P  + KW K  E ++ S   KI +V E+ ++L I++ + SD G Y    S  + S         ++   +V  TK  EK IS                                    P F     D+ V +G  +VL+  + G P+ + W+  N   I + + E      +Y L + + Q+ D G YS+TA N +G     A V V +
Sbjct: 3606 KPEPEVKWFKDGVPIA--IDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEVKPLFIEPLKETFAVEGDTVVLECKVNKESH-PQIKFFKNDQPVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFE---TVGDTASSKTDTGRGAPEFV-ELLRSCTVTEKQQAI---LKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGE---APDFLQPVKPAVV-------TVGETAVLEGKISGKPKPSVKWYKNGEELKPSD-RVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEPAQVAPGFFKELSAIQVKETETAKFECKVSG--TKPDVKWF---KDGTP---LKEDKRVH-----FESTDDGTQR--LVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTVVPSETLK--------IKKGLTDVNVTQGTKILLSVEVEGKPKTV-KWYKGTETVTSSQTTKIVQVTESEYKLEIESAEMSDTGAYRVVLSTDSFS---------VESSATVTVTKAAEK-ISL-----------------------------------PSFKKGLADQSVPKGTPLVLEVEIEGKPKDVKWYK-NGDEIKDGKVEDLGN-GKYRLTIPDFQEKDVGEYSVTAANEAGEIESKAKVNVSA 4300          

HSP 6 Score: 84.7297 bits (208), Expect = 1.053e-14
Identity = 117/484 (24.17%), Postives = 189/484 (39.05%), Query Frame = 3
Query: 3444 SIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSI---------------RAKQNGSINIVCV--VNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAA--------LAE--AQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGET-----HELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYN-THFINNPRFEMKR-ELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALV-----IVDSHNKNHSIDRSQY 4778
            S +L  +F  D    + W KD + +     R+Q+    +  C L ++ AT  D+G Y+ V + T  +  T  ++N I+     +D   SI               RAK   S+   C+   N +P   SI W     DG     L ++ + KM            QR  L   +VT    G +     N  G +S    + +          L E   + ++  P+  + L    I   N   ++ C  +G P P +KW K+G+E+   D    ++V  T     H LVI N    D G Y  +A+N  GS  ++  L +I P                      R+    D       +R  M F       PP FV    ++ V      +  C ++G+P P + W +N    +   R +++      + LI+ +    D+G Y  TA+NS G A+ SA++      +DS   N  ID + Y
Sbjct: 5831 SFRLRCKFSGDPKPTIKWFKDGERVFPYG-RLQLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVIRGDRKPRDIDSSIREGKAPGFTTPLTIRRAKPGDSVTFECLPFGNPFP---SIKWL---KDG---LELFSDEKIKM-----EAAADGTQR--LILSDVTFLSEGYFRCVATNEHGTASTKAELVIEGDRTIGSRPLPEVNGEPEECKPRIRRGLYNMSIHEGNVVEMIVC-ATGIPTPTVKWYKDGQEIV-GDGPDGKRVIFTDERGIHHLVIVNASPDDEGEYSLEATNKLGSAKTEGSLNIIRP----------------------RHIADAD-------ERGGMPF-------PPGFVRQLKNKHVFNHMPTIFDCLVVGHPAPEVEWFHNGKKIVPGGRIKIQSCGGGSHALIILDTTLEDAGEYVATAKNSHGSASSSAVLDVTVPFLDSIKFNGEIDVTPY 6259          

HSP 7 Score: 77.0258 bits (188), Expect = 1.898e-12
Identity = 160/759 (21.08%), Postives = 296/759 (39.00%), Query Frame = 3
Query: 2559 DIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNN---MPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK-DVAKTHLEIGEKPEFVYHQ-FKENSLL-GDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDV----LKLQLSAAEALISSQTLIPVSAKPISS--SQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQN-----GSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLD--KEIISPINEKVIVRCKVSGNPNPILKWMKNGEELS-ESDHLKIRKVGETHE--LVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEP-LIWWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHS 4760
            +I+WYK+ + I P    +     +    K ++ I +  + DA +Y   + +       SS  L      K+  +I    ++  +  + P+ L++   G   +P++   + N   +P      +    K+  N+ +     SV ++D G Y   V+++   A +  +I  +P+  + +  K+ S+  G++   S+         P+ + W             +   I  N   + E    T+     Y   + N   +D     + L+ +A EA  S+Q  +  +   +      L D  V  + G  +  +V+   +   DV WL+D   +++    I I   +++   L I  A + D+G Y   V+ E+G+ ++             + + P+ +R  +N     G  ++  V  S P    + W     +  P  +L      K I           ++ EL  +     DG +Y + + N+AG       +TV            P  ++ +D  K++     + V ++ KV G P  ++KW KNG+EL  ++D  K  +  E+ E  L I + KKSD G Y     N  G   S   + V     S  +++P                                        S   F++   D  V+EGD + L+C + G P P +IW         + R  M+  LD    L +++ +K D G+Y +TA+N +G AT    V V    +  S
Sbjct: 4520 EIKWYKNGKEITPSDKAQ---PGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEPKIIKGLEDQVVSIGS-PIKLEIETSG---SPKTVKWYKNGKELP-GAAAKTIKIQKIDDNKYVLEIPSSV-VEDTGDYKVEVANEAGSANSSGKITVEPKITFLKPLKDQSITEGENAEFSVETNT----KPRIVKW-----------YKNGQEIKPNSRFIIEQKTDTK-----YQLVIKNAVRDDADTYKIVLENTAGEAESSAQLTVKKAKAGLCKIVKGLEDQVV--AKGAKMVFEVKIQGE-PEDVRWLRDANVISAGANAI-IEKIDDTTYRLIIPSADLKDAGEYTVEVINESGKAKS--------DAKGEVDEKPEIVRGLENIEIPEGDDDVFKVEVSAP-VRQVKWYKNDQEIKPNSHL----EAKKIGP---------KKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVV----------KPNVLKIVDGLKDVDVEEPQPVELKVKVEGIPK-VIKWYKNGQELKPDADGFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHV----KSAKSSEPT---------------------------------------SGANFLSPLKDTEVEEGDMLTLQCTIAGEPFPEVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVTVTEQGEQPS 5169          

HSP 8 Score: 77.0258 bits (188), Expect = 2.322e-12
Identity = 166/756 (21.96%), Postives = 281/756 (37.17%), Query Frame = 3
Query: 2565 QWYKDNEAILPDCDPRILLQCNSQ-SGKM--KMHIDNCRESDAGQYWCEVRN--GPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDG---FKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQY-LFRVSSKDVAKTHLEI---GEKPEFVYHQFKENSLLGDSLAISIPMK-------NFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQF--APVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPI----NEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRK---VGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVI-DPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN--NPRFEMKRE-LDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +W KD + I  +   RI +Q  +   G +  ++ +DN    DAG+Y C V N  G      +  V+ S   +K     P+F        T   S K+VL+     +  P+   + +N    +   S     V   E +     S  L   G+Y     +++  +KT   +   GE P F      +   +G+ L +S  +K       +F+  S  T +  K  +         +T  N +  +V  I + T+  +  Y    +N  G        + + + I+++   PV  + +  + + +        + IK++V+     + DV W KD++P++          PE    +L +  A   D+G Y A       T  +  E    Q    P       +   K N +  +   V   P   S+ W     DG P +   ++   K+       +T    R+E         D G+Y  R  N AG +      T A  A  +N    P+F++KL     SP+     E   +  KV G P P ++W K+   +S  +   I+K   VG +  L I + ++ D GIY  +A N  G  ++  +  +I D I                                                 PP+F        V+E + + LK  +IG P P + W  +   IN  N     K E    + L +K  +  D G Y+  A N +G A  +A + V
Sbjct: 2919 KWLKDGKEI--ELIARIRVQTRTGPEGHITQELVLDNVTPEDAGKYTCIVENTAGKDTCEATLTVIES-LEKKSEKKAPEFI-VALQDKTTKTSEKVVLECKVIGEPKPKVSWLHDNK--TITQESITVESVEGVERVTIT--SSELSHQGKYTCIAENTEGTSKTEAFLTVQGEAPVFTKELQNKELSIGEKLVLSCSVKGSPQPHVDFYSFSETTKVETKITSSSRIAIEHDQT--NTHWRMV--ISQITKEDIVSYKAIATNSIG-------TATSTSKITTKVEAPVFEQGLKKTSVKEK-------EEIKMEVKV-GGSAPDVEWFKDDKPVSEDGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEAEVTQSLEKPTFVRELVTTEVKINETATLSVTVKGVPD-PSVEWL---KDGQPVQTDSSHVIAKVEGSGSYSITIKDARLE---------DSGKYACRATNPAGEAK-----TEANFAVVKN-LVPPEFVEKL-----SPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISIDNVHVIQKQTAVG-SFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSI-------------------------------------------------PPEFTQKLRPLEVREQETLDLKVTVIGTPVPNVEWFKDDKPINIDNSHIFAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAV 3573          

HSP 9 Score: 67.3958 bits (163), Expect = 1.669e-9
Identity = 119/524 (22.71%), Postives = 205/524 (39.12%), Query Frame = 3
Query: 3207 HKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN-SRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK-ETGQTQTT---IVEINPIQ--FAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINK-PLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGET--HELVIKNCK--KSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN--NPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            H  Y +++G     I        G YTC  +NE+G+       ++  A      +   +A P   ++L D       GD I  + E       ++VWL D+QPL  S D R+Q Y  + +K  L+I  A  +D+G Y   ++ E G  ++     V+ +P +   AP  Q   + +   +   +    V+   P+   I W I   +G P   L  + + K I++  +  LT  ++ +  +FD + T  G    L   +  G   V +P               P F + L+ + +      V+    VSG P P L +   G+EL   +   +  VG    + + I N    K D  I  A+A N +G+  S+  L V                           +  ++ S                 RS P F+    D+ VK G+  V +  + G P P + W  N H ++  +P  +++    ++ L + + Q   +G     AEN+ G     A ++V
Sbjct:  594 HTFYSDEDGFFAMTIDPVQVTDTGRYTCMATNEYGQ-------ASTSAFFRVLKVEKEAAPPAFVTKLRDKEC--KEGDVIDFECEVEGWPEPELVWLVDDQPLRPSHDFRLQ-YDGQTAK--LEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPDKNHVAPEFQATIEYVECDEGEEVRFKSVITGDPNPEII-WFI---NGKP---LSESEKVKFISEDGICILT--IKDVTRHFDGMVTCQGSNR-LGSASCDGRLKVRVP------------PAPPTFNKPLEDKTVQE-KSTVVFEVDVSGWPEPTLTFTLCGKELKNGEE-GVEIVGHDGFYRISIPNTSMDKHDGEIV-AKAQNEHGTAESRARLTV---------------------------EQEEEES-----------------RSAPTFLKDIEDQTVKTGEFAVFETTVRGNPNPEVTWFINGHKMDQGSPGVKIEAHNHDHKLTIDSAQY--AGTVLCRAENAVGRFETKARLVV 1034          

HSP 10 Score: 66.6254 bits (161), Expect = 2.832e-9
Identity = 72/297 (24.24%), Postives = 119/297 (40.07%), Query Frame = 3
Query: 3486 DVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK-ETGQTQTTIV--------EINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE 4349
            D+ W KD+  L+  D R   Y  E+   ++ I+   V D+G Y  +   E GQ  T+          E  P  F   ++D       K+   I+  C V  +P    + W +      P+ +               +L  + Q  +L   +    D G Y ++++N  G  S+     +   A+      +P+F Q   + +     E+V  +  ++G+PNP + W  NG+ LSES+ +K         L IK+  +   G+   Q SN  GS      L+V  P       KPLE
Sbjct:  578 DITWYKDDVQLH-EDERHTFYSDEDGFFAMTIDPVQVTDTGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRD----KECKEGDVIDFECEVEGWPEPELV-WLVDDQPLRPSHDF--------------RLQYDGQTAKLEIRDAQPDDTGVYTVKIQNEFG--SIESKAELFVQADPDKNHVAPEF-QATIEYVECDEGEEVRFKSVITGDPNPEIIWFINGKPLSESEKVKFISEDGICILTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPPAPPTFNKPLE 851          

HSP 11 Score: 65.4698 bits (158), Expect = 7.620e-9
Identity = 54/240 (22.50%), Postives = 94/240 (39.17%), Query Frame = 3
Query: 4032 SPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIR-KVGE----THELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +PKFI K+ K+  +      +  C V        KW+K+G+E+     ++++ + G     T ELV+ N    DAG Y     NT G +  +  L VI+          LEK                                    +  P+F+    D+  K  + VVL+C +IG P+P + W ++   I      ++       + + + +    G+Y+  AEN+ G +   A + V
Sbjct: 2886 APKFITKI-KDTKAKKGHSAVFECVVPDTKGVCCKWLKDGKEIELIARIRVQTRTGPEGHITQELVLDNVTPEDAGKYTCIVENTAGKDTCEATLTVIE---------SLEKKSE---------------------------------KKAPEFIVALQDKTTKTSEKVVLECKVIGEPKPKVSWLHDNKTITQESITVESVEGVERVTITSSELSHQGKYTCIAENTEGTSKTEAFLTV 3082          

HSP 12 Score: 60.077 bits (144), Expect = 2.905e-7
Identity = 68/296 (22.97%), Postives = 114/296 (38.51%), Query Frame = 3
Query: 3930 GGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKL-DKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRY---------SITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSN 4787
             G    R EN+ G       + V A    + +K  PKF++ L DK     ++  V+   +V G P P + W   GEEL +SD ++IR+   + ++ IKN K  DAG   A A+N+ GS+ +K  L V             +KP +                                    P+F        V++G + V      G P P   WS N   + + +   +   DE  +   +I   D+  Y         S+ AEN+ G     A + ++   ++  +++    S+
Sbjct: 1012 AGTVLCRAENAVGRFETKARLVVLA---PEKQKKPPKFVEILVDK--TETVDNTVVFEVRVEGEPKPTVTWYLKGEELKQSDRVEIREFDGSIKISIKNIKIEDAGEIRAVATNSEGSDETKAKLTV------------QKKPFA------------------------------------PEFDLRPVSLTVEKGSEAVFSAHAFGIPLPTYEWSVNGRKVRDGQEGARVTRDESTVDGASILTIDTATYYSEVNHLTISVVAENTLGAEETGAQLTIEPKKESVVVEKQDLSSS 1254          

HSP 13 Score: 57.3806 bits (137), Expect = 1.902e-6
Identity = 82/345 (23.77%), Postives = 150/345 (43.48%), Query Frame = 3
Query: 3279 DYTCQV-SNEFGEDVLKLQLSAAEALISSQTLIPV------SAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSG--TYQAVLKETGQTQTTI-VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSG-NPNPILKWMKNGEELSESDHLKIRKVGE-THELVIKNCKKSDAGIYEAQASNTNG 4277
            ++ C + +  FG   + +  S A   + ++T + V      + KP  + +L D  VT   GD++++DV   A  S    W ++   L      + I   EE+K SL I  A   DSG  T +A   E G ++++  + +NP    P++ D P+S+  K+  +      ++ +P+  ++ W+I          +V  +R     K  +  T       L   N      G   +  +NSAG  S    + V    +A      PKF  +L  ++     E +    ++ G +P   + W+ NG+ L++SD +++   G+ T+ + I   K   +G   A+A N  G
Sbjct: 1938 EFRCSIDTTMFGSGTVSVVASNAAGSVETKTELKVLETPKETKKPEFTDKLRDMEVTK--GDTVQMDV--IALHSPLYKWYQNGNLLEDGKNGVTIKN-EENKSSLIIPNA--QDSGKITVEAS-NEVGSSESSAQLTVNPPSTTPIVVDGPKSVTIKETETAEFKATISGFPA-PTVKWTI-------NEKIVEESRTITTIKTEDVYT-------LKISNAKIEQTGTVKVTAQNSAGQDSKQADLKVEPNVKA------PKFKSQLTDKVADE-GEPLRWNLELDGPSPGTEVSWLLNGQPLTKSDTVQVVDHGDGTYHVTIAEAKPEMSGTLTAKAKNAAG 2252          

HSP 14 Score: 57.3806 bits (137), Expect = 1.934e-6
Identity = 103/496 (20.77%), Postives = 173/496 (34.88%), Query Frame = 3
Query: 3282 YTCQVSNEFGEDVLKLQLSA--AEALISSQTLIPVS---AKPISSSQLSDNYVTGSVGDSIKLDVEFPA-DVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK-ETGQTQTTI-VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCL-IGYPEPLI-WWSYNTHFINNPRFEMKRELDEYF-LILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            YT ++SN   E    ++++A  +    S Q  + V      P   SQL+D       G+ ++ ++E       ++V WL + QPL   D  +Q+    +    + I  A    SGT  A  K   G+ +T+  V +N     P     PQ+       S+    +V   P   ++ W +        + L+ +   K+      K      +  +          G   +  EN +G       +   A  +   K   PKF   +D   +    E V     V G P P + W  NGE +S+  ++ +      H + I       AG    +A+N  GS+     L V                                                  V   P F     D ++ EG+  ++   L I  P+P I W        ++  +++  E D    L +   +  D GR +I AE+  G+A CSA + V
Sbjct: 2130 YTLKISNAKIEQTGTVKVTAQNSAGQDSKQADLKVEPNVKAPKFKSQLTDK--VADEGEPLRWNLELDGPSPGTEVSWLLNGQPLTKSD-TVQVVDHGDGTYHVTIAEAKPEMSGTLTAKAKNAAGECETSAKVTVNGGNKKPEFVQAPQNHETTLEESVKFSAIVTGKP-MPNVTWYLN------NKKLIQSEEVKV------KYVHETGKTSIRIQKPLMEHNGTIRVEAENVSG------KVQATAQLKVDKKTEVPKFTTNMDDRQVKE-GEDVKFTANVEGYPEPSVAWTLNGEPVSKHPNITVTDKDGEHTIEISAVTPEQAGELSCEATNPVGSKKRDVQLAV------------------------------------------------KKVGDAPTFAKNLEDRLITEGELTLMDAKLNIVKPKPKITWLKDGVEITSDGHYKIVEEEDGSLKLSILQTKLEDKGRITIKAESEFGVAECSASLGV 2554          
BLAST of Fibronectin type III domain-containing protein vs. UniProt/SwissProt
Match: sp|A2ASS6|TITIN_MOUSE (Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 7.792e-27
Identity = 174/773 (22.51%), Postives = 304/773 (39.33%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVAKTH---LEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTY--INDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE----KPISFT-------------------IIPTERYQPADDNS---------DISSPQRTQMIFSN----------TIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYN-THFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            I W KDN  I P  + ++ L  N+ +    + +    + DAGQY C   N     + S    L V  Q+    I K  +       E    +  + G   +PE  +++    + +  SS  +     + +      S+S++D G Y     +   + +    L++ E P F    F   +L G  + +   ++      P  + W K+K  L     S K Y  +++N      I     A +G+Y C+ +N+ G D            + S T+    A P    +L+D  ++  +G  ++L           V W KD   +      I I Y  E+  +L+ + A   ++G Y   +K     Q     ++ ++ A +++  P+SI+     +  + C V+  P   S  W     DG   + L ++ +YK+     NK++G      L   NV   D G Y   V+N  G  S  + I V+      ++   P F +KL KE        V++ CKV G+P   + W  +G E+S     +      T  L +   +++DAG Y   A+N  GS+     L V +P   V    P++      ++FT                   ++P  R   +  +S         D S       I SN            V++P  FV    D  +++G  ++L+    G P   + W  N  + I + R  +        L + +    DSG+Y+   EN+SG  +CSA +++
Sbjct: 8131 ITWAKDNREIRPGGNYKMTLVENTAT----LTVLKVAKGDAGQYTCYASNVAG--KDSCSAQLGV--QEPPRFIKKLDQSRIVKQDEYTRYECKIGG---SPEIKVLWYKDEVEIQESS-KFRMSFEDSVAILEMHSLSVEDSGDYTCEARNAAGSASSSTSLKVKEPPVFRKKPFPVETLKGADVHLECELQG---TPPFQVSWHKDKRELR----SGKKYKIMSENLLTSIHILNVDTADIGEYQCKATNDVGSD----------TCVGSVTM---KAPPQFVKKLTD--ISTIIGKEVQLQTTIEGAEPISVAWFKDKGEIVRESDNIWISY-SENIATLQFSRAEPANAGKYTCQIKNDAGMQECYATLSVLEPAAIVEK-PESIKVTTGDTCTLECTVSGTPEL-STKWF---KDG---KELTSDNKYKISF--FNKVSG------LKIINVVPGDSGVYSFEVQNPVGKDSCKVSIQVS------DRIIPPSFTRKL-KETNGLSGSSVVMECKVYGSPPISVLWFHDGNEISSGRKYQTTLTDNTCALTVNMLEEADAGDYTCIATNVAGSDECSAPLTVREPPSFVQKPDPMDVLTGSNVTFTSIVKGSPPFTVSWFKGSTELVPGARCNVSLQDSVGELELFDVDTSQSGEYTCIVSNEAGRASCTTRLFVKAPAIFVKRLNDYSIEKGKPLILEGTFSGTPPISVTWKKNGINVIASQRCNITTTEKSAILEILSSTVEDSGQYNCYIENASGKDSCSAQILI 8845          

HSP 2 Score: 93.5893 bits (231), Expect = 2.008e-17
Identity = 163/762 (21.39%), Postives = 290/762 (38.06%), Query Frame = 3
Query: 2652 MHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLS---VFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHK-TYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQ-AVLKETGQTQTTIV-----EINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG--------SVNTTKPL--------EKPISFTIIPTERYQPADDNSDISSPQRTQM--IFSNTI------------------------VRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDR 4769
            + I+     D G Y CE  NG      S+ + +    VF+QK   V         A     + L+  + G    P  ++++      V  SS  +   S N     +  ++   D+G+Y  + +++   D     ++  E P FV      ++L+GD + +   ++ F    P +++W K+K  +     + + +++++   L    P+ +Q+  G Y CQ+ N+ G      + SA   ++   T++    KP          +T + G+   L+            W KD + L+S   R  I +   +  SLKI  A +ND G Y   V    G++  T+       + P  F   ++D   ++ A    S+ + C V+      S+ W +   DG+           ++I+ P  + +       L   ++  SD G Y     N AG       +TV         +  P F Q  D   + P    +     + G P   +KW K   EL   +   I       EL +   +   +G Y    +N  GS     HL V +P          SV T  P+          PIS + +  E       N  I++ +++ +  I  +TI                        V  PP F+          G+ + L+C + G PE  I W+  +T   + P ++M+ + +   L++  +   D G Y+  AENS G    SA++++       S  R
Sbjct: 7310 LTINEASAEDTGDYICEAHNGVGDASCSTALKVKAPPVFTQKPPPV--------GALKGSDVILQCEISG---TPPFEVVWVKDRKQV-RSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDTCACTVKFKEPPRFVKKLSDASTLIGDPVELQAVVEGFQ---PISVVWLKDKGEVIRESENVRISFVDNIATLQLGSPEASQS--GKYVCQIKNDAG----MRECSAVLTVLEPATIV---EKP--------EPMTVTTGNPFTLECVVAGTPELSAKWFKDGRELSSGS-RHHITF-VRNLASLKIPSAEMNDKGLYTFEVENRVGKSSCTVSVHVSDRVVPPSFVRRLKDTSATLGA----SVVLECRVSGSAPI-SVGWFL---DGN-----------EIISSPKCQSSFADNVCTLTLSSLEPSDTGAYTCVAANVAGQDESSAVLTV---------QEPPSFEQTPDSVEVLP-GMSLTFTSVIRGTPPFKVKWFKGSRELVSGEACTISLEDFVTELELLEVEPGQSGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADTSVETGSPIVLEATYSGTPPISVSWMKNEYPLSQSPNCGITTTEKSSILEILESTIEDYAQYACLIENEAGQDICEALVSVLEPPYFIEPLEHVEAAIGEPITLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYTCKAENSVGAVASSAVLVIKERKLPPSFAR 8008          

HSP 3 Score: 92.0485 bits (227), Expect = 6.178e-17
Identity = 112/501 (22.36%), Postives = 189/501 (37.72%), Query Frame = 3
Query: 3237 LVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +  EI  F  A VGDY C V+NE G    K    A   L    T +          +  D++ T   G ++ L           V+W+K  Q +   D +I++ +       L I    ++  G Y  + +    +QT++ E+   + A +I+   + I+        +   V+  P        +KP      R LV + +Y++          N+ +++ Y  +    D G+Y   + N  G SS     TV       ++  +P F + L + + S +     + CK++G+    + W K+G+EL+ SD  +I  V  T  L I     +DAG +  +A+N+ GS+ S   L V +P                                                   P FVT      V  G  V LK    G  P  + W+  +   ++     + +E  E  L L  ++  DSG Y+    N +G   CSA + V
Sbjct: 4774 VYLEISSFNSADVGDYECVVANEVG----KCGCVATHLLKEPPTFV----------KKVDDF-TALAGQTVTLQAAVRGSEPISVMWMK-GQEVIKEDGKIKMSF-SNGVAVLTIPDVQISLGGKYTCLAENEAGSQTSVGELIVKEPAKIIERA-ELIQVTAGDPATLEYTVSGTPE-------LKPKWYKDGRPLVASKKYRI------SFKNNIAQLKFY--SAELHDSGQYTFEISNEVGSSSCETTFTVL------DRDIAPLFTKPL-RNVDSVVGGACRLDCKIAGSLPMRVSWFKDGKELTASDRYQIAFVEGTASLEISRVDMNDAGNFTCRATNSVGSKDSSGALIVQEP---------------------------------------------------PSFVTKPGSRDVLPGSAVCLKSAFQGSAPLTIKWFKGDKELVSGGSCYITKETSESSLELYAVKTSDSGTYTCKVSNVAGSVECSADLFV 5183          

HSP 4 Score: 90.8929 bits (224), Expect = 1.239e-16
Identity = 179/797 (22.46%), Postives = 305/797 (38.27%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVN-HSSCPWSKVSSNEMIQFNHRS-------VSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELV-FEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDF---------PQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVI-VRCKVSGNPNPI-LKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQ-----------------------PA-------DDNS----------------------DISSPQRTQMIFSNTIVRSPPQFVTTFTDEIV-KEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLI-LKNIQKGDSGRYSITAENSSGLATCS 4721
            I+W+K ++ ++      I  + +  S    + +   + SD+G Y C+V N    +  S+     +F ++  T I K          EP  L    DG + A +   +    PI +   ++    + SS   + F   +       V+++D G+Y+      +  D     + + E P F   +FK   +L +   +   +       P  I W K+ T L + +  +KT++ D  +LV  ++ KF  A  G+Y C+V+NE G      +++  E         P   K I ++       +   G +          +   V WLKDN  + + D  I++ + E +  SL ++G  V   G Y    K     Q     ++  + A ++++          P +++ K +G+  I           S  W     DG   + L    +YK+       +T  +  +++   +    D GEY   V+N  G SS    I V  L         P F +KL K  +  I    I + C V+G+ +PI ++W K+ +E+S SD  K      T  L I   + +D+G Y   A+N  G      HL V +P   V      EKP S  + P  R Q                       P        DD S                      D+ +      IF    V+ PPQF+   +  +V + G     +C + G PE  + W  + + I + R      +D      + N +  +SG Y   A N +G A+CS
Sbjct: 5125 IKWFKGDKELVSGGSCYITKETSESS----LELYAVKTSDSGTYTCKVSNVAGSVECSA----DLFVKEPATFIEKL---------EPSQLLKKGDGTQLACK---VTGTPPIKITWFANDRELRESSKHKMSFAESTAVLRLTDVAIEDSGEYMCEAQNEAGSDHCTGIVIVKESPYFT-KEFKSIEVLKEYDVML--LAEVAGTPPFEITWFKDNTTLRSGR-KYKTFLQD--QLVSLQVLKFVAADAGEYQCRVTNEVGSSTCSARVTLREP--------PSFIKKIEAT-------SSLRGGTAAFQATLKGSLPITVTWLKDNDEI-TEDDNIRMTF-ENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATIMEEAVSIDVTQGDPATLQVKFSGTKEI-----------SAKWF---KDG---QELTLGPKYKI------SVTDTVSILKII--STEKKDSGEYTFEVQNDVGRSSCKASINVLDLI------IPPSFTKKLRK--MDSIKGSFIDLECIVAGS-HPISIQWFKDDQEISASDKHKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHSQCSGHLTVKEPPYFV------EKPQSQDVNPGTRVQLKALVGGTAPMTIKWFKDNKELHPGAARSVWKDDTSTILELFSAKAADSGTYICQLSNDVGTTSSKATIF----VKEPPQFIKKPSPVLVLRNGQSTTFECQVTGTPEIRVSWYLDGNEITDLRKYGISFVDGLATFQISNARVENSGTYVCEARNDAGTASCS 5834          

HSP 5 Score: 88.5817 bits (218), Expect = 7.333e-16
Identity = 178/733 (24.28%), Postives = 281/733 (38.34%), Query Frame = 3
Query: 2565 QWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYA--PESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLF---RVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVL-----KETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFT--DEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSA 4724
            +W+KD + +  D   +I    N  SG   + I N    D+G Y  EV+N   V + S  V + V  +    + P F+ K    N    S  +V++   Y   P S L F++   N   S   +    ++         +   D G Y      V+  D     L + E P FV      + L G ++  +  +K      P T+ W K  T L      + +  +  GEL  E+     +  G+YTC VSNE G               S  T + V A  I   +L+D  +    G  + L+  F       V W K+   + +   R  I   E+S   L+I  +TV DSG Y   +     K++   Q  I+E  P  F   ++     ++     S ++ C +   P    ++W        PT      A  KM  K  N +        L F  V +SD GEY  R ENS G  S    +TV      Q +K  P F ++L +++   +   V+  C VSG+    + W K+G+ L +S +++   +     L I    +S +G Y   A+N               PIGS ++   L        I TE                          ++PP F       D +V E  D  L+C + G  P  + W   N    +   +++    +   L +  + KGDSG+Y+  A N  G  +C+A
Sbjct: 8506 KWFKDGKELTSDNKYKISF-FNKVSG---LKIINVVPGDSGVYSFEVQN--PVGKDSCKVSIQVSDR---IIPPSFTRKLKETNGLSGS-SVVMECKVYGSPPISVLWFHDG--NEISSGRKYQTTLTDNTCALTVNMLEEADAGDYTCIATNVAGSDECSAPLTVREPPSFVQKPDPMDVLTGSNVTFTSIVKG---SPPFTVSWFKGSTELVPGARCNVSLQDSVGEL--ELFDVDTSQSGEYTCIVSNEAGR-------------ASCTTRLFVKAPAIFVKRLNDYSI--EKGKPLILEGTFSGTPPISVTWKKNGINVIASQ-RCNITTTEKSAI-LEILSSTVEDSGQYNCYIENASGKDSCSAQILILE--PPYFVKQLE----PVKVTVGDSASLQCQLAGTPEI-GVSWYKGDTKLRPT------ATCKMHFK--NNVA------TLVFTQVDSSDSGEYICRAENSVGEVSSSTFLTV------QEQKLPPSFSRQL-RDVQETVGLPVVFECAVSGSEPISVSWYKDGKPLKDSPNIQTSFLDNIATLNIFKTDRSLSGQYSCTATN---------------PIGSASSGAKL--------ILTEG-------------------------KNPPFFDIPLAPMDAVVGESAD--LECHVTGTQPIKVTWAKDNREIRSGGNYQISYLENSAHLTIVKVDKGDSGQYTCYAVNEVGKDSCTA 9126          

HSP 6 Score: 87.0409 bits (214), Expect = 1.924e-15
Identity = 178/764 (23.30%), Postives = 276/764 (36.13%), Query Frame = 3
Query: 2631 SQSGKMKMHIDNCRESDAGQYWCEVR---NGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQ--FAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWS-----IKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKP------------LEKPISFT-------------IIPTERYQPADDNSDIS-------SP-------QRTQMIFSNTIV-----RSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFIN---NPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            SQSG+    + N    +AGQ  C  R     P+   K     LS  S + G  I    E T+   T P+S+    DG    P          I     +C    +SS +            D G Y   +   + +D     +   E P FV       + +GDS+++   +    ++   T+ W K  T L +       + N+   LVF   K +    G+YTC   N  G    K         I  + L P  A+     QL D  +  +VG  + L           V W +D   L   D  +Q+ +  ++  +LKI    ++ SG Y         T ++   +   +   +P     P SI      S +  C V  + P    + WS     I+P  G+ T   V N  +  I K                  V   D G+Y  +  N  G       ++V         K  PKFI+KLD   ++   E + + CK+SG+P   + W +N  EL ES    +  V     L I      D G Y  +A N  G       L+V  P   V T KP            L+  IS T             +  +++++    N D S       +P       + T  + S+T       + PP+FV   +D     GD V L+  + G+ P  ++W       I    N R      +    L L + +   SG+Y    +N +G+  CSA++ V
Sbjct: 6846 SQSGEYTCVVSN----NAGQASCTTRLFVKEPATFVKK----LSDHSVEPGKSI--ILEGTYTG-TLPISVTWKKDGVSITPS-----ERCNIVTTEKTCILEILSSTK-----------GDAGHYSCEIENEAGRDACDALVSTLEPPYFVTELEPLEASVGDSVSLQCQVAGTPEI---TVSWFKGDTKLRSTPEYRTYFTNNVATLVFN--KVSINDSGEYTCMAENSIGTAASKTIFR-----IQERQLPPSFAR-----QLKD--IEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRD-DENLQMSF-VDNVATLKILQTDLSHSGQYSCSASNPLGTASSTARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQP--MRVTWSKDNKEIRPG-GNYTITCVGNTPHLRILK------------------VGKGDSGQYTCQATNDVGKDMCSAQLSV---------KEPPKFIKKLDASKVAKQGESIQLECKISGSPEIKVVWFRNDSELHESWKYNMSFVNSVALLTINEASAEDTGDYICEAHNGVGDASCSTALKVKAP--PVFTQKPPPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDTCACTVKFKEPPRFVKKLSDASTLIGDPVELQAVVEGFQPISVVWLKDKGEVIRESENVRISFVDNI--ATLQLGSPEASQSGKYVCQIKNDAGMRECSAVLTV 7529          

HSP 7 Score: 83.5741 bits (205), Expect = 2.013e-14
Identity = 164/772 (21.24%), Postives = 286/772 (37.05%), Query Frame = 3
Query: 2475 LLVNAESSCPTRLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVN--------HSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK----DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPL-NSRDPRIQIYYPEESKCSLKINGATVNDSGTYQ-AVLKETGQT--QTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            L++  ES+   RL   L+  P I      + W+K+N+ +      R+    NS++    + I + +  D+G Y CE  N              V S    T +      +F    EP     ++ G     + + I    P  VN         SS  +   +    +     S +  DVG Y   V+++        THL + E P FV       +L G ++ +   ++      P +++W K +  +  +     ++   NG  V  IP    +  G YTC   NE G      Q S  E ++         AK I  ++L    +  + GD   L+            W KD +PL  S+  RI     + +   LK   A ++DSG Y   +  E G +  +TT   ++    AP+     +++ +   G+  + C +  S P    ++W     DG   + L  + RY++      + T +++        V  +D G +  R  NS G       + V         +  P F+ K     + P    V ++    G+    +KW K  +EL       I K      L +   K SD+G Y  + SN  GS   +C   +            +++P +F     E+ +P+                                 +++K+GD   L C + G P   + W++ +     + + +M        L L ++   DSG Y   A+N +G   C+ +VIV
Sbjct: 4636 LMLPGESA---RLHCKLKGSPVIQ-----VTWFKNNKELSESNTVRMSF-VNSEA---ILDITDVKVDDSGTYSCEATN-------------DVGSDSCSTEVVIKEPPSFIKTLEPAD---IVRGANALLQCE-IAGTGPFEVNWFKDKKQIRSSKKYRLFTQKTFVYLEISSFNSADVGDYECVVANEVGKCGCVATHL-LKEPPTFVKKVDDFTALAGQTVTLQAAVRGSE---PISVMWMKGQEVIKEDGKIKMSF--SNGVAVLTIPDVQISLGGKYTCLAENEAGS-----QTSVGELIVKE------PAKIIERAEL----IQVTAGDPATLEYTVSGTPELKPKWYKDGRPLVASKKYRISF---KNNIAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLD-RDIAPLFTKPLRNVDSVVGGACRLDCKIAGSLP--MRVSWF---KDG---KELTASDRYQIA---FVEGTASLE-----ISRVDMNDAGNFTCRATNSVGSKDSSGALIV---------QEPPSFVTKPGSRDVLP-GSAVCLKSAFQGSAPLTIKWFKGDKELVSGGSCYITKETSESSLELYAVKTSDSGTYTCKVSNVAGS--VECSADLF-----------VKEPATF----IEKLEPS---------------------------------QLLKKGDGTQLACKVTGTPPIKITWFANDRELRESSKHKMSFAESTAVLRLTDVAIEDSGEYMCEAQNEAGSDHCTGIVIV 5277          

HSP 8 Score: 83.1889 bits (204), Expect = 2.912e-14
Identity = 123/545 (22.57%), Postives = 206/545 (37.80%), Query Frame = 3
Query: 3255 KFTQAHV---GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSI---NIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVI--------DPIGSVNTTKPLEKPISFTIIPTERYQPA--DDNSDISSPQRTQMIFSNTIV----------------------------------RSPPQFVTTFTDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            KF  A +   G YT ++SNE G    +   +     +  + + P+  KP+ +       V   VG + +LD +    +   V W KD + L + D R QI +  E   SL+I+   +ND+G +           T  V       A ++Q+ P  +    +  +   + VC+ +++    S   +IK   G   + LV+     +  +       +   +ELY   V TSD G Y  +V N AG        +V   A+   K+ +  FI+KL+   +    +   + CKV+G P   + W  N  EL ES   K+     T  L + +    D+G Y  +A N  GS+   C   VI            S+   K  +  +   +  T  ++     DN+ + S ++ +    + +V                                  R PP F+          G     +  L G  P  + W   N     +    M  E +   L L  I+    G+Y   A+N +G+  CSAL+ V
Sbjct: 4963 KFYSAELHDSGQYTFEISNEVGSSSCETTFT-----VLDRDIAPLFTKPLRN-------VDSVVGGACRLDCKIAGSLPMRVSWFKDGKELTASD-RYQIAF-VEGTASLEISRVDMNDAGNFTC-------RATNSVGSKDSSGALIVQEPPSFVTKPGSRDVLPGSAVCLKSAFQG--SAPLTIKWFKGD--KELVSGGSCYITKE------TSESSLELY--AVKTSDSGTYTCKVSNVAG--------SVECSADLFVKEPA-TFIEKLEPSQLLKKGDGTQLACKVTGTPPIKITWFANDRELRESSKHKMSFAESTAVLRLTDVAIEDSGEYMCEAQNEAGSD--HCTGIVIVKESPYFTKEFKSIEVLKEYDVMLLAEVAGTPPFEITWFKDNTTLRSGRKYKTFLQDQLVSLQVLKFVAADAGEYQCRVTNEVGSSTCSARVTLREPPSFIKKIEATSSLRGGTAAFQATLKGSLPITVTWLKDNDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSV 5463          

HSP 9 Score: 78.1814 bits (191), Expect = 8.690e-13
Identity = 119/542 (21.96%), Postives = 203/542 (37.45%), Query Frame = 3
Query: 3243 FEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN-SRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE------KPISFTIIPTERYQPA--DDNSDISSPQRTQMIFSNTIV----------------------------------RSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
             EI +      G+YTC+ SNE+G       L+  EA   +    P               +T  VG + K           +++W KD   L+ S D R+      ++K SL+++  TV D G Y               E+  I     I++  +++++  N  I++ C V+      +I WS    DG   + L     YK+           +  +E+    +   D G Y     N AG SS    + V         +  P F++K+D   +    E   + CK+ G+P   + W KN +ELSES+ +++  V     L I + K  D+G Y  +A+N  GS+     + + +P   + T +P +        +   I  T  ++     D   I S ++ ++    T V                                  + PP FV    D     G  V L+  + G  P  ++W         + + +M        L + ++Q    G+Y+  AEN +G  T    +IV
Sbjct: 4401 LEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRP-------------KALTTFVGKAAKFLCTVSGTPVIEIIWQKDGAALSPSPDCRVT---DADNKHSLELSNLTVQDRGIYSCKASNKFGADICQAELTIIDKPHFIKEL-EAVQSAINKKIHLECQVDEDRKV-TITWS---KDG---QKLPAGKDYKIY------FEDKIASLEIPLAKL--KDSGTYTCTASNEAGSSSSSAAVAV---------REPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMSFVNSEAILDITDVKVDDSGTYSCEATNDVGSDSCSTEVVIKEPPSFIKTLEPADIVRGANALLQCEIAGTGPFEVNWFKDKKQIRSSKKYRLFTQKTFVYLEISSFNSADVGDYECVVANEVGKCGCVATHLLKEPPTFVKKVDDFTALAGQTVTLQAAVRGSEPISVMWMKGQEVIKEDGKIKMSFSNGVAVLTIPDVQISLGGKYTCLAENEAGSQTSVGELIV 4901          

HSP 10 Score: 78.1814 bits (191), Expect = 9.690e-13
Identity = 151/764 (19.76%), Postives = 264/764 (34.55%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNG-------PSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNM-------------PINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYL-----FRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDR 4769
            + + W+KD   +      +I+    S++    +HI N   +D G+Y C+  N         SV  K+ P  +   +     +  +   +T     EP+S+    D  +   ESD I+ +              P N    +C   ++ ++  +Q  + ++S+ +    +      +V++ D       +   PE     FK+   L       I    F+K+S   II                    D+G   FE+    Q  VG  +C+VS +                  S  +IP    P  + +L +    G  G S+ ++ +        V+W  D   ++S   R       ++ C+L +N     D+G Y  +      +      +  ++  P     P  +      ++    +V   P   +++W      GS    LV  AR  +       L  ++  +EL+  +V TS  GEY   V N AG +S    + V A A          F+++L+   I    + +I+    SG P   + W KNG  +  S    I    ++  L I +    D+G Y     N +G +     + +++P                                                   P FV       V  GD   L+C L G PE  + W+  +T        +M  + +   L+   +   DSG Y   AENS G  + S  + V       S  R
Sbjct: 8316 FQVSWHKDKRELRSGKKYKIM----SENLLTSIHILNVDTADIGEYQCKATNDVGSDTCVGSVTMKAPPQFVKKLTDISTIIGKEVQLQTTIEGAEPISVAWFKDKGEIVRESDNIWISYSENIATLQFSRAEPANAGKYTC---QIKNDAGMQECYATLSVLEPAAIVEKPESIKVTTGDTCTLECTVSGTPELSTKWFKDGKELTSDNKYKISF--FNKVSGLKII---------------NVVPGDSGVYSFEV----QNPVGKDSCKVSIQV-----------------SDRIIP----PSFTRKLKET--NGLSGSSVVMECKVYGSPPISVLWFHDGNEISSG--RKYQTTLTDNTCALTVNMLEEADAGDYTCIATNVAGSDECSAPLT-VREPPSFVQKPDPMDVLTGSNVTFTSIVKGSPP-FTVSW----FKGS--TELVPGARCNV------SLQDSVGELELF--DVDTSQSGEYTCIVSNEAGRASCTTRLFVKAPA---------IFVKRLNDYSIEK-GKPLILEGTFSGTPPISVTWKKNGINVIASQRCNITTTEKSAILEILSSTVEDSGQYNCYIENASGKDSCSAQILILEP---------------------------------------------------PYFVKQLEPVKVTVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTATCKMHFKNNVATLVFTQVDSSDSGEYICRAENSVGEVSSSTFLTVQEQKLPPSFSR 8949          

HSP 11 Score: 77.7962 bits (190), Expect = 1.310e-12
Identity = 172/801 (21.47%), Postives = 301/801 (37.58%), Query Frame = 3
Query: 2508 RLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLS---VFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHK-TYINDNGELVFEIPKFTQAHVGDYTCQVSNEFG--EDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQ-AVLKETGQTQ-TTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPI--------------------GSVNTTKPLE---KPISFTIIPTERYQPADDNSDISSPQRTQM--IFSNT----------------------IVRS--PPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSAL 4727
            RL+  +   P I      + WY+ NE  L   D   +   +S +    + +++    D+G + CE +N       S+ V++    VFS       P   E     NTE +SL+  L G    P  ++++      +  SS  +   S N     +  +V   D+G+Y  +  ++   D     +++ E P+F+    K NSL   +   +    +     P ++ W K K  +     + + +++N+   L F   K   A+ G Y CQV N+ G  E++  L +     +I                      +T +VG++  L+ +        V W KD + L S       +Y + S  SLKI      D+GTY   V    G++  T +V+++     P    F + ++    G +   C++             K A  SP      + + K+++    + T +     L  +++ +SD G Y     N AG       +TV         +  P F+++ +   + P  + +     + G P   + W +   EL + +   I       EL + N   S +G Y    SN  G       L V +P                     G+   T P+    K    +I P+ER        +I + ++T +  I S+T                      +V +  PP FVT         GD V L+C + G PE  + W+  +T   + P +      +   L+   +   DSG Y+  AENS G A    +
Sbjct: 6330 RLECKITGSPEIQ-----VVWYR-NEHELTASDKYQMTFIDSVA---VIQMNSLGTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSS-----FPPIVET--LKNTE-VSLECELSG---TPPFEVVWYKDKRQL-RSSKKYKVASKNFHASIHILNVESTDIGEYHCKAQNEVGSDACVCAVKLKEPPKFIS---KLNSLTVVAGEPAELQASIEGAQPISVQWLKEKEEVIRESENIRISFVNNVATLQFA--KVEPANAGKYICQVKNDGGVRENMATLTVLEPAVIIEKA-----------------GSMTVTVGETCALECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKIS--SLKILSVEKEDAGTYTFQVQNNVGKSSCTAVVDVSDRMVPP---SFTRRLK-DTGGVLGTSCILEC-----------KVAGSSPISIAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGSYTCVAANVAGSDECRALLTV---------QEPPSFVKEPEPLEVLP-GKNITFTSVIRGTPPFKVGWFRGARELVKGNRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPATFVKKLSDHSVEPGKSIILEGTYTGTLPISVTWKKDGVSITPSER-------CNIVTTEKTCILEILSSTKGDAGHYSCEIENEAGRDACDALVSTLEPPYFVTELEPLEASVGDSVSLQCQVAGTPEITVSWFKGDTKLRSTPEYRTYFTNNVATLVFNKVSINDSGEYTCMAENSIGTAASKTI 7053          

HSP 12 Score: 73.9442 bits (180), Expect = 1.823e-11
Identity = 139/669 (20.78%), Postives = 249/669 (37.22%), Query Frame = 3
Query: 2985 DVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVW-LKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPR-FEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLPPETYSNLVKTHINDESRVMQASPRGWQEFQFHSNASTLRSSKNDIFEQELPVDKDVS 4973
            D G Y    ++K        HL + E P FV     ++   G  + +   +      +P TI W K+   L     + ++   D+   + E+     A  G Y CQ+SN+ G               SS+  I V   P    + S   V  + G S   + +        V W L  N+  + R   I      +   + +I+ A V +SGTY    +    T +  +E+  ++  P+     + +   ++  + + C V+ + P    + W            L NN   +   K    ++  M    L+      SD GEY   + N  G  +    + +         K  P FI+K++  + + +      +  V+G+P   + W+K+ + L E+D++ I        L +++     +G Y  QA N +G  + +C+                    +F ++                             + P Q +       V E D V L+C + G PE  + W  +   I   R F M  E +     ++++ K DSG+Y+   EN  G ++C A + V        +D+   PS +K L       ++ + I+ E +V  + P   Q F+     ST  S+K  +   E  V  +VS
Sbjct: 5629 DSGTYTCSATNKAGHSQCSGHLTVKEPPYFVEKPQSQDVNPGTRVQLKALVGG---TAPMTIKWFKDNKELHPG--AARSVWKDDTSTILELFSAKAADSGTYICQLSNDVG-------------TTSSKATIFVKEPPQFIKKPSPVLVLRN-GQSTTFECQVTGTPEIRVSWYLDGNEITDLRKYGISFV---DGLATFQISNARVENSGTYVCEARNDAGTASCSIELK-VKEPPIFIRELEPVEVVKDSDVELECEVMGTTP--FEVTW------------LKNNKEIRSGKK--YTMSEKMSVFYLHITKCDPSDVGEYQCIIANEGGSCACSARVAL---------KEPPSFIKKIEN-VTTVLKSSATFQSTVAGSPPISITWLKDDQILEENDNVHISFEDSVATLQVRSVDNGHSGRYTCQAKNESG--IERCY--------------------AFLLV-----------------------------QEPAQIIEKAKSVDVTEKDPVTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRV--------LDQDIPPSFTKKL--TKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEIST--SAKYRLVCHENTVSLEVS 6185          

HSP 13 Score: 72.0182 bits (175), Expect = 8.177e-11
Identity = 174/862 (20.19%), Postives = 330/862 (38.28%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV------SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSS----DVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGAT-------VNDSGTYQAVLKETGQT-----QTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRN---LVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDP---IGSVNT-----TKPLE--------KPIS------------------------FTIIPTERYQPADDNSDISSPQRTQMIFSNT---IVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNP---RFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLPPETYSNLVKTHINDESRVMQASP--RGWQEFQFHSNASTLRSSK 4928
            I W KD++ IL + D    +  + +     + + +     +G+Y C+ +N   + R  + +L+    Q+   +I K ++       +P++L+ V+ G    PE  + +      +  S   +S    N +  F  +SV  +D GQY F+V      SS D     L+    P F     K + +LG S+ +   +     +S +   W K+   ++T+   ++   ++N  +  E+         +YTC+VSN  G++       A   +++ +       KP     + D+             VEF A +       + WLKD+  L S             KC + + G+T       V+ S T Q   + T         T ++   P +F   ++    S   K   S  + C +   P    + +          RN   L  + +Y+M          ++  I++  +++ T D G++    +N AG +S    + V    E     + P  ++ L        N +V + C++SG P   + W K+  +L  S   K+        + I N + +D G Y  +A N  GS+   C +++ +P   I  +N+      +P E        +PIS                           +   + +PA+    I   +    +  N     V  P   +       V  G+   L+C + G PE  + W  +   + +    +F    ++    L + +++K D+G Y+   +N+ G ++C+A+V V         DR   PS ++ L  +    ++ T    E +V  +SP    W    FH     +  +K
Sbjct: 5967 ITWLKDDQ-ILEENDN---VHISFEDSVATLQVRSVDNGHSGRYTCQAKNESGIERCYAFLLV----QEPAQIIEK-AKSVDVTEKDPVTLECVVAG---TPELKVKWLKDGKQIVPSRY-FSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQDIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQ---WFKDGKEISTSA-KYRLVCHEN-TVSLEVSNLELEDTANYTCKVSNVAGDN-------ACSGILTVKEPPSFLVKPERQQAIPDS------------TVEFKAVLKGTPPFKIKWLKDDVELVSG-----------PKCFIGLEGSTSFLNLYSVDSSKTGQYTCQVTNDVGSDSCTTMLLVTEPPKF---VKKLEASKIIKAGDSARLECKITGSPEIQVVWY----------RNEHELTASDKYQMT------FIDSVAVIQM--NSLGTEDSGDFICEAQNPAGSTSCSTKVIVK---EPPVFSSFPPIVETLK-------NTEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKVASKNFHASIHILNVESTDIGEYHCKAQNEVGSDACVCAVKLKEPPKFISKLNSLTVVAGEPAELQASIEGAQPISVQWLKEKEEVIRESENIRISFVNNVATLQFAKVEPANAGKYICQVKNDGGVRENMATLTVLEPAVIIEKAGSMTVTVGETCALECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISS--LKILSVEKEDAGTYTFQVQNNVGKSSCTAVVDVS--------DRMVPPSFTRRL--KDTGGVLGTSCILECKVAGSSPISIAW----FHEKTKIVSGAK 6733          

HSP 14 Score: 71.2478 bits (173), Expect = 1.233e-10
Identity = 48/162 (29.63%), Postives = 79/162 (48.77%), Query Frame = 3
Query: 3843 YKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRV--ENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG 4322
            Y+  ++P ++ T      +L        +G +Y  RV   N+ G   V +P     + EA+ +   PK +  + ++I     +K+ V   V G PNPI KW K  +E+  S HL I K   +  L+IK+  + D+G Y   A N++GS+  K  + V+D  G
Sbjct: 20626 YREEDQPADRWTEYSVVKDLSLIVTGLKEGKKYKFRVAARNAVG---VSMPREAEGVYEAKEQLLPPKIL--MPEQITIKAGKKLRVEAHVYGKPNPICKWKKGDDEVVTSSHLAIHKADGSSVLIIKDVTRKDSGYYSLTAENSSGSDTQKIKVTVMDAPG 20782          

HSP 15 Score: 69.707 bits (169), Expect = 3.606e-10
Identity = 81/325 (24.92%), Postives = 134/325 (41.23%), Query Frame = 3
Query: 3768 SCHSINWSIKPADG-SPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRV--ENSAG---WSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKV---GETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI-NNPRFEMKRELDEYFLILKN-IQKGDSGRYSITAENSSGL 4709
            SC  + W    +DG +  RN     R K  NK +   T  ++       N+   +G EY  RV  EN  G   WS +  P+T  +    Q    +P F ++L    +   +   +V CKV+G+P PI+KW + G+E+  +D LK R     G  H+L+I +    DA +Y+ +A+N  GS      L+V  P                              + I  P+  + + +   +R                G+ V +K    G P+P+I W      I NN  +++        L+  N +++ D+G Y + A+N  G+
Sbjct: 32629 SC-VVAWKPPASDGGAKIRNYYLERREKKQNKWIAVTTEEIRETVFSVQNLI--EGLEYEFRVKCENLGGESEWSEISEPVTPKSDVPIQ----APHFKEELRNLNVRYQSNATLV-CKVTGHPKPIVKWYRQGKEII-ADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVP------------------------------AKIHLPKTLEGMGAVHALR----------------GEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFSNGVERKDAGFYVVCAKNRFGI 32898          

HSP 16 Score: 69.3218 bits (168), Expect = 4.638e-10
Identity = 181/855 (21.17%), Postives = 308/855 (36.02%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCN--SQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKL---VLDGFKYAPESDLIFNNMPINVNHSSCP-WSKVSSNEMIQFNHRSVSLKDVGQYLFRVS---SKDVAKTHLEIGEK---PEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN----------SRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-----VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSV----NTTKPLEKPISFTIIPTERYQP--------------ADDNSDIS-----------SPQRTQ----------------------MIFSNTIVRSP-PQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLPPETYSNLVKTHINDESRVMQASP--RGW 4880
            + W KD  +I P        +CN  +      + I +  + DAG Y CE+ N     R +   L+S       T+ P +    F    EPL   +   V    + A   ++  +    +    S P +    +N +       VS+ D G+Y            +KT   I E+   P F          +G  + ++      +  +P  + W ++   L  ++    +++++   L  +I +   +H G Y+C  SN  G      +L+A E   S    I    KP+S   ++        G+S   +          V W KDN+ +              P ++I         LK+      DSG Y       V K+    Q ++ E  P +F   I+    S  AKQ  SI + C ++  P    + W    ++      L  + +Y M    +N +        L  +  +  D G+Y     N  G +S    + V         K  P F QK    + +     VI++C++SG P   + W+K+ +++  S   KI        L I N +  D G Y  +A+N  GS+   C ++  +P   V    + +  +  P+    +  E +QP                +N  IS           SP+ +Q                      ++   TIV  P P  VTT        G+   L+C + G PE    W+       +  R  +    +   L + + +  D G Y+   EN  G ++C+  V        H  DR   PS  + L  +  S  +   +  E RV  ++P   GW
Sbjct: 6905 VTWKKDGVSITPS------ERCNIVTTEKTCILEILSSTKGDAGHYSCEIEN--EAGRDACDALVS-------TLEPPY----FVTELEPLEASVGDSVSLQCQVAGTPEITVSWFKGDTKLRSTPEYRTYFTNNVATLVFNKVSINDSGEYTCMAENSIGTAASKTIFRIQERQLPPSFARQLKDIEQTVGLPVTLTC---RLNGSAPIQVCWYRDGVLLRDDENLQMSFVDNVATL--KILQTDLSHSGQYSCSASNPLGTASSTARLTAREPKKSPFFDI----KPVSIDVIA--------GESADFECHVTGAQPMRVTWSKDNKEIRPGGNYTITCVGNTPHLRI---------LKVGKG---DSGQYTCQATNDVGKDMCSAQLSVKE--PPKF---IKKLDASKVAKQGESIQLECKISGSPEIKVV-WFRNDSE------LHESWKYNMSF--VNSVA------LLTINEASAEDTGDYICEAHNGVGDASCSTALKV---------KAPPVFTQK-PPPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDTCACTVKFKEPPRFVKKLSDASTLIGDPVELQAV-VEGFQPISVVWLKDKGEVIRESENVRISFVDNIATLQLGSPEASQSGKYVCQIKNDAGMRECSAVLTVLEPATIVEKPEPMTVTT--------GNPFTLECVVAGTPELSAKWFKDGRELSSGSRHHITFVRNLASLKIPSAEMNDKGLYTFEVENRVGKSSCTVSV--------HVSDRVVPPSFVRRL--KDTSATLGASVVLECRVSGSAPISVGW 7662          

HSP 17 Score: 65.855 bits (159), Expect = 5.454e-9
Identity = 45/138 (32.61%), Postives = 64/138 (46.38%), Query Frame = 3
Query: 3897 ELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVG-ETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV 4307
            +L  ++VTT D  EY +   N  G  S    +TV            P F ++L         + V    +VSG P P LKW K+G+ LS   H++I   G + + L I++    D G Y   A+NT GS   + HLQV
Sbjct: 33537 QLTINSVTTDDDAEYTVVARNKHGEDSCKAKLTVTLHPPPTETTLRPMF-KRLLANAECHEGQSVCFEIRVSGIPAPTLKWEKDGQPLSLGPHIEIVHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 33673          

HSP 18 Score: 65.855 bits (159), Expect = 5.688e-9
Identity = 116/512 (22.66%), Postives = 183/512 (35.74%), Query Frame = 3
Query: 3276 GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-----VLKETGQTQTTIVE-INPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWSIKPADGSPTRN----LVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVID--PIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNT--HFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSID 4766
            G Y+C  +N  G        S A+ +++     P    P++        +   VG+S  L+          V W KDN+ + S     QI Y E S   L I      DSG Y       V K++   Q  I E + P  F    +   +++   +  S  +   V  S P   ++ W     +  PT N      NNA                  + L     + +D G Y  +  N AG +     I +      +  K  P F Q L   + +   + V + C V G+    ++W+K G E+  SD         T  L +K   K+D+G Y  +ASN  GS+ SKC + + +            ++  + F                +S PQ  +++   T          TF   I K G D          P P + W+           R  + ++ DE  L +++  K DSG Y   A N  G    +  + VD   K   I+
Sbjct: 9013 GQYSCTATNPIGS-----ASSGAKLILTEGKNPPFFDIPLAP-------MDAVVGESADLECHVTGTQPIKVTWAKDNREIRSGG-NYQISYLENS-AHLTIVKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFT---KKLSETVEETEGNSFKLEGRVAGSQPI--TVAWYKNNVEIHPTSNCEIMFKNNA------------------LLLQVKRASMADAGLYTCKATNDAGSALCTSSIVI------KEPKKPPVFDQHL-APVTASEGDSVQLSCHVQGSEPIRIQWLKAGREVKPSDRCSFSFASGTAMLELKETAKADSGDYVCKASNVAGSDTSKCKVTIKEKPAAAPAAKKAAVDGKLFF----------------VSEPQSIRVVEKTT---------ATF---IAKVGGD----------PIPNVKWTKGKWRQLNQGGRILIHQKGDEAKLEIRDTTKTDSGLYRCVAFNKHGEIESNVNLQVDERKKQEKIE 9442          

HSP 19 Score: 63.5438 bits (153), Expect = 2.844e-8
Identity = 111/542 (20.48%), Postives = 187/542 (34.50%), Query Frame = 3
Query: 3276 GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKC---------SLKINGATVNDSGTYQA-VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTE--------RYQPA------DDNSDISSPQRTQMIFSNT----------------------------------IVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSA 4724
            G+Y C+ SN+ G+     +L+  E            A P+   ++    V  ++G   K   E     +    W K  +         +IY  E  KC         SL+I    V D G Y      E G    T        + P     P+++      +   +C V+  P    I W    A  SP+              P  ++T    +  L   N+T  D G Y  +  N  G       +T+            P FI++L+  + S IN+K+ + C+V  +    + W K+G++L      KI    +   L I   K  D+G Y   ASN  GS  S   + V +P   V    P     S+ ++P E        +  P        +N ++S     +M F N+                                  +++ PP F+ T     +  G + +L+C + G  P  + W+       ++ ++ +  +    +L + +    D G Y     N  G   C A
Sbjct: 4317 GEYVCEASNDSGKAKTSAKLTVGE-----------RAAPVIKRRIEPLEV--ALGHLAKFTCEIQGAPNVRFQWFKAGR---------EIY--ESDKCSIRSSNYVSSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKALTTFVGKAAKFLCTVSGTPVIEII-WQKDGAALSPS--------------PDCRVTDADNKHSLELSNLTVQDRGIYSCKASNKFGADICQAELTII---------DKPHFIKELEA-VQSAINKKIHLECQVDEDRKVTITWSKDGQKLPAGKDYKIYFEDKIASLEIPLAKLKDSGTYTCTASNEAGSSSSSAAVAVREPPSFVKKVDP-----SYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMSFVNSEAILDITDVKVDDSGTYSCEATNDVGSDSCSTEVVIKEPPSFIKTLEPADIVRGANALLQCEIAGTGPFEVNWFKDKKQIRSSKKYRLFTQKTFVYLEISSFNSADVGDYECVVANEVGKCGCVA 4804          

HSP 20 Score: 63.1586 bits (152), Expect = 3.226e-8
Identity = 38/139 (27.34%), Postives = 66/139 (47.48%), Query Frame = 3
Query: 3891 RIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV 4307
            R  L    VT ++ G Y LR  N +G ++    + V A      +   P F Q+L    +     +V ++ +V+G P P++K+ ++G E+  S   +I + G+ + L+I      D+G Y   A+N+ G   S   L V
Sbjct:   62 RARLMIPAVTKANSGRYSLRATNGSGQATSTAELLVTA------ETAPPNFSQRLQSMTVRQ-GSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELVV 193          

HSP 21 Score: 63.1586 bits (152), Expect = 3.720e-8
Identity = 81/383 (21.15%), Postives = 139/383 (36.29%), Query Frame = 3
Query: 3657 VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQN----------KKTSPKFIQKLDKEIISP-------INEKVIVRCKVSGNPNPILKWMKNGEELSESDHLK---IRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRE-LDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVD 4739
            V++  I+  PV      +I  ++ G +  VC + +Y     + W          R L N+ +Y+        +T       +Y  ++T  D G Y  +V N  G  S    + V  + E  +          ++T    + +   E   P       + E V     ++ +P P + W K+G+++   D  K          ++L I +    D   Y   A N +G +  K  L V            L  P      PTE                       T +R  P F     +    EG  V  +  + G P P + W  +   ++  P  E+  E LD Y L +++    D+G Y +TA N++G  +C A + V+
Sbjct: 33349 VKVASIEIGPVSGQIMHAI-GEEGGYVKYVCKIENYDQSTQVTWYFG------VRQLENSEKYE--------ITYEDGVATMYVKDITKFDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTKKVKRRTDAMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPRVTWYKSGQKIKPGDDEKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKHGEDSCKAKLTVT-----------LHPP------PTE-----------------------TTLR--PMFKRLLANAECHEGQSVCFEIRVSGIPAPTLKWEKDGQPLSLGPHIEIVHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVE 33674          

HSP 22 Score: 62.7734 bits (151), Expect = 4.436e-8
Identity = 68/282 (24.11%), Postives = 100/282 (35.46%), Query Frame = 3
Query: 3900 LYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSA-LVIVD 4739
            L  + V T D GEY     N +G +     +TV        ++ +P   ++++   ++ +       C++ G PN   +W K G E+ ESD   IR       L I   +  D G Y  +ASN  GS      L V                       TE Y P                       S P+ +TTF  +  K        C + G P   +IW         +P   +    +++ L L N+   D G YS  A N  G   C A L I+D
Sbjct: 4306 LVIEAVKTEDEGEYVCEASNDSGKAKTSAKLTVG-------ERAAPVIKRRIEPLEVA-LGHLAKFTCEIQGAPNVRFQWFKAGREIYESDKCSIRSSNYVSSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTV-----------------------TEAYPPT--------------------FLSRPKALTTFVGKAAK------FLCTVSGTPVIEIIWQKDGAALSPSPDCRVTDADNKHSLELSNLTVQDRGIYSCKASNKFGADICQAELTIID 4530          

HSP 23 Score: 62.3882 bits (150), Expect = 5.562e-8
Identity = 156/795 (19.62%), Postives = 290/795 (36.48%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEI--NPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPAD----------------------------------------------DNSDISSPQ--RTQMIFSNTIV-----RSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPL-IWWSYNTHFINNPRFEMKRELDEYF---------LILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            + ++W+K +  ++      I L+        ++ +       +G Y C V N       S+     +F ++  T + + ++ +    + P+ L+    G      S  + N  P++    +C  +    + +++    ++  +D  QY   +   + +D+ +  + + E P F+       + +G+ + +   +    ++    I W K  T L +       + N+   LV  I K   + VG+YTC+  N  G       ++++  L+  +  +P    P  + +L D + T  +G  +  +          V W KD + L   D  +Q+ +      +L+I     +  G Y         T ++  ++  +  +  P     P S+      S +  C V        I W+         R +     YKM       L  N   + +    V   D G+Y     N AG  S    + V         +  P+FI+KLD+  I   +E     CK+ G+P   + W K+  E+ ES   ++        L + +    D+G Y  +A N  GS  S   L+V +P   V   KP          P E  + AD                                              D +DI   Q   T  + S+T V     ++PPQFV   TD     G +V L+  + G  EP+ + W  +       + E+ RE D  +         L     +  ++G+Y+   +N +G+  C A + V
Sbjct: 7751 FKVKWFKGSRELVSGEACTISLE----DFVTELELLEVEPGQSGDYSCLVTNDAG----SASCTTHLFVKEPATFVKRLADTSVETGS-PIVLEATYSGTPPISVS-WMKNEYPLS-QSPNCGITTTEKSSILEILESTI--EDYAQYACLIENEAGQDICEALVSVLEPPYFIEPLEHVEAAIGEPITLQCKVDGTPEIR---ISWYKEHTKLRSAPAYKMQFKNNVASLV--INKVDHSDVGEYTCKAENSVG------AVASSAVLVIKERKLP----PSFARKLKDVHET--LGFPVAFECRINGSEPLQVSWYKDGELLKD-DANLQMSFVHHV-ATLQILQTDQSHVGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGSFKCHVTGTAPIK-ITWA------KDNREIRPGGNYKMT------LVENTATLTVL--KVAKGDAGQYTCYASNVAGKDSCSAQLGV---------QEPPRFIKKLDQSRIVKQDEYTRYECKIGGSPEIKVLWYKDEVEIQESSKFRMSFEDSVAILEMHSLSVEDSGDYTCEARNAAGSASSSTSLKVKEP--PVFRKKPF---------PVETLKGADVHLECELQGTPPFQVSWHKDKRELRSGKKYKIMSENLLTSIHILNVDTADIGEYQCKATNDVGSDTCVGSVTMKAPPQFVKKLTDISTIIGKEVQLQTTIEGA-EPISVAWFKD-------KGEIVRESDNIWISYSENIATLQFSRAEPANAGKYTCQIKNDAGMQECYATLSV 8470          

HSP 24 Score: 62.3882 bits (150), Expect = 5.704e-8
Identity = 77/309 (24.92%), Postives = 129/309 (41.75%), Query Frame = 3
Query: 3924 SDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIK--NCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSP------------QRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCL--IGYPEPLIWWSYNTHFINNP-RFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPL 4799
            SD GE+ +  +N AG S++ + +TV    EA   +  P F++KL K +      ++ ++ + +GNPNP + W+KN + +    + +IR  G   E  +K  +    D+  Y A A N  G + ++C + V      V   +P  +P    IIP   Y+      +I++P            Q  +    +   +  P F    T   +K       +C L  IG P  ++ W ++   +    R  M  E     L        DSG  +  A N  G    SA +IV   ++   ++ SQ P   K L
Sbjct: 1529 SDSGEWTVVAQNRAGKSTISVTLTV----EAVEHQIKPAFVEKL-KNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPRIRIEGTRGEAALKIDSIISQDSAWYTATAINKAGRDTTRCKVNV-----EVEFAEP--EPERKLIIPRGTYR----AKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGAAYSRDSGVITCRATNKYGTDHTSATLIV--KDEKSLVEESQLPDGKKGL 1819          

HSP 25 Score: 62.3882 bits (150), Expect = 5.704e-8
Identity = 64/250 (25.60%), Postives = 101/250 (40.40%), Query Frame = 3
Query: 4011 EAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNT------TKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEP-LIWWSYNTHFINNPRFEMKRELD-EYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +++ +  +P FI+++    IS + +   +   V+G P P ++W  NG  L+ S   K    G+TH L+I   +  D G Y   ASN  G  V   HL+ I P G  +T       K LEKP                      P              PP F           G   V +  + G P P ++W+  +     +  + +    D     I+ + Q+GDSG Y   A+N  G +TC+A ++V
Sbjct: 3501 DSRQEGAAPVFIREISDVEIS-VEDVAKLSVTVTGCPKPKIQWFFNGMLLTPSADYKFVFDGDTHSLIILFTRFQDEGEYTCLASNEYGKAVCSAHLR-ISPRGERSTEMESGEKKALEKP--------------------KGP-------------CPPYFFKELKPVHCGPGIPAVFEYSVHGEPAPTVLWFKEDMPLYTSVCYTIIHSPDGSGTFIVNDPQRGDSGLYLCKAQNLWGESTCAAELLV 3715          

HSP 26 Score: 61.2326 bits (147), Expect = 1.244e-7
Identity = 54/251 (21.51%), Postives = 104/251 (41.43%), Query Frame = 3
Query: 3993 TVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFT-IIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWW-SYNTHFINNPRFEMK--RELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVI 4733
            T    A A+   T P  +  L K +     E V + C +SG P+P + W +   ++  S   +I   G    L+I+     D+G +   A N  G+  + C+L       +V  ++  +K  + T    TE  +  +    + +        +     + P F++    + + EG  VV +C + G P+P ++W           R+++   ++  E  L++      D+G Y+I   N  G  + SA ++
Sbjct:  932 TARVPAPAEVPVTPPTLVSGL-KNVTVIEGESVTLECHISGYPSPKVTWYREDYQIESSIDFQITFQGGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYL-------AVQVSEEFDKETTLTEKFATEEKRFVESRDVVMTDTSITEEQAGPGEPAAPFFISKPVVQKLVEGGSVVFECQIGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECRLVISMTFADDAGEYTIVIRNKHGETSASASLL 1174          

HSP 27 Score: 56.6102 bits (135), Expect = 3.556e-6
Identity = 49/158 (31.01%), Postives = 64/158 (40.51%), Query Frame = 3
Query: 3906 FDNVTTS--DGGEYCLRV--EN--SAGWSSVMIPITVAALAEAQNKKTSP------KFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVID----PIGSVN 4331
             D V T    G  Y  RV  EN    G     IPI      E Q K   P      K I+ L  +  + +    I+R    G P P  KW  +G E+   DH  +     +  L IKNC + D G Y+   SN  G++    HL V+D    P G +N
Sbjct: 19254 LDCVVTGLQQGKTYRFRVKAENIIGLGLPDTTIPI------ECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIR----GVPVPTAKWTTDGTEIKTDDHYTVETDSFSSVLTIKNCLRKDTGEYQLTVSNAAGTKTVAVHLTVLDVPGPPTGPIN 19401          
BLAST of Fibronectin type III domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8WZ42|TITIN_HUMAN (Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4)

HSP 1 Score: 117.087 bits (292), Expect = 1.633e-24
Identity = 175/774 (22.61%), Postives = 305/774 (39.41%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSS-CPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTY--INDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE----KPISFT-------------------IIPTERYQPADDNS---------DISSPQRTQMIFSNTI----------VRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYN-THFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            I W KDN  I P  + ++ L  N+ +    + +    + DAGQY C   N     + S    L V  Q+    I K          E    +  + G   +PE  +++      +  SS    S V S  +++ ++  +S++D G Y       +    + T L++ E P F        +L G  + +   ++      P  + W K+K  L     S K Y  +++N      I     A +G+Y C+ +N+ G D            + S   I + A P    +LSD  ++  VG  ++L           VVW KD   +      I I Y  E+  +L+ +     ++G Y   +K     Q     ++ ++ A +++  P+SI+     +  + C V   P   S  W     DG   + L ++ +YK+     NK++G      L   NV  SD G Y   V+N  G  S    + V+      ++   P F +KL KE        V++ CKV G+P   + W   G E+S     +      T  L +   ++SD+G Y   A+N  GS+     L V +P   V    P++      ++FT                   ++P +R   + ++S         D S       I SN            +++P +FV    D  +++G  ++L+    G P   + W  N  +   + R  +        L + +    D+G+Y+   EN+SG  +CSA +++
Sbjct: 8170 ITWAKDNREIRPGGNYKMTLVENTAT----LTVLKVGKGDAGQYTCYASNIAG--KDSCSAQLGV--QEPPRFIKKLEPSRIVKQDEFTRYECKIGG---SPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHN--LSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGADVHLECELQG---TPPFHVSWYKDKRELR----SGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSD----------TCVGS---IALKAPPRFVKKLSD--ISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISY-SENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEK-PESIKVTTGDTCTLECTVAGTPEL-STKWF---KDG---KELTSDNKYKI--SFFNKVSG------LKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVS------DRTVPPSFTRKL-KETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQKPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILI 8884          

HSP 2 Score: 88.1965 bits (217), Expect = 9.915e-16
Identity = 119/543 (21.92%), Postives = 203/543 (37.38%), Query Frame = 3
Query: 3243 FEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRN--LVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE------KPISFTIIPTERYQPA--DDNSDISSPQRTQM----------IFS------------------------NTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
             EI +      G+YTC+ SNE+G       L+  EA   +    P S             +T  VG + K           + +W KD   L S  P  +I    E+K  L+++  T+ D G Y               E+  I     I++  + +++  N  +++ C V+      ++ WS       P ++  +    +   +  PL KL                 D G Y     N AG SS    +TV         +  P F++K+D   +    E   + CK+ G+P   + W KN +ELSES+ +++  V     L I + K  D+G Y  +A N  GS+     + + +P   + T +P +        +   +  T  ++ +   D   I S ++ ++          IFS                          +++ PP FV    D I   G  V L+  + G  P  + W         + + +M        LI+ ++Q    G+Y+  AEN +G  T    +IV
Sbjct: 4440 LEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKS-------------LTTFVGKAAKFICTVTGTPVIETIWQKDGAAL-SPSPNWRIS-DAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIKEL-EPVQSAINKKVHLECQVDEDRKV-TVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKL----------------KDSGTYVCTASNEAGSSSCSATVTV---------REPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEPADIVRGTNALLQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIV 4940          

HSP 3 Score: 86.2705 bits (212), Expect = 3.699e-15
Identity = 157/740 (21.22%), Postives = 272/740 (36.76%), Query Frame = 3
Query: 2538 RIDKDQ-YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVS---SKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTY--INDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            ++D+D+   + W KD + + P  D +I  +    +    + I   +  D+G Y C   N       SS    +V  ++  + + K          E   L   L G   +P   + +      ++ S+       ++E I  +   V ++D G Y          D   T + I E P F+      + + G +  +   +       P  I W K+K  +     S K Y   +    +  EI  F  A VG+Y C V+NE G    K    A   L    T +          ++ D    G  G ++ L           V W+K  Q +   D +I++ +       L I    ++  G Y  + +    +QT++ E+   + A +I+   + I+        +   V   P        +KP      R LV + +Y++          N+ +++ Y  +    D G+Y   + N  G SS     TV       ++  +P F + L + + S +N    + CK++G+    + W K+G+E++ SD  +I  V  T  L I     +DAG +  +A+N+ GS+ S   L V +P                                                   P FVT    + V  G  V LK    G  P  + W+  N   ++     + +E  E  L L  ++  DSG Y+    N +G   CSA + V
Sbjct: 4593 QVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIAT----LEIPLAKLKDSGTYVCTASNEAG----SSSCSATVTVREPPSFVKKVDPSYLMLPGESARLHCKLKG---SPVIQVTWFKNNKELSESNTVRMYFVNSEAI-LDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEPADIVRGTNALLQCEVSG---TGPFEISWFKDKKQIR----SSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVG----KCGCMATHLLKEPPTFV---------KKVDDLIALG--GQTVTLQAAVRGSEPISVTWMK-GQEVIREDGKIKMSF-SNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKIIERA-ELIQVTAGDPATLEYTVAGTPE-------LKPKWYKDGRPLVASKKYRI------SFKNNVAQLKFY--SAELHDSGQYTFEISNEVGSSSCETTFTVL------DRDIAPFFTKPL-RNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEP---------------------------------------------------PSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFV 5222          

HSP 4 Score: 85.8853 bits (211), Expect = 4.266e-15
Identity = 163/719 (22.67%), Postives = 256/719 (35.61%), Query Frame = 3
Query: 2631 SQSGKMKMHIDNCRESDAGQYWCEVR---NGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAK---PISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKE---TGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWS-----IKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALV 4730
            SQSG+    + N    +AGQ  C  R     P+   K     LS  S + G  I    E T+   T P+S+    DGF        I  +   N+         V++ +       + + +D GQY   +   + +DV    +   E P FV       + +GDS+++   +    ++   T+ W K  T L         + N+   LVF   K      G+YTC+  N  G               SS+T+  +  +   P  + QL D  +  +VG  + L           V W +D   L   D  +Q  +  ++  +LKI    ++ SG Y         T  +   +    P + +P     P SI      S +  C V  + P    I WS     I+P  G+ T   V N  +  I K                  V   D G+Y  +  N  G       ++V         K  PKF++KL+   ++   E + + CK+SG+P   + W +N  EL ES    +  +     L I      D+G Y  +A N  G       L V  P   V T KP   P+                                                  +G DV+L+C + G P   ++W        N+ +F++  +  +  L + N++  D G Y   A N  G  TCS  V
Sbjct: 6885 SQSGEYTCVVSN----NAGQASCTTRLFVKEPAAFLKR----LSDHSVEPGKSI--ILESTYTG-TLPISVTWKKDGFN-------ITTSEKCNI---------VTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSVSLQCQVAGTPEI---TVSWYKGDTKLRPTPEYRTYFTNNVATLVFN--KVNINDSGEYTCKAENSIG-------------TASSKTVFRIQERQLPPSFARQLKD--IEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRD-DENLQTSF-VDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREP-KKSPFFDIKPVSIDVIAGESADFECHVTGAQP--MRITWSKDNKEIRPG-GNYTITCVGNTPHLRILK------------------VGKGDSGQYTCQATNDVGKDMCSAQLSV---------KEPPKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAP--PVFTQKP--SPVG-----------------------------------------------ALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSV 7472          

HSP 5 Score: 83.5741 bits (205), Expect = 2.588e-14
Identity = 153/744 (20.56%), Postives = 265/744 (35.62%), Query Frame = 3
Query: 2679 DAGQYWCEVRNGPS-------VIRKSSPVLLSVFSQKQGTVIPKFSEKTFA--ANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN-SRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQF--APVIQDFPQSIRAKQNGSINIVCVV-NSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPL-----EKPISF----TIIPTERYQPADDNSDISSPQRTQMIFSNTI----------------------------------VRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALV 4730
            D+G+Y CE +N          VI K SP     F  K   V+ ++     A  A T P  +    D                  +  S   +     + ++          D G+Y  RV+++    +    + + E P F+      +SL G + A    +K      P T+ W K+   +T +     T+ N+   L          H G Y CQ  N+ G       +    AL+S +    ++ + +S        +  + GD   L V+F         W KD Q L      +I +    ++   LKI      DSG Y   ++      +    IN +     P      + + + +   I++ C+V  S+P   SI W          + +  + +YK           N   +E+    +  +D G Y     N AG +     +TV         K  P F++K   + ++P N +V ++  V G     +KW K+ +EL       + K   +  L +   K +D+G Y  Q SN  G+  SK  L V +P   +    P+      +  +F    T  P  R     D ++I++ Q+  + F + +                                  V+ PP F+       V +  DV L+C + G P   + W   N    ++ ++ +   +  + L +      D+G Y     N  G  +CS  V
Sbjct: 5293 DSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEF--KPIEVLKEYDVMLLAEVAGTPPFEITWFKDN----------------TILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFIKKIESTSSLRGGTAAFQATLKG---SLPITVTWLKDSDEITEDDNIRMTFENNVASLYLS--GIEVKHDGKYVCQAKNDAG-------IQRCSALLSVKEPATITEEAVS--------IDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISV---TDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPI--SIQWF------KDDQEISASEKYKF------SFHDNTAFLEI--SQLEGTDSGTYTCSATNKAGHNQCSGHLTV---------KEPPYFVEKPQSQDVNP-NTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRV 5969          

HSP 6 Score: 82.4185 bits (202), Expect = 5.192e-14
Identity = 160/755 (21.19%), Postives = 289/755 (38.28%), Query Frame = 3
Query: 2652 MHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLS---VFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNH-RSVSLKDVGQYLFRVSSK---DVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHK-TYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKET-GQTQTTIV-----EINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG--------SVNTTKPL--------EKPISFTIIPTERYQPADDNSDISSPQRTQM--IFSNTI------------------------VRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSH 4745
            + I+     D+G Y CE  NG      S+ + +    VF+QK   V         A     + L+  + G    P  ++++      V +S     K++S       H  ++   DVG+Y  + +++   D     ++  E P FV      ++L+GD++ +   ++ F    P +++W K++  +     + + ++I++   L    P+ + +  G Y CQ+ N+ G      + SA   ++    +I    KP          +T + G+   L+            W KD + L S D +  I +  +   SLKI  A ++D G Y   +K + G++  T+       I P  F   ++D    + A    S+ + C V+      S+ W     DG+           ++++ P  + + +     L    +  SD G Y     N AG       +TV         +  P F Q  D   + P    +     + G P   +KW K   EL   +   I       EL +   +  ++G Y    +N  GS     HL V +P          SV T  P+          PIS + I  E      +   I+  +++ +  I  +TI                        V  PP F+          G+   L+C + G PE  I W+  +T   + P ++M+ + +   L++  +   D G YS  A+NS G    SA++++ + 
Sbjct: 7349 LTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSPV--------GALKGSDVILQCEISG---TPPFEVVWVKDRKQVRNSKK--FKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSDTSTLIGDAVELRAIVEGFQ---PISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNS--GKYICQIKNDAG----MRECSAVLTVLEPARII---EKP--------EPMTVTTGNPFALECVVTGTPELSAKWFKDGREL-SADSKHHITFINKV-ASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKD----VNAILGASVVLECRVSGSAPI-SVGWF---QDGN-----------EIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTV---------QEPPSFEQTPDSVEVLP-GMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKAR 8039          

HSP 7 Score: 80.4925 bits (197), Expect = 2.106e-13
Identity = 161/786 (20.48%), Postives = 290/786 (36.90%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKT---FAANTEPLSLKLVLDG-----FKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHV---GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSI---NIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVI-----------DPI-----------GSVNTTKPLE----------------------KPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            ++I W+KD + I      R+     SQ   + + I +   +D G+Y C V N    + K   +   +  +      P F +K     A   + ++L+  + G       +    ++I  +  I ++ S+     +  +  I F  +   L +          + + K   +I E+ E +          GD   +   +    ++ PK   W K+  PL  +K    ++ N+  +L     KF  A +   G YT ++SNE G    +   +     +  + + P   KP+ +    D+ V G+     +LD +    +   V W KD + + + D R +I +  E   SL+I    +ND+G +           T  V       A ++Q+ P  +    +  +   + VC+ +++    S   +I+   G+  + LV+     +  + L         +ELY   V TSD G Y  +V N AG       + V         K    F++KL+   +    +   + CKV+G P   + W  N  E+ ES   ++  V  T  L + +    D+G Y  +A N  GS+   C   VI            PI             V  T P E                        +S  I+        +    +++   + +  +   +R PP F+          G     +  L G  P  + W   +     +    M  E +   L L  I+    G+Y   A+N +G+  CSAL+ V
Sbjct: 4787 FEISWFKDKKQIRSSKKYRLF----SQKSLVCLEIFSFNSADVGEYECVVANE---VGKCGCMATHLLKEP-----PTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKIIERAELI------QVTAGDPATLEYTVAGTPELKPK---WYKDGRPLVASKKYRISFKNNVAQL-----KFYSAELHDSGQYTFEISNEVGSSSCETTFT-----VLDRDIAPFFTKPLRNV---DSVVNGTC----RLDCKIAGSLPMRVSWFKDGKEIAASD-RYRIAF-VEGTASLEIIRVDMNDAGNFTC-------RATNSVGSKDSSGALIVQEPPSFVTKPGSKDVLPGSAVCLKSTFQG--STPLTIRWFKGN--KELVSGGSCYITKEALE------SSLELYL--VKTSDSGTYTCKVSNVAGGVECSANLFV---------KEPATFVEKLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSD--HCSSIVIVKESPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSV 5502          

HSP 8 Score: 80.1073 bits (196), Expect = 2.777e-13
Identity = 151/746 (20.24%), Postives = 270/746 (36.19%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNG-------PSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDR 4769
            + + WYKD   +      +I+    S++    +HI N   +D G+Y C+  N         S+  K+ P  +   S     V  +   +T     EP+S+    D  +   ESD I+ +   N+  ++  +S+V      ++  +  +   + +    +S  + A     I EKPE +          GD+  +   +    ++S K   W K+   LT++     ++ N    L  +I     +  G Y+ +V N  G+D     L      +S +T+ P   + +  +        G  G S+ ++ +        V W  +   ++S   R       ++ C+L +N    +DSG Y  +      +      +  ++  P     P  +      ++    +V   P   S++W      GS    LV   R  +       L  ++  +EL+  +V TS  GEY   V N AG +S    + + A A         KF+++L+   I    + +I+    +G P   + W KNG  ++ S    I    ++  L I +    DAG Y     N +G +     + +++P                                                   P FV       V  GD   L+C L G PE  + W+  +T       ++M    +   L+   +   DSG Y   AENS G  + S  + V       S  R
Sbjct: 8355 FHVSWYKDKRELRSGKKYKIM----SENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENI--ATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPAT----IVEKPESI------KVTTGDTCTLECTVAGTPELSTK---WFKDGKELTSDNKYKISFFNKVSGL--KIINVAPSDSGVYSFEVQNPVGKDSCTASLQ-----VSDRTVPPSFTRKLKETN-------GLSGSSVVMECKVYGSPPISVSWFHEGNEISSG--RKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLT-VREPPSFVQKPDPMDVLTGTNVTFTSIVKGTPP-FSVSW----FKGS--SELVPGDRCNV------SLEDSVAELELF--DVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPA---------KFVKRLNDYSIEK-GKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEP---------------------------------------------------PYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSR 8988          

HSP 9 Score: 76.2554 bits (186), Expect = 3.436e-12
Identity = 120/547 (21.94%), Postives = 199/547 (36.38%), Query Frame = 3
Query: 3276 GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPR-FEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPLPPETYSNLVKTHINDESRVMQASPRGWQEFQFHSNAST 4913
            G Y CQ+SN+ G    K  L   E         P   K  S   +  N      G S   + +        V W  D   + +       +   +   + +I+GA V +SGTY    +    T +  +E+   +    I++  + +   +   + + C V   P    + W            L NN   +   K    LT  +    L+      SD GEY   V N  G  S     T  AL E       P FI+K++    + +      +  V+G+P   + W+K+ + L E D++ I  V     L I++     +G Y  QA N +G  V +C+                    +F ++                             + P Q V       V E D + L+C + G PE  + W  +   I   R F M  E +     ++++ K DSG+Y+   EN  G ++C A + V        +D++  PS +K L       ++ + I+ E +V  + P   Q F+     ST
Sbjct: 5763 GTYICQLSNDVGTATSKATLFVKEP--------PQFIKKPSPVLVLRN------GQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFI--DGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIREL-KPVEVVKYSDVELECEVTGTPP-FEVTW------------LKNNREIRSSKK--YTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCS---TRVALKEP------PSFIKKIEN-TTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESG--VERCY--------------------AFLLV-----------------------------QEPAQIVEKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRV--------LDQNIPPSFTKKL--TKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEIST 6206          

HSP 10 Score: 73.9442 bits (180), Expect = 1.719e-11
Identity = 113/548 (20.62%), Postives = 189/548 (34.49%), Query Frame = 3
Query: 3261 TQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKC---------SLKINGATVNDSGTYQA-VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNL-VNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTE--------RYQPA------DDNSDISSPQRTQMIFSNT----------------------------------IVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSA 4724
            T+ H G+Y C+  N+ G+     +L+  +            A P+   ++    V  ++G   K   E  +  +    W K  +         +IY  E  KC         SL+I    V D G Y      E G    T        + P     P+S+      +   +C V   P   +I W    A  SP+ N  +++A  K I               L   N+T  D G Y  +  N  G       + +            P FI++L+  + S IN+KV + C+V  +    + W K+G++L      KI    +   L I   K  D+G Y   ASN  GS      + V +P   V    P     S+ ++P E        +  P        +N ++S     +M F N+                                  +++ PP F+ T     +  G + +L+C + G  P  + W+       ++ ++ +  +     L + +    D G Y     N  G   C A
Sbjct: 4351 TEDHQGEYVCEALNDSGKTATSAKLTVVK-----------RAAPVIKRKIEPLEV--ALGHLAKFTCEIQSAPNVRFQWFKAGR---------EIY--ESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKSLTTFVGKAAKFICTVTGTPVIETI-WQKDGAALSPSPNWRISDAENKHI---------------LELSNLTIQDRGVYSCKASNKFGADICQAELIII---------DKPHFIKELEP-VQSAINKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVREPPSFVKKVDP-----SYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEPADIVRGTNALLQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMA 4843          

HSP 11 Score: 73.1738 bits (178), Expect = 3.197e-11
Identity = 154/731 (21.07%), Postives = 264/731 (36.11%), Query Frame = 3
Query: 2652 MHIDNCRESDAGQYWCEVRN-------GPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKY--APESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVS---SKDVAKTHLEIGEK--PEFVYHQFKENSLLGDSLAISIPMK-NFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLN----------SRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-----VLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPIN----EKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYF-LILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            + I N  + DAGQY CE+ N       G  V     P  ++     +  V    S +   A T  +++       K    PE    F N   NV               + FN   V++ D G+Y  +         +KT   I E+  P     Q K+   +  ++ + + +    +  +P  + W ++   L  ++    +++++   L  +I +   +H G Y+C  SN  G      +L+A E   S    I    KP+S   ++        G+S   +          + W KDN+ +              P ++I         LK+      DSG Y       V K+    Q ++ E  P +F   ++    S  AKQ  SI + C ++  P    ++W    ++      L  + +Y M    +N +        L  +  +  D G+Y     N  G +S    +TV         K  P F QK      SP+       VI++C++SG P   + W+K+ +++  S   KI        L I N + SD G Y  +A+N  GS+   C ++  +P                                                   P+FV   +D     GD V L+  + G+ P  ++W       I          +D    L L + +  +SG+Y    +N +G+  CSA++ V
Sbjct: 6970 LEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTN---NVA-------------TLVFNK--VNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKD---IEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATL--KILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDI----KPVSIDVIA--------GESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRI---------LKVGKG---DSGQYTCQATNDVGKDMCSAQLSVKE--PPKF---VKKLEASKVAKQGESIQLECKISGSPEIK-VSWFRNDSE------LHESWKYNM--SFINSVA------LLTINEASAEDSGDYICEAHNGVGDASCSTALTV---------KAPPVFTQKP-----SPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEP---------------------------------------------------PRFVKKLSDTSTLIGDAVELRAIVEGFQPISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTV 7568          

HSP 12 Score: 70.4774 bits (171), Expect = 2.391e-10
Identity = 80/321 (24.92%), Postives = 133/321 (41.43%), Query Frame = 3
Query: 3780 INWSIKPADG-SPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRV--ENSAG---WSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRK---VGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI-NNPRFEMKRELDEYFLILKN-IQKGDSGRYSITAENSSGL 4709
            + W    +DG +  RN     R K  NK ++  T  ++       N+   +G EY  RV  EN  G   WS +  PIT  +    Q    +P F ++L    +   +   +V CKV+G+P PI+KW + G+E+  +D LK R     G  H+L+I +    DA +Y+ +A+N  GS      L+V  P                              + I  P+  + + +   +R                G+ V +K    G P+P+I W      I NN  +++        L+  N +++ D+G Y + A+N  G+
Sbjct: 31770 VAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLI--EGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQ----APHFKEELRNLNVRYQSNATLV-CKVTGHPKPIVKWYRQGKEII-ADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVP------------------------------AKIHLPKTLEGMGAVHALR----------------GEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGI 32036          

HSP 13 Score: 69.3218 bits (168), Expect = 4.876e-10
Identity = 147/742 (19.81%), Postives = 262/742 (35.31%), Query Frame = 3
Query: 2565 QWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPS-------VIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQF-NHRSVSLKDVGQYLFRVS---SKDVAKTHLEIGEKPEFVYHQFKENSLL--GDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESK---CSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLN-KLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIG-YPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            QW+KD + I      R++  C+ +S  + + ++N    D   Y C+V N          +  K  P  L    ++Q         K     T P  +K   D                 +V   S P   +       F N  SV     GQY   V+     D   T L + E P+FV  + + + ++  GDS  +   +    ++    ++W +N+  L  +     T+I+     V ++   +    GD+ C+  N  G      ++   E  + S    P   + + ++++S             L+ E       +VVW KD + L S        Y   SK    S+ I     +D G Y    +    + T +  +        +++ P+ +       +N + VV   P+   +  SI+ A   P        + ++I +  N ++T       L F     ++ G+Y  +++N  G    M  + V            P  I +    +   + E   + CKV+G P   ++W K+G+ L+ S   K     +   L I + ++ DAG Y  Q  N  G   S C   V                               D SD +                PP F     +     G   +L+C + G  P  + W+   T  ++  +++     +   L L ++   D G Y+  A N +G   C A++ V
Sbjct: 6196 QWFKDGKEISTSAKYRLV--CHERS--VSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPSFLVKPGRQQAIPDSTVEFKAILKGTPPFKIKWFKD-----------------DVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFV-KKLEASKIVKAGDSSRLECKIAGSPEIR---VVWFRNEHELPASDKYRMTFIDSVA--VIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSS--FPPIVETLKNAEVS-------------LECELSGTPPFEVVWYKDKRQLRSSK-----KYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVK-------LKEPPRFV-----SKLNSLTVVAGEPA--ELQASIEGA--QPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVL----------EPAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGK--SSCTAVV-------------------------------DVSDRA---------------VPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTV 6816          

HSP 14 Score: 68.1662 bits (165), Expect = 9.377e-10
Identity = 172/792 (21.72%), Postives = 274/792 (34.60%), Query Frame = 3
Query: 2472 LLLVNAESSCPTRLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRILLQCNSQS---GKMKMHIDNCRESDAGQYWCEVRNG---------------PSVIRKSSPVLLSVFS----QKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVA---KTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDN-QPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQ-------NGSINIVC-VVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTF-TDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI-NNPRFEMKRELDEYFLI-LKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            L+L N +S   T  +  +   P+I      + WY D   I         +Q +  S   G     I   R  ++G Y CE RN                P+ IR+  PV +  +S    + + T  P F       N E  S K      KY     +   N+ I     S                      D G+Y   VS++  +    T + + E P F+       ++L  S              P +I W K+   L  +   + ++++    L  +I      H G YTCQ  NE G     ++   A  L+     I   AK +  ++           D + L+          V WLKD  Q + SR   +     E +  S +I      DSG Y   ++    + +    +  +      Q+ P S   K          SI++ C V  S P   S  W     DG   + +  +A+Y+++         + + + L  +N+   D   Y  +V N AG  +    +TV         K  P F+ K  ++   P +  V  +  + G P   +KW K+  EL       I   G T  L + +   S  G Y    +N  GS+     L V +P                                                   P+FV      +IVK GD   L+C + G PE  + W  N H +  + ++ M   +D   +I + N+   DSG +   A+N +G  +CS  VIV
Sbjct: 5798 LVLRNGQS---TTFECQITGTPKIR-----VSWYLDGNEI-------TAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSK------KYTLTDRVSVFNLHITKCDPS----------------------DTGEYQCIVSNEGGSCSCSTRVALKEPPSFIKKIENTTTVLKSSATF---QSTVAGSPPISITWLKDDQILDEDDNVYISFVDSVATL--QIRSVDNGHSGRYTCQAKNESG-----VERCYAFLLVQEPAQIVEKAKSVDVTE----------KDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSF---ENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLD-----QNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPI--SAQWF---KDG---KEISTSAKYRLVC--------HERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTV---------KEPPSFLVKPGRQQAIP-DSTVEFKAILKGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEP---------------------------------------------------PKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTF-IDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIV 6440          

HSP 15 Score: 68.1662 bits (165), Expect = 1.020e-9
Identity = 149/743 (20.05%), Postives = 269/743 (36.20%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKV-------SSNEMIQFNHRSVSLK-------DVGQYLFRVSSKDVAKTH---LEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSV-GDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIF-SNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSAL 4727
            +++ WYKD   +      +I     S++    +HI N   SD G+Y C+ +N       S   + +V  ++    + K +  T  A  EP  L+  ++G +            PI V      W K        S N  I F     +L+       + G+Y+ ++ +    + +   L + E    V         +G++  +   +    ++S   + W K+   LT+++    ++ N    L   I    +   G YT QV N  G+              S   ++ VS + +  S       TG V G S  L+ +        V W  +   + S   + Q  +  ++ C+L++N    +D G Y  V      +      +  +Q  P     P+ +      ++    V+   P    +NW          R LV   R  +           +  +EL+  N+  S  GEY   V N+AG +S    + V         K    F+++L    + P  + +I+    +G     + W K+G  ++ S+   I    +T  L I N  K DAG Y  +  N  G +V    +  ++P   V   +PLE  +  ++  + + Q A       +P+ T   +  +T +R  P++ T FT+ +                                             L+   +   DSG Y+  AENS G A+   +
Sbjct: 6473 FEVVWYKDKRQLRSSKKYKIA----SKNFHTSIHILNVDTSDIGEYHCKAQNEVG----SDTCVCTVKLKEPPRFVSKLNSLTVVAG-EPAELQASIEGAQ------------PIFVQ-----WLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKAGPMTVTVGETCTLECKVAGTPELS---VEWYKDGKLLTSSQKHKFSFYNKISSL--RILSVERQDAGTYTFQVQNNVGKS-------------SCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVS-GAKYQTTF-SDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLT-VQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTPP-FKVNWF------RGARELVKGDRCNIY------FEDTVAELELF--NIDISQSGEYTCVVSNNAGQASCTTRLFV---------KEPAAFLKRLSDHSVEP-GKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSV--SLQCQVA------GTPEITVSWYKGDTKLRPTPEYRTYFTNNVAT-------------------------------------------LVFNKVNINDSGEYTCKAENSIGTASSKTV 7092          

HSP 16 Score: 67.3958 bits (163), Expect = 1.715e-9
Identity = 119/514 (23.15%), Postives = 190/514 (36.96%), Query Frame = 3
Query: 3255 KFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQA-----VLKETGQTQTTIVE-INPIQFAPVIQDFPQSIRAKQNGSINIVC-VVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNS-DISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNT--HFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSID 4766
            K  ++  G Y+C  +N  G        S++  LI ++   P    P    +L+   V   VG+S   +          V W KD++ + S   + QI Y E S   L +      DSG Y       V K++   Q  I E + P  F    +   +++   +  S  +   V  S P   ++ W     +  PT N               ++T     + L       +D G Y  +V N AG +     I +      +  K  P F Q L    +S   E V + C V G+    ++W+K G E+  SD         T  L +++  K+D+G Y  +ASN  GS+ +K  + + D        KP        + P  +    D     +S PQ  +++   T          TF   I K G D          P P + W+           R  + ++ DE  L +++  K DSG Y   A N  G    +  + VD   K   I+
Sbjct: 9045 KTDRSLAGQYSCTATNPIG------SASSSARLILTEGKNP----PFFDIRLAP--VDAVVGESADFECHVTGTQPIKVSWAKDSREIRSGG-KYQISYLENS-AHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFT---KRLSETVEETEGNSFKLEGRVAGSQPI--TVAWYKNNIEIQPTSNC--------------EITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVI------KEPKKPPVFDQHLTPVTVSE-GEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKD--------KP-------AVAPATKKAAVDGRLFFVSEPQSIRVVEKTT---------ATF---IAKVGGD----------PIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKIE 9481          

HSP 17 Score: 64.6994 bits (156), Expect = 1.103e-8
Identity = 80/311 (25.72%), Postives = 130/311 (41.80%), Query Frame = 3
Query: 3918 TTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIK--NCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSP------------QRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCL--IGYPEPLIWWSYNTHFINNP-RFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSNSKPL 4799
            T SD GE+ +  +N AG SS+ + +TV    EA   +  P F++KL K +      ++ ++ + +GNPNP + W+KN + +    + KIR  G   E  +K  +    D+  Y A A N  G + ++C + V      V   +P  +P    IIP   Y+      +I++P            Q  +    +   +  P F    T   +K       +C L  IG P  ++ W ++   +    R  M  E     L        DSG  +  A N  G    SA +IV   ++   ++ SQ P   K L
Sbjct: 1521 TPSDSGEWTVVAQNRAGRSSISVILTV----EAVEHQVKPMFVEKL-KNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNV-----EVEFAEP--EPERKLIIPRGTYR----AKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIV--KDEKSLVEESQLPEGRKGL 1813          

HSP 18 Score: 64.3142 bits (155), Expect = 1.454e-8
Identity = 39/134 (29.10%), Postives = 68/134 (50.75%), Query Frame = 3
Query: 3927 DGGEYCLRV--ENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIG 4322
            +G +Y  RV   N+ G   V +P     + EA+ +   PK +  + ++I     +K+ +   V G P+P  KW K  +E+  S HL + K   +  L+IK+  + D+G Y   A N++G++  K  + V+D  G
Sbjct: 19792 EGKKYKFRVAARNAVG---VSLPREAEGVYEAKEQLLPPKIL--MPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPG 19920          

HSP 19 Score: 63.5438 bits (153), Expect = 2.966e-8
Identity = 37/139 (26.62%), Postives = 68/139 (48.92%), Query Frame = 3
Query: 3891 RIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV 4307
            R +L    VT ++ G Y L+  N +G ++    + V A      +   P F+Q+L    +     +V ++ +V+G P P++K+ ++G E+  S   +I + G+ + L+I      D+G Y   A+N+ G   S   L V
Sbjct:   62 RAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKA------ETAPPNFVQRLQSMTVRQ-GSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLV 193          

HSP 20 Score: 63.1586 bits (152), Expect = 3.814e-8
Identity = 44/138 (31.88%), Postives = 65/138 (47.10%), Query Frame = 3
Query: 3897 ELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVG-ETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV 4307
            +L  ++VTT D  EY +   N  G  S    +TV       +    P F ++L         + V    +VSG P P LKW K+G+ LS   +++I   G + + L I++    D G Y   A+NT GS   + HLQV
Sbjct: 32676 QLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMF-KRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 32812          

HSP 21 Score: 62.7734 bits (151), Expect = 4.044e-8
Identity = 79/381 (20.73%), Postives = 148/381 (38.85%), Query Frame = 3
Query: 3657 VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQN---KKTSPKFIQKLDK--------EIISP-------INEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRE-LDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVD 4739
            V++  I+  PV      ++  ++ G +  VC + +Y     + W          R L N+ +Y++  +    +        LY  ++T  D G Y  +V N  G  S    + V  + E  +   ++T  K  ++ D         E   P       + E V     ++ +P P + W K+G+++   D+ K            K   +SD G+Y+                     I SV T    E    +T++   +Y   +D+             +++ +R  P F     +   +EG  V  +  + G P P + W  +   ++  P  E+  E LD Y L +++    D+G Y +TA N++G  +C A + V+
Sbjct: 32487 VKVASIEIGPVSGQIMHAV-GEEGGHVKYVCKIENYDQSTQVTWYFG------VRQLENSEKYEITYEDGVAI--------LYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDK------------KYTFESDKGLYQLT-------------------INSVTTDDDAE----YTVVARNKY--GEDSCKAKLTVTLHPPPTDSTLR--PMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVE 32813          

HSP 22 Score: 62.003 bits (149), Expect = 8.457e-8
Identity = 70/283 (24.73%), Postives = 101/283 (35.69%), Query Frame = 3
Query: 3900 LYFDNVTTSD-GGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPE-PLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSA-LVIVD 4739
            L  D V T D  GEY     N +G ++    +TV        K+ +P   +K++   ++ +       C++   PN   +W K G E+ ESD   IR       L I   +  D G Y  +ASN  GS      L V                       TE Y P                       S P+ +TTF  +  K        C + G P    IW         +P + +    +++ L L N+   D G YS  A N  G   C A L+I+D
Sbjct: 4344 LVIDKVNTEDHQGEYVCEALNDSGKTATSAKLTVV-------KRAAPVIKRKIEPLEVA-LGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTV-----------------------TEAYPPT--------------------FLSRPKSLTTFVGKAAK------FICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIID 4569          

HSP 23 Score: 61.2326 bits (147), Expect = 1.483e-7
Identity = 158/789 (20.03%), Postives = 294/789 (37.26%), Query Frame = 3
Query: 2556 YDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANT-EPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRV---SSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVS--SDVVWLKDNQPLNS----RDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEK----------------PISFTIIPTER-------YQPADDN------------SDISSPQ--RTQMIFSNTIV-----RSPPQFVTTFTDEIVKEGDDVVLKCCLIGY-PEPLIWWSYNTHFINNPRFEMKRELDEYF---------LILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            + ++W+K +  ++P     I L+        ++ +   +  ++G Y C V N       S+     +F ++  T + + ++  F+  T  P+ L+    G    P S     +  +      C  +    + +++    ++  +D  QY   +   + +D+ +  + + E P F+       +++G+   +   +    ++    I W K  T L +       + N+   LV  I K   + VG+Y+C+  N  G        S+A  +I ++ L P  A+ +     +  +    V    +++   P  VS   D V LKD+  L +        +QI   ++S    + N +  N  GT  +  K         + ++  +  P     P S+      S    C V        I W+         R +     YKM       L  N   + +    V   D G+Y     N AG  S    + V         +  P+FI+KL+   I   +E     CK+ G+P   + W K+  E+ ES   ++  V     L + N    D+G Y  +A N  GS  S   L+V +P        P+E                 P   +    +R       Y+   +N            +DI   Q   T  + S+T V     ++PP+FV   +D     G +V L+  + G  P  ++W+          + E+ RE D  +         L    ++  ++G+Y+   +N +G+  C A + V
Sbjct: 7790 FKVKWFKGSRELVPGESCNISLE----DFVTELELFEVQPLESGDYSCLVTNDAG----SASCTTHLFVKEPATFVKRLAD--FSVETGSPIVLEATYTG--TPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTI--EDYAQYSCLIENEAGQDICEALVSVLEPPYFIEPLEHVEAVIGEPATLQCKVDGTPEIR---ISWYKEHTKLRSAPAYKMQFKNNVASLV--INKVDHSDVGEYSCKADNSVG-----AVASSAVLVIKARKLPPFFARKLKDVHETLGF---PVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIG-QYNCSASNPLGTASSSAK---------LILSEHEVPPFFDLKPVSVDLALGESGTFKCHVTGTAPIK-ITWA------KDNREIRPGGNYKMT------LVENTATLTVL--KVGKGDAGQYTCYASNIAGKDSCSAQLGV---------QEPPRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWF--------KDKGEIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSV 8509          

HSP 24 Score: 59.3066 bits (142), Expect = 4.598e-7
Identity = 54/247 (21.86%), Postives = 105/247 (42.51%), Query Frame = 3
Query: 4029 TSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVR---------SPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYN-THFINNPRFEMK--RELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVI 4733
            T P  +  L K +     E V + C +SG P+P + W +   ++  S   +I        L+I+     D+G +   A N  G+  + C+L       +V  ++  EK    T   TE++   ++   + S     ++ ++T +          + P F+T    + + EG  VV  C + G P+P ++W  +        R+++   ++  E  L++      D+G Y+I   N  G  + SA ++
Sbjct:  941 TPPTLVSGL-KNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYL-------AVQVSEEFEKE---TTAVTEKFT-TEEKRFVES---RDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLL 1172          

HSP 25 Score: 59.3066 bits (142), Expect = 5.128e-7
Identity = 59/251 (23.51%), Postives = 99/251 (39.44%), Query Frame = 3
Query: 4011 EAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWW---------SYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIV 4736
            +++ + T P FI+++    IS + +   +   V G P P ++W  NG  L+ S   K    G+ H L+I   K  D G Y   ASN  G  +   +L+ I+  G  +     E  ++ ++              +  P              PP F+         +G   + +  ++G P P + W         S     I+NP             I+ + Q+ DSG Y   AEN  G +TC+A ++V
Sbjct: 3495 DSEKEGTGPIFIKEVSNADIS-MGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLK-INSKGEGHKDTETESAVAKSL------------EKLGGP-------------CPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPN-------GSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLV 3711          

HSP 26 Score: 58.151 bits (139), Expect = 1.128e-6
Identity = 57/254 (22.44%), Postives = 104/254 (40.94%), Query Frame = 3
Query: 4065 IISPINEKVI-------VRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE-----KPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVR----------SPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN-NPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNH 4757
            II+P+ + V         +C+VSG  +  + W    +++  S   ++ +  +T++L I      D G Y   ASN  G   S  +L +  P   ++     E     K  S + +  E          +S    T  + S + V           + P F+   ++  +  GD   L   +IG P+P I W +N   +  +  ++   + D++ LI+   +  D G Y+  A N  G   CSA + ++S  + H
Sbjct: 3347 IITPLQDTVTSEGQPARFQCRVSGT-DLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSKINETLELLSESPVYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGH 3599          

HSP 27 Score: 57.7658 bits (138), Expect = 1.551e-6
Identity = 65/285 (22.81%), Postives = 109/285 (38.25%), Query Frame = 3
Query: 3927 DGGEYCLRV--ENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKE------GDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEY-FLILKNIQ-KGDSGRYSITAENSSGLATCSALVIVDSHNK 4751
            +  EY  RV  EN  G S    P   A   + +        I+K  K++ + + E   + C++ G P P +KW + G+EL +S   K+   G TH L +   ++ D G+Y   A+N                +G V T+                                    S  ++++ PQF   +    +KE      G  + L    IG P P + W +    + N         + Y  L++KN+Q K  +G+Y +   N  G  T  A++ V+  +K
Sbjct: 31424 EATEYEFRVFAENETGLSR---PRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNE---------------VGEVETS------------------------------------SKLLLQATPQFHPGYP---LKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFG--TVDAILDVEIQDK 31649          
BLAST of Fibronectin type III domain-containing protein vs. UniProt/SwissProt
Match: sp|A8DYP0|OBSCN_DROME (Obscurin OS=Drosophila melanogaster OX=7227 GN=Unc-89 PE=1 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 5.085e-24
Identity = 172/774 (22.22%), Postives = 303/774 (39.15%), Query Frame = 3
Query: 2562 IQWYKDN-----EAILPDCDPRILLQCNSQSGKMK----MHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAA----NTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSN--EMIQFNHRSVSLKDVGQYLFRVSSKDVAKTHL-EIGEKPEFVYHQF-----KENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYIND-NGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK--ETGQTQTTIVEINPIQFAPVIQDFPQSIRA--------KQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKL-DKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLI-WWSYNTHFINNPRFEMKRELDEYF-LILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQY 4778
            I+W+KD+     EAI      ++  + +++ G  +    + I + RE+D G Y C   N   V +  +P  L++ S     + P F +K   A      EPL L+  +DG    P    + +   +  + S     K+S+N   +++    S    D G Y   +S+    K  L  +  KPE +  +F      +  ++G+ L +   +  F   +P+ + W K+   L  +   +  +IN  NG++   I        G Y C ++N+ GE          E  +S   ++P  +KP+  ++L D   +   G  +K+D++   +    + W  +   +      I I    ++  SL I      DSG Y+ + +  E        + + P       ++ PQ + A         Q   ++   + N  P    + WS      +P   L+              +T + + I L       +D G Y   + N  G  S       A  A  +     P F QK+ D++ +   N K+ V   VSG P P L+W    + + +S+   I+  G+ H L++ NC+K D G+Y+  ASN  G ++++  L +++                                +I    R++          PP F+    D  + EG       C  GYPEP + W+  +     + RF +  E +    L +KN+ + D GRYS    N  G   C A +  DS +        QY
Sbjct: 2144 IEWFKDDKPINYEAINKPGKDKLYAKEDTKKGTDQIESVLDIKSFRENDVGAYTCVATNEIGVTK--APFKLAMLS-----LAPSFVKKLDNALDVLQGEPLVLECCVDGSPL-PTVQWLKDGDEVKPSESI----KISTNPDGLVKLEINSCQPNDSGAYKLIISNPHGEKVALCAVAVKPEEMQPKFLKPITSQTVVVGEPLKLEAQVTGFP--APE-VKWYKDGMLLRPSPEIN--FINSPNGQIGLIIDAAQPLDAGVYKCLIANKGGE---------IEG-VSKVEIVPKESKPVFVAELQD--ASSIEGFPVKMDIKVVGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKADETATEEAPQFVSALRDVNADEGQELVLSAPFISNPMPE---VIWSKDGVTLTPNERLL--------------MTCDGKHIGLTIKPAEAADSGNYTCLLANPLGEDSS------ACNANVRKVYKPPVFTQKISDQQQVFGNNAKIPV--TVSGVPYPDLEWYFQDKPIPKSEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIASNREGKDITQGRLDIVN--------------------------------EIKKHSRSE----------PPVFLKKIGDCDIYEGMVAKFTACATGYPEPEVEWFKNDQKLFPSDRFLIDIEPNGLLRLTIKNVTEYDVGRYSCRIFNPYGDDICHAELFYDSLDSQQKPLEDQY 2821          

HSP 2 Score: 66.2402 bits (160), Expect = 3.380e-9
Identity = 152/753 (20.19%), Postives = 267/753 (35.46%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNE--MIQFNHRSVSLKD---VGQYLFRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKN-FHKMSPKTI--------IWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQ-AVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNAR----YKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESD-HLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGD-DVVLKCCLIGYPEPLIWWSYNTHFINNPR--FEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNK 4751
            + W KDN+ +      RI  Q  +     ++ I NC E+DAG Y        ++  +S+    +V +Q      P   E     NTEP  L  + D        + +F  M + +     P  K   +E  +++ N R   ++D   +G Y   ++  DV KT  + G       ++  E +   +++A ++  KN F  +S + +         WK+N       +     +  D   L            G YTC      G      +LS   A+   QTL     KP  +  +       S+G S  L+++        V W  D + +   D R +  Y +E   SL I      D+G Y    + E GQ +++I  +  ++  P I+     I      +I +   V  +P               PT  + NN +       +    + +  +++++ +    +  S  G Y ++  N    +S     TV         K+ P  ++  + E I    E V +  ++   P   L W  +  E+  +D    +   G  + L I    + DAG Y  +A+N +GS  S   L                                                   +++  P+F     +  V EGD +V L   +  YP P   W  +   I+  R  F    E +++ LI+  +     G Y+    N  G    + +V V+   K
Sbjct: 1047 VTWLKDNKPLEDRLADRIT-QTAAPMNSYRLDIKNCSETDAGTY--------TIRAQSASETTTVSAQLAVGQAPGHDET--KTNTEPAFLVSLKDAEMI---ENTLFRFM-VKIIGDPKPRVKFYKDEKEILETNDRIQIIRDKDYLGFYELVIA--DVQKT--DAGTYSCKATNKHGEANC--EAIATTVEDKNPFGALSGQILPAGEKPVFQWKRNGEEFDPEERFKVLFGEDEDSLALVFQHVKPEDAGIYTCVAQTSTGNISCSAELSVQGAI---QTLNREPEKP--TLVIEHREANASIGGSAILELQCKGFPKPAVQWKHDGEVIQVDD-RHKFMYEDEESMSLVIKNVDTVDAGVYTIEAINELGQDESSINLV--VKAPPKIKKI-TDITCSAGETIKMEIEVEGFP--------------QPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIKATNDLSQTSEYWSCTV---------KSKPVIVKNFESEYIHGEKENVQMTVRIDAYPEAKLTWYHDETEIKITDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHGSATSSTQL---------------------------------------------------LIKCAPEFTHKLKNITVAEGDSNVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGNDFKLIMNQVATNMQGNYTCKIMNDYGKLEDNCVVTVNCKPK 1695          

HSP 3 Score: 63.5438 bits (153), Expect = 2.391e-8
Identity = 131/619 (21.16%), Postives = 224/619 (36.19%), Query Frame = 3
Query: 3024 VAKTHLEIGEKPE------------FVYHQFKENSLLGDSLAISIPMKN---FHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQP-LNSRDPRIQIYYPE------ESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEII---SPINEKVIVRCKVSGNPNPILKWMK-----NGEELSESDHLKIRKVGETHE--------LVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEI-VKEGDDVVLKCCLIGYPEPLIWW---------SYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG--LATCSALV 4730
            V KT +   E+PE            F  H ++   L  + +A  IP      +H   P T                H     D      E+        G+Y   V N+ GE   + +LS +         I    KPI +       +  + GD +   V F AD + ++V LKD QP + + + ++++   +      +  C+L I  A + DSG Y+  +K       T   I+ +   P I       +     +I    +V + P    ++W+          NL N+   ++I         +  +  L F +V+  + G+Y +   NS G ++V     +A L E       P FI + + + I    P++ KV+V     G P P ++W K     N E +++    K+    +T +        L IK+ +++D G Y   A+N  G                                                   T+  F   ++   P FV    + + V +G+ +VL+CC+ G P P + W         S +     NP   +K E++       + Q  DSG Y +   N  G  +A C+  V
Sbjct: 1798 VTKTLIATTEEPEEGAVPEIVHVDVFQQHSYESVPLKYEVIATGIPKPEAIWYHDGKPIT-------------PDKHTAITVDGDHYKLEVQSLDLVDAGEYKVVVQNKVGEKSHQGELSLSG--------IAEYRKPILTQGPGLKDIKVNKGDKVCEPVVFTADPAPEIVLLKDGQPVVETNNVKLKVDKKDAENGLVQYTCTLNILEAEIKDSGRYELKVKNKYGELVTSGWID-VLAKPEISGL-NDTKCLPGDTICFEALVQANPK-PKVSWT------RGNENLCNHENCEVIADV------DADKYRLVFQSVSPCEDGKYTITATNSEGRAAV--DFNLAVLVE------KPTFIVQPESQSIHDYRPVSTKVLVH----GVPLPTIEWFKDDKPINYEAINKPGKDKLYAKEDTKKGTDQIESVLDIKSFRENDVGAYTCVATNEIGV--------------------------------------------------TKAPFKLAMLSLAPSFVKKLDNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSESIKISTNPDGLVKLEIN-------SCQPNDSGAYKLIISNPHGEKVALCAVAV 2311          
BLAST of Fibronectin type III domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96RW7|HMCN1_HUMAN (Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2)

HSP 1 Score: 96.6709 bits (239), Expect = 2.369e-18
Identity = 175/746 (23.46%), Postives = 285/746 (38.20%), Query Frame = 3
Query: 2631 SQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANT---EPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLF---RVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSA-AEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV-IDPI-------------------------GS-------------VNTTKPLEKPISFTIIPTERYQPADDN----SDISSPQRTQMIFSNTIVRSPPQFVTTFTDEI-VKEGDDVVLKCCLIGYPEPLIWWSYNTH--FINNPRFEMKRELDE-YFLILKNIQKGDSGRYSITAENSSG 4706
            SQ     + I N   SD G Y CE  N    I+  + V ++      G V P        AN    + L+L   L      PE   I N+  +  N    P+  V S+  +      V L+D G+Y      V+  +   T + +   P   + Q   +++ G  + +++P K      P ++IW K    ++T+  S K     +G L    P   ++  G+Y C  +N  G    K+QL+      +          KP+  S L+        G+ + L  E  +     + W K+ Q ++   PR   + P  S   +KI     +DSG Y  V        T  V++N +   P IQ  P+ ++ +    ++I C     P    I WS     G  T  LV+   +  ++ P   L+          D  T SD G Y     N AG     I + V      ++ +  P +     + +    N+++   C   G P P +KW+ NG EL+  +   I  + +   LVI +    D G Y   A N  G+   K +L+V + P+                         G+             V  +  ++   +  I+   R  P D        I+    +Q  F+  ++  P    T F +E+ V    DV L+C + G P P I W  +    F+ +P  E+   LD    L LKN ++ D GRY  T  N++G
Sbjct:  845 SQLRTGALFILNLWASDKGTYICEAENQFGKIQSETTVTVT------GLVAPLIGISPSVANVIEGQQLTLPCTLLAGNPIPERRWIKNSAMLLQN----PYITVRSDGSLHIER--VQLQDGGEYTCVASNVAGTNNKTTSVVVHVLPTIQHGQQILSTIEG--IPVTLPCKASGNPKP-SVIWSKKGELISTS--SAKFSAGADGSLYVVSPGGEES--GEYVCTATNTAGYAKRKVQLTVYVRPRVFGDQRGLSQDKPVEISVLA--------GEEVTLPCEVKSLPPPIITWAKETQLISPFSPR-HTFLPSGS---MKITETRTSDSGMYLCVATNIAGNVTQAVKLN-VHVPPKIQRGPKHLKVQVGQRVDIPCNAQGTP-LPVITWS----KGGSTM-LVDGEHH--VSNPDGTLS---------IDQATPSDAGIYTCVATNIAGTDETEITLHVQEPPTVEDLE--PPYNTTFQERVA---NQRIEFPCPAKGTPKPTIKWLHNGRELTGREP-GISILEDGTLLVIASVTPYDNGEYICVAVNEAGTTERKYNLKVHVPPVIKDKEQVTNVSVLLNQLTNLFCEVEGTPSPIIMWYKDNVQVTESSTIQTVNNGKILKLFRATPEDAGRYSCKAINIAGTSQKYFNIDVLVPPTIIGTNFPNEVSVVLNRDVALECQVKGTPFPDIHWFKDGKPLFLGDPNVEL---LDRGQVLHLKNARRNDKGRYQCTVSNAAG 1532          

HSP 2 Score: 82.4185 bits (202), Expect = 4.522e-14
Identity = 116/539 (21.52%), Postives = 214/539 (39.70%), Query Frame = 3
Query: 3225 DNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQ--DFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDP------------IGSVNTTKPLEKPISFTIIPTERY----QPADD----------------NSDISSPQRTQMIFSNT----------IVRSPPQFVTT-FTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG 4706
            +NG+ + ++ + T    G Y+C+  N  G          ++   +   L+P    P        N V+  +   + L+ +       D+ W KD +PL   DP +++    +    L +  A  ND G YQ  +      Q   +++  I   P I+  +    I    N  I + C     P   +I W     DG P   ++++++   I+K      G      L+      SD   Y   V N AG +     + V      +    +P     L+K+++  I   + + CK +GNP+PIL W+K+G  +  +D+++I   G+  +L I + ++ D G Y   A++  G +  K  + V+ P            I  VN    L+  ++ +  PT  +    Q  D+                 + +S+    + + +NT           V  PP   ++  ++ +V +   V L+C   G P P I W  +   +N  +  +K +     L +      D+GRY+  A N++G
Sbjct: 1411 NNGK-ILKLFRATPEDAGRYSCKAINIAG---------TSQKYFNIDVLVP----PTIIGTNFPNEVSVVLNRDVALECQVKGTPFPDIHWFKDGKPLFLGDPNVELL---DRGQVLHLKNARRNDKGRYQCTVSNAAGKQAKDIKLT-IYIPPSIKGGNVTTDISVLINSLIKLECETRGLPM-PAITWY---KDGQP---IMSSSQALYIDK------GQY----LHIPRAQVSDSATYTCHVANVAGTAEKSFHVDVYVPPMIEGNLATP-----LNKQVV--IAHSLTLECKAAGNPSPILTWLKDGVPVKANDNIRIEAGGK--KLEIMSAQEIDRGQYICVATSVAGEKEIKYEVDVLVPPAIEGGDETSYFIVMVNNLLELDCHVTGSPPPTIMWLKDGQLIDERDGFKILLNGRKLVIAQAQVSNTGLYRCMAANTAGDHKKEFEVTVHVPPTIKSSGLSERVVVKYKPVALQCIANGIPNPSITWLKDDQPVNTAQGNLKIQSSGRVLQIAKTLLEDAGRYTCVATNAAG 1905          

HSP 3 Score: 80.4925 bits (197), Expect = 2.015e-13
Identity = 133/553 (24.05%), Postives = 208/553 (37.61%), Query Frame = 3
Query: 3231 GELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIP--VSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQ---------DFPQSIRAKQ---NGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVM--IPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDP---IG--SVNTTKPLEKPISFTI------------IPTERYQPADDNSDISSPQRTQMIFSNTI------------------------VRSPPQFVTTFTDEI----VKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG 4706
            G    +I    + + G Y+C  +NE GE +   ++         +  IP  ++   +    LS   V   V +++ L+ E  A  S+ + W KD QPL S D  + I     +  +L+I  A ++D+G Y  V            ++N IQ  P  Q         D  ++  AK    N  I++ C  N+ P   ++ W     DG P       +  K++  P  ++        L        D G Y     N AG  S+   + + V  + +  N          L +E+   +N+  ++ C  SG+P P   W K+G+ L E DH K    G    L I N + +D G Y   A NT GS     +L V  P   IG  S N T  +   IS T             +  E+    + N+ I    RT  I    +                        V  PP      ++ +    V+EG  V L+C     P P+I W  N   I      ++   D   L +K  +  D+G+Y   A N +G
Sbjct: 2627 GGRTLQILNAQEDNAGRYSCVATNEAGEMIKHYEV---------KVYIPPIINKGDLWGPGLSPKEVKIKVNNTLTLECEAYAIPSASLSWYKDGQPLKSDD-HVNI---AANGHTLQIKEAQISDTGRYTCVASNIAGEDELDFDVN-IQVPPSFQKLWEIGNMLDTGRNGEAKDVIINNPISLYCETNAAPP-PTLTWY---KDGHPL-----TSSDKVLILPGGRV--------LQIPRAKVEDAGRYTCVAVNEAGEDSLQYDVRVLVPPIIKGANSD--------LPEEVTVLVNKSALIECLSSGSPAPRNSWQKDGQPLLEDDHHKFLSNGRI--LQILNTQITDIGRYVCVAENTAGSAKKYFNLNVHVPPSVIGPKSENLTVVVNNFISLTCEVSGFPPPDLSWLKNEQPIKLNTNTLIVPGGRTLQIIRAKVSDGGEYTCIAINQAGESKKKFSLTVYVPPSIKDHDSESLSVVNVREGTSVSLECESNAVPPPVITWYKNGRMITE-STHVEILADGQMLHIKKAEVSDTGQYVCRAINVAG 3137          

HSP 4 Score: 80.1073 bits (196), Expect = 2.344e-13
Identity = 118/507 (23.27%), Postives = 185/507 (36.49%), Query Frame = 3
Query: 3270 HVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETH-ELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDRSQYPSN 4787
            H G YTC   N  G     + L   E              P+   Q S+ +V   + + I L  E     S  + W K+   +N+   R     P      L+I+ A   D+GTY  V +    T    +++N +Q  PVI    +      +  I + C  +  P    I W     DG   R +V + R ++++      +G++Q   + F  V   D G Y     N AG SS    +TV            P  I+  +       N + I+ C   G P P + W K+   L+   +L  +   E + EL+++N    D+G Y   A+N  G +     L V                    ++PT    P D +                                + +G+ + L C   G P P + W++N + I    F+      E  L+++ + K DSG Y  TAENS G       V V    K   + +  YPSN
Sbjct: 3961 HAGRYTCVARNAAGSAHRHVTLHVHE-------------PPVIQPQPSELHVI--LNNPILLPCEATGTPSPFITWQKEGINVNTSG-RNHAVLPSGG---LQISRAVREDAGTYMCVAQNPAGTALGKIKLN-VQVPPVISPHLKEYVIAVDKPITLSCEADGLPP-PDITWH---KDG---RAIVESIRQRVLS------SGSLQ---IAF--VQPGDAGHYTCMAANVAGSSSTSTKLTVHV----------PPRIRSTEGHYTVNENSQAILPCVADGIPTPAINWKKDNVLLA---NLLGKYTAEPYGELILENVVLEDSGFYTCVANNAAGEDTHTVSLTV-------------------HVLPTFTELPGDVS--------------------------------LNKGEQLRLSCKATGIPLPKLTWTFNNNII-PAHFDSVNGHSE--LVIERVSKEDSGTYVCTAENSVGFVKAIGFVYV----KEPPVFKGDYPSN 4358          

HSP 5 Score: 78.9518 bits (193), Expect = 5.291e-13
Identity = 123/544 (22.61%), Postives = 204/544 (37.50%), Query Frame = 3
Query: 3207 HKTY-INDNGELVFEIPKFTQAHV---GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQV-IDPIGSVNTTK---PLEKPISFTI----IPTERYQPADDNSDISSPQRTQMIFSNTI-------------------------------VRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYF-LILKNIQKGDSGRYSITAENSSG 4706
            H  Y I +NG L  +      AHV   G Y C  +N  G D  ++ L         Q  +P S  P  ++      +T  V     L  E        + W K+   LN    + Q  Y   S  SL I   +V+D+ TY+  +          V++  +Q  P I D P      ++    I C  +  P   SI+W+      +  R L     Y++++      +G ++ +    ++      G Y     N+AG +   + + V            P  IQ    E+   +N  +++ C+ +G P+P + W K G  ++ S   +   V  +  L I    + DAG Y   A N  G+ + K  L V + P+ S +  +    ++KPI+ +     +P        D   I    R +++ S ++                               V  PP+  +T     V E    +L C   G P P I W  +   + N     K   + Y  LIL+N+   DSG Y+  A N++G
Sbjct: 3757 HARYSILENGFLHIQ-----SAHVTDTGRYLCMATNAAGTDRRRIDL---------QVHVPPSIAPGPTN------MTVIVNVQTTLACEATGIPKPSINWRKNGHLLNVD--QNQNSYRLLSSGSLVIISPSVDDTATYECTVTNGAGDDKRTVDLT-VQVPPSIADEPTDFLVTKHAPAVITCTASGVPF-PSIHWT-----KNGIRLLPRGDGYRILS------SGAIEILATQLNHA-----GRYTCVARNAAGSAHRHVTLHVH----------EPPVIQPQPSELHVILNNPILLPCEATGTPSPFITWQKEGINVNTSG--RNHAVLPSGGLQISRAVREDAGTYMCVAQNPAGTALGKIKLNVQVPPVISPHLKEYVIAVDKPITLSCEADGLPPPDITWHKDGRAIVESIRQRVLSSGSLQIAFVQPGDAGHYTCMAANVAGSSSTSTKLTVHVPPRIRSTEGHYTVNENSQAILPCVADGIPTPAINWKKDNVLLAN--LLGKYTAEPYGELILENVVLEDSGFYTCVANNAAG 4246          

HSP 6 Score: 78.1814 bits (191), Expect = 9.285e-13
Identity = 114/508 (22.44%), Postives = 181/508 (35.63%), Query Frame = 3
Query: 3216 YINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDP-RIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKT----SPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMK------RELDEYFLILKNIQKGDSGRYSITAENSSG 4706
            Y+ ++  +  +I K T +  G Y C   +  G                +QT   VS  P    Q+ +N VT + G+   L     + V  ++ W ++++ +   +P RI+      +  SL++     ND+G Y  ++   G +    V +  +Q  P +   P++        ++I+C    YP    I W++          +V + RY+M +              L+  N    D G Y     NSAG              + QN       +PK +  +  E++  + +  ++ CK SG P P +KW K   EL  S  L I  +     L I+  +  DAG Y   A N  G    K  L                                    D+ SP               P F+    D  ++ G +V L C + GYPEP I W       N P F          +L    L + N+   D G Y   AEN  G
Sbjct:  475 YLKESASVNLDIAKVTLSDEGFYECIAVSSAGTG-------------RAQTFFDVSEPP-PVIQVPNN-VTVTPGERAVLTCLIISAVDYNLTWQRNDRDVRLAEPARIRTL----ANLSLELKSVKFNDAGEYHCMVSSEGGSSAASVFLT-VQEPPKVTVMPKNQSFTGGSEVSIMCSATGYPK-PKIAWTVN------DMFIVGSHRYRMTSDG-----------TLFIKNAAPKDAGIYGCLASNSAG-------------TDKQNSTLRYIEAPKLM-VVQSELLVALGDITVMECKTSGIPPPQVKWFKGDLELRPSTFLIIDPL--LGLLKIQETQDLDAGDYTCVAINEAGRATGKITL------------------------------------DVGSP---------------PVFIQEPADVSMEIGSNVTLPCYVQGYPEPTIKWR---RLDNMPIFSRPFSVSSISQLRTGALFILNLWASDKGTYICEAENQFG 874          

HSP 7 Score: 76.2554 bits (186), Expect = 3.136e-12
Identity = 160/731 (21.89%), Postives = 276/731 (37.76%), Query Frame = 3
Query: 2562 IQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVAKTH----LEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPK---TIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWS------SVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTH-FINNPRFEMKRELDE-YFLILKNIQKGDSGRYSITAENSSGL 4709
            I W KD + I      +ILL         K+ I   + S+ G Y C   N     +K   V + V    + +     SE+      +P++L+ + +G    P    + ++ P+N    +      SS  ++Q       L+D G+Y   V++    +T     L + E P           +L +++ +S P++   K +      I W K+   L+ +  +  T++N    +  E  + + A  G Y C   N  G         A E   S Q  +   A  IS S      V  +    ++L+ E     +  + WLKD  P++S    +Q+         L +  A ++D+G Y  V       +   +++  +   P I    Q++    + ++ ++C  ++ P   ++ W     DG P           ++ KP   ++ N  R  L  ++    D G Y     N AG +      ++ +P  +    E          +  ++  +IS       + C+ SG P P L W K G  +      ++R +    +L I   +KSDA +Y   ASN  G+   + +LQV                           +P   NS  S P                      T+ IV  G  + L+C + G P P + W  + H  I     E+   LDE + L LKNI   D+GRY   A N +G+
Sbjct: 1766 IMWLKDGQLIDERDGFKILLN------GRKLVIAQAQVSNTGLYRCMAANTAGDHKKEFEVTVHVPPTIKSS---GLSER-VVVKYKPVALQCIANGIP-NPSITWLKDDQPVNTAQGNLKIQ--SSGRVLQI--AKTLLEDAGRYTC-VATNAAGETQQHIQLHVHEPPSL----EDAGKMLNETVLVSNPVQLECKAAGNPVPVITWYKDNRLLSGS--TSMTFLNRGQIIDIESAQISDA--GIYKCVAINSAG---------ATELFYSLQVHV---APSISGSNNMVAVVVNN---PVRLECEARGIPAPSLTWLKDGSPVSSFSNGLQVL---SGGRILALTSAQISDTGRYTCVAVNAAGEKQRDIDLR-VYVPPNIMGEEQNVSVLISQAVELLCQSDAIPP-PTLTWL---KDGHP-----------LLKKPGLSISEN--RSVLKIEDAQVQDTGRYTCEATNVAGKTEKNYNVNIWVPPNIGGSDELTQ-------LTVIEGNLIS-------LLCESSGIPPPNLIWKKKGSPVLTDSMGRVRILSGGRQLQISIAEKSDAALYSCVASNVAGTAKKEYNLQVY-------------------------IRPTITNSG-SHP----------------------TEIIVTRGKSISLECEVQGIPPPTVTWMKDGHPLIKAKGVEI---LDEGHILQLKNIHVSDTGRYVCVAVNVAGM 2371          

HSP 8 Score: 73.1738 bits (178), Expect = 2.828e-11
Identity = 172/788 (21.83%), Postives = 291/788 (36.93%), Query Frame = 3
Query: 2541 IDKDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVS---SKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLK-DNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLK-ETGQTQT-TIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINE-KVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFIN--NPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVD---------SHNKNHSIDRSQYPSNSK--PLPPETYSNLVKTHIND 4844
            I    Y++ W +++  +      RI    N     + + + + + +DAG+Y C V +       ++ V L+V    + TV+PK   ++F   +E +S+     G+   P+     N+M I  +H      +++S+  +    ++ + KD G Y    S     D   + L   E P+ +  Q +    LGD   I++       + P  + W K    L  +       I D    + +I +      GDYTC   NE G    K+ L              V + P+   + +D  V+  +G ++ L           + W + DN P+ SR P       +    +L I     +D GTY    + + G+ Q+ T V +  +  AP+I   P      +   + + C             ++   +  P R  + N+   + N  +   +       L+ + V   DGGEY     N AG ++    + V  L   Q+            ++I+S I    V + CK SGNP P + W K GE +S S        G    L + +    ++G Y   A+NT G    K  L V                +   +   +R    D   +IS                            V  G++V L C +   P P+I W+  T  I+  +PR      L    + +   +  DSG Y   A N +G  T +  + V           H K     R   P N++  PLP  T+S    T + D
Sbjct:  544 ISAVDYNLTWQRNDRDVRLAEPARIRTLAN-----LSLELKSVKFNDAGEYHCMVSS--EGGSSAASVFLTVQEPPKVTVMPK--NQSFTGGSE-VSIMCSATGYP-KPKIAWTVNDMFIVGSHRY----RMTSDGTLFI--KNAAPKDAGIYGCLASNSAGTDKQNSTLRYIEAPKLMVVQSELLVALGD---ITVMECKTSGIPPPQVKWFKGDLELRPSTF----LIIDPLLGLLKIQETQDLDAGDYTCVAINEAGRATGKITLD-------------VGSPPVFIQEPAD--VSMEIGSNVTLPCYVQGYPEPTIKWRRLDNMPIFSR-PFSVSSISQLRTGALFILNLWASDKGTYICEAENQFGKIQSETTVTVTGL-VAPLIGISPSVANVIEGQQLTLPC-------------TLLAGNPIPERRWIKNSAMLLQNPYITVRSDG----SLHIERVQLQDGGEYTCVASNVAGTNNKTTSVVVHVLPTIQH-----------GQQILSTIEGIPVTLPCKASGNPKPSVIWSKKGELISTSS--AKFSAGADGSLYVVSPGGEESGEYVCTATNTAGYAKRKVQLTVY---------------VRPRVFGDQRGLSQDKPVEIS----------------------------VLAGEEVTLPCEVKSLPPPIITWAKETQLISPFSPRHTF---LPSGSMKITETRTSDSGMYLCVATNIAGNVTQAVKLNVHVPPKIQRGPKHLKVQVGQRVDIPCNAQGTPLPVITWSKGGSTMLVD 1214          

HSP 9 Score: 73.1738 bits (178), Expect = 3.373e-11
Identity = 106/492 (21.54%), Postives = 173/492 (35.16%), Query Frame = 3
Query: 3246 EIPKFTQAHV---GDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLA 4712
            E+ + + A V   G YTC  S+  G+D               + L+ V   P  +       +T      + L+ +  A     + WL++ + L +  PR++I         L+IN A + D+  Y  V       +TT   I  +   P I+  PQS+    N S  + C+    P+   I W     DG+      N+ARY ++               L+  +   +D G Y     N+AG     I + V            P  I      +   +N +  + C+ +G P P + W KNG  L+   +    ++  +  LVI +    D   YE   +N  G                                        DD   +           +  V+ PP      TD +V +    V+ C   G P P I W+ N   +  PR +  R L    + +   Q   +GRY+  A N++G A
Sbjct: 3582 EVLRISTAQVEDTGRYTCLASSPAGDD-------------DKEYLVRVHVPPNIAGTDEPRDITVLRNRQVTLECKSDAVPPPVITWLRNGERLQA-TPRVRIL---SGGRYLQINNADLGDTANYTCVASNIAG-KTTREFILTVNVPPNIKGGPQSLVILLNKSTVLECIAEGVPT-PRITWR---KDGAVLAG--NHARYSILENGF-----------LHIQSAHVTDTGRYLCMATNAAGTDRRRIDLQVHV----------PPSIAPGPTNMTVIVNVQTTLACEATGIPKPSINWRKNGHLLNVDQNQNSYRLLSSGSLVIISPSVDDTATYECTVTNGAG----------------------------------------DDKRTV-----------DLTVQVPPSIADEPTDFLVTKHAPAVITCTASGVPFPSIHWTKNGIRL-LPRGDGYRILSSGAIEILATQLNHAGRYTCVARNAAGSA 3976          

HSP 10 Score: 71.633 bits (174), Expect = 1.004e-10
Identity = 151/724 (20.86%), Postives = 266/724 (36.74%), Query Frame = 3
Query: 2568 WYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANTEPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYL---FRVSSKDVAKTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMK-NFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPL-NSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKET-GQTQTTIVEINPIQFAPVIQ--DFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEI-VKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDEYFLILKNI--QKGDSGRYSITAENSSG 4706
            W KD + +L D   + L      +G++ + I N + +D G+Y C   N     +K   + + V     G   PK    T   N   +SL   + GF   P+   + N  PI +N ++     V     +Q     VS  D G+Y       + +   K  L +   P    H  +  S++      S+ ++   + + P  I W KN   +T +  +H   + D G++   I K   +  G Y C+  N  G D     L+                 P S        +  ++ + + L  +        + WLK+++ + NS    ++I         L+I  +  +DSG Y  +     G+ Q        IQ  P +   + P  +      ++ +VC  N  P+   I W     DG P    + +   + I     +++ N   + +Y     TSD G+Y     N AG    +  + V      +  K   + +  L       ++  + + C+ +G P P + W+KNG  L  S H+++   G+   +V    + SD  +Y   ASN  G +    +LQV  P                         P  DNS                           T+EI V +G    + C   G P P + W  +   +     +    +  + ++L+ +  +  DSG+Y+  A N +G
Sbjct: 2906 WQKDGQPLLEDDHHKFL-----SNGRI-LQILNTQITDIGRYVCVAENTAGSAKKYFNLNVHVPPSVIG---PKSENLTVVVNNF-ISLTCEVSGFP-PPDLSWLKNEQPIKLNTNTL---IVPGGRTLQIIRAKVS--DGGEYTCIAINQAGESKKKFSLTVYVPPSIKDHDSESLSVVNVREGTSVSLECESNAVPPPVITWYKNGRMITES--THVEILAD-GQM-LHIKKAEVSDTGQYVCRAINVAGRDDKNFHLNVY--------------VPPSIEGPEREVIVETISNPVTLTCDATGIPPPTIAWLKNHKRIENSDSLEVRIL---SGGSKLQIARSQHSDSGNYTCIASNMEGKAQKYY--FLSIQVPPSVAGAEIPSDVSVLLGENVELVCNANGIPT-PLIQWL---KDGKP----IASGETERI-----RVSANGSTLNIY--GALTSDTGKYTCVATNPAGEEDRIFNLNVYVTPTIRGNKDEAEKLMTL-------VDTSINIECRATGTPPPQINWLKNGLPLPLSSHIRLLAAGQVIRIV--RAQVSDVAVYTCVASNRAGVDNKHYNLQVFAP-------------------------PNMDNS-------------------------MGTEEITVLKGSSTSMACITDGTPAPSMAWLRDGQPLG---LDAHLTVSTHGMVLQLLKAETEDSGKYTCIASNEAG 3513          

HSP 11 Score: 63.1586 bits (152), Expect = 3.260e-8
Identity = 110/469 (23.45%), Postives = 162/469 (34.54%), Query Frame = 3
Query: 3489 VVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVI--QDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRI-------ELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLE-------KPISFTI----IPTERYQPADDNSDISSPQRTQMIFSNTIVR--------------------------------SPPQFV--TTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNT---------HFINNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG 4706
            + WLKD  PL  + P + I    E++  LKI  A V D+G Y                +N I   P I   D    +   +   I+++C                 + G P  NL+    +K    P+  LT +M R+       +L       SD   Y     N AG +     + V       N  + P        EII    + + + C+V G P P + WMK+G  L ++  ++I  + E H L +KN   SD G Y   A N  G    K  L V  P   +   +  E         +S T     IP        D   +S     +++    ++R                                 PP  V   T  D  VKE   V L C + G P P I W  +          H I+  R          FL + N+Q   +GRY+  A + +G
Sbjct: 2135 LTWLKDGHPL-LKKPGLSI---SENRSVLKIEDAQVQDTGRYTCEATNVAGKTEKNYNVN-IWVPPNIGGSDELTQLTVIEGNLISLLC----------------ESSGIPPPNLI----WKKKGSPV--LTDSMGRVRILSGGRQLQISIAEKSDAALYSCVASNVAGTAKKEYNLQVYIRPTITNSGSHPT-------EIIVTRGKSISLECEVQGIPPPTVTWMKDGHPLIKAKGVEI--LDEGHILQLKNIHVSDTGRYVCVAVNVAGMTDKKYDLSVHAPPSIIGNHRSPENISVVEKNSVSLTCEASGIPLPSITWFKDGWPVSLSNSVRILSGGRMLRLMQTTMEDAGQYTCVVRNAAGEERKIFGLSVLVPPHIVGENTLEDVKVKEKQSVTLTCEVTGNPVPEITWHKDGQPLQEDEAHHIISGGR----------FLQITNVQVPHTGRYTCLASSPAG 2557          

HSP 12 Score: 56.9954 bits (136), Expect = 2.435e-6
Identity = 125/559 (22.36%), Postives = 197/559 (35.24%), Query Frame = 3
Query: 3228 NGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSD----VVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAV-LKETGQTQTTIVEIN-PIQFAPVIQDFPQ--SIRAKQNGSINIVCVVNSYPSCHSINW---SIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSS------VMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESD-HLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDP--IGSVNTTKPLEKPISFTI--------IPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVT---TFTDEIVK-------------------EGD-------------DVVLKCCLIGYPEPLIWWSYNTHFI---NNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSG 4706
            N +    I + T +  G YTC  +N  G D  ++ L   E              P +   L   Y T          +EFP          + WL + + L  R+P I I    E    L I   T  D+G Y  V + E G T+    + N  +   PVI+D  Q  ++    N   N+ C V   PS   I W   +++  + S T   VNN +                   L     T  D G Y  +  N AG S       V++P T+                     E+   +N  V + C+V G P P + W K+G+ L   D ++++   G+   L +KN +++D G Y+   SN  G +     L +  P  I   N T  +   I+  I        +P        D   I S  +   I     +  P   V+   T+T  +                     EG+              + L+C   G P P++ W  +   +   +N R E   +  E    + + Q+ D G+Y   A + +G
Sbjct: 1221 NPDGTLSIDQATPSDAGIYTCVATNIAGTDETEITLHVQE--------------PPTVEDLEPPYNTTFQERVANQRIEFPCPAKGTPKPTIKWLHNGRELTGREPGISIL---EDGTLLVIASVTPYDNGEYICVAVNEAGTTER---KYNLKVHVPPVIKDKEQVTNVSVLLNQLTNLFCEVEGTPS-PIIMWYKDNVQVTESS-TIQTVNNGKI------------------LKLFRATPEDAGRYSCKAINIAGTSQKYFNIDVLVPPTIIG--------------TNFPNEVSVVLNRDVALECQVKGTPFPDIHWFKDGKPLFLGDPNVELLDRGQV--LHLKNARRNDKGRYQCTVSNAAGKQAKDIKLTIYIPPSIKGGNVTTDISVLINSLIKLECETRGLPMPAITWYKDGQPIMSSSQALYIDKGQYLHIPRAQVSDSATYTCHVANVAGTAEKSFHVDVYVPPMIEGNLATPLNKQVVIAHSLTLECKAAGNPSPILTWLKDGVPVKANDNIRIEAGGKKLE----IMSAQEIDRGQYICVATSVAG 1719          

HSP 13 Score: 55.4546 bits (132), Expect = 6.610e-6
Identity = 101/436 (23.17%), Postives = 155/436 (35.55%), Query Frame = 3
Query: 3438 GDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTIVEINPIQFAPVI---QDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWS------SVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKREL----DEYFLILKNIQKGDSGRYSITAENSSG 4706
            G SI L+ E        V W+KD  PL  +   ++I    +    L++    V+D+G Y  V            +++ +   P I      P++I   +  S+++ C  +  P   SI W     DG P  +L N+ R          L+G      L     T  D G+Y   V N+AG        SV++P  +      ++ K   K              + V + C+V+GNP P + W K+G+ L E +   I   G    L I N +    G Y   AS+  G +     L V                    + PT     +D N     P+   +I +     SP   V                 C    YP   I W     F +    E  R +        L + N Q+ ++GRYS  A N +G
Sbjct: 2307 GKSISLECEVQGIPPPTVTWMKDGHPL-IKAKGVEIL---DEGHILQLKNIHVSDTGRYVCVAVNVAGMTDKKYDLS-VHAPPSIIGNHRSPENISVVEKNSVSLTCEASGIP-LPSITWF---KDGWPV-SLSNSVRI---------LSGGRM---LRLMQTTMEDAGQYTCVVRNAAGEERKIFGLSVLVPPHIVGENTLEDVKVKEK--------------QSVTLTCEVTGNPVPEITWHKDGQPLQEDEAHHIISGGRF--LQITNVQVPHTGRYTCLASSPAGHKSRSFSLNVF-------------------VSPTIAGVGSDGN-----PEDVTVILN-----SPTSLV-----------------CEAYSYPPATITW-----FKDGTPLESNRNIRILPGGRTLQILNAQEDNAGRYSCVATNEAG 2653          
BLAST of Fibronectin type III domain-containing protein vs. TrEMBL
Match: A0A267FY06 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012691g1 PE=4 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 4.851e-56
Identity = 172/656 (26.22%), Postives = 291/656 (44.36%), Query Frame = 3
Query: 2886 NNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQY--LFRVSSKDVA---KTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPK-TIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPE-ESKCSLKINGATVNDSGTYQAVLKETGQTQTTI--VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNL-VNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI--NNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDR----SQYPSNSKPLPP 4805
            N  P++ +     W         +     V++ D G    L R     VA      L++   P FV        L G+ + +   ++     SP   ++W K+  PL           N +G    ++P   ++H G Y C+ +++ GE V  + +   +  I S+   P++ + +              G  ++L V+F  + + +V W +D+Q L    PR+ +      S C+  I+   + D+G Y   L+  G  Q T+  +++ P   AP            +  S  + C ++  P    I W       +P   L +N+  Y  ++              L  D  T  D GEY L  EN  G       + V +    +   ++P+F   + +E+I+ +++KV ++C V G+P P + W K+  ++  +DHL +  + E H LVI   +  DAG+Y+  ASN+ GS   +C L+V                                N +    +RT ++F NT+V+ PP+F+  F DE+ K GDDV+L+C + G PEP +WWS+N+  I  N+ RF        + L +K +   ++GRYS+TAENSSG+ATCSAL++V+   K  S ++    S + SNS    P
Sbjct:  815 NGRPLHTDRLGGKWRLDEGPGYSRVTCDRVTVDDAGDIACLIRDGGSGVAMETSCRLQVLSPPSFVRELQSIRVLEGEPILLQCQVRG----SPTPEVVWLKDNWPLRAGVDCDVVVDNLDGICAVKVPTADRSHAGVYKCRATSDAGEAV-SVAMVEVQEFIKSRFTRPLADQSVQE------------GGRLQLHVDFEGEPAPEVTWFRDSQRLFESPPRLLLSTGRGNSTCT--IDPLRLEDAGLYSVQLRNPGGVQKTVCNIDVRPKGEAPRCWSQLMDANVLEGSSTRLSCRISGNPPPR-IVWRFNGRQLTPRPGLRINSDTYSGVHT-------------LEIDEATKEDDGEYSLLAENPEGRVETSCRLFVES---TKPVPSAPRFAGDICEELIANVSDKVTLQCTVHGHPLPTVTWFKDERKIYTNDHLIVSGMDELHSLVIPYVRLQDAGVYKIIASNSLGSAECRCTLRV--------------------------------NDEEQMAKRTTLVFHNTLVKEPPEFIRLFRDEMCKVGDDVILECEIHGIPEPSVWWSFNSEPILDNDKRFRKLSSGHVHSLFIKRVSDAETGRYSVTAENSSGVATCSALLVVEEPGKTGSFEKVTRQSSWGSNSNLASP 1402          

HSP 2 Score: 224.557 bits (571), Expect = 5.755e-55
Identity = 315/1496 (21.06%), Postives = 592/1496 (39.57%), Query Frame = 3
Query:  117 ITESSIPTAIAQVHQWIDVNGTAMIKSNQRLPYSFKEAEELRKLHEKIELKCMNFLAFYAHM-NLKTIPEDCEPMRQNMDIAIHNFSERVKARRHVVVSFFTFYRHLDELTDTFKGIREEDHIHLPDTLSDVQDVIEKYHNTTNLCLKKFSHLKEEAIRVKASLDMLLKLDNDLSTQIVDPALIKKVIKYLDELMNQTELELTSC-------YENQHLMEMEVKIESKMMFIEEEIMRSTSWMQIILDVIISRYNDTVVGKATVENDILQEQNKDYVKNLQMAHEYGTRLQDLYKKFCDQFDRETDRGDSVSDKFDELWNTAEIVSAESTERLKIASNLFHNLDSTLEIVEDLLMAINKDRENIEKKDSIFDHYQAKIYDVHGDYQNIKKIATHLFQKLQFDLMNKRLIPKSSCSAEIEQIEDMVKMKIFTLSVKIKALDRCLHNDEVPLIQTLAATKERSALDATDYDNAGIFDIIKKYLAFLNSSLSNW-ESKPLPKTLDQARKSIDAHKKLSGQSEDYWKDIQNTLSQYFGNSPKAIQSKEVKSMLSDAENQKRKWDKKWSSHLKRKLDPRLQLLLKIQNFNDVLGENMSTLDEF-----VTRPNHSLPLVIELKEELG-RMTIDPKWDKLKQLKNEAQSIHESDFDTPLNSLEAKLNSYNNRLNNFLQLESIIEEIHEFLPKLTSFKSEWHSRVNMHRDNPVEMAELKDEA-------KQIHARIDEFDIEQFRKLATAIYGSSKRVEWLIDELVVDFRIPKQHRTISATHKAIENPIIPAKQAQVRTEKSETPNKNIESNGKLLLVNAESSCPTRLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRI--LLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANT---EPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVAKTHLEIGEKPEFVYHQFK-----ENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPK--FTQAHVGDYTCQVSNEFGED--VLKLQL---SAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKC-SLKINGATVNDSGTYQAVLKET--GQTQTT----IVEINPIQFAP-VIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTS-----------PKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKV--GETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSP 4424
            ++   +   + Q+  W+   GT ++ S + LP +F+EAE +RK HE+ E KCM  LA YA + +++T   +     + ++I I +F  R+++RR  VVS +TF+R   +L   FK               ++ D++    N      ++     EE       ++ LL+    L  Q    A   +++    E+++    +L           E   +  +E +   +++  E +  ++ +W++ I++ ++  Y    +GK  VE   + +Q++      Q  ++ G  +     K       +T+   ++    +  W     +  E ++R   A   + N+D  LE +E L++ I +D +N    + + + Y  +  ++   Y+N K+I   L +++QF + +   +P++     I+Q++D++K+K+FTL +KI+ L   L      +I+    T+    +  T          I K+   L    + W E+  LP T+ +A   I+ H+  + +    W  +   L++     P+     E     +DA+ +  +W ++W   +         LL      N+V  +  + L E      VTR     P+   +++  G +  +     K++ L  E +     DF+  +  +E +   Y   L        +I  I ++L KL +F  E    +   R         +DEA       ++ +   D FD +     A  +YGSS++   +I+ L          R I A   A E  I+  +  Q  T     P + +     L L    + C   +++   S P       D++W ++   +  D   R+    + +   G  ++  D     DAG   C +R+G S +   +   L V S       P F  +  +      EP+ L+  + G    PE   + +N P+      C     + + +      +      G Y  R +S       + + E  EF+  +F      ++   G  L + +   +F       + W +                  + + +FE P         G+ TC +     ED  +  +QL      +  + +  + P    P   SQL D  V    G S +L      +    +VW  + + L  R P ++I     S   +L+I+ AT  D G Y ++L E   G+ +T+    +    P+  AP    D  + + A  +  + + C V+ +P               PT     + R    N  L  ++G  +   L    V   D G Y +   NS G +     + V    E   K+T+           P+FI +L ++ +  + + VI+ C++ G P P + W  N E + ++D  + RK+  G  H L IK    ++ G Y   A N++G       L V +P      T   EK          R      NS+++SP
Sbjct:   41 LSREEVLNGVGQILDWVHGPGTKLLDSQRELPRNFEEAERIRKNHEQFEFKCMQALANYASLRDVRTNDNELAERLEKLEITIQDFLRRLQSRRQAVVSLYTFFRLRRDLDSYFK---------------EIADMLVWTDNQQQHQQQRI----EETEHYLRQVEKLLRFGESLYQQFCSEAERIRIVITFKEILDIVAAQLAEAKPLLAKQLEMLKIRLLETRRRLQLLVYERDASQTVAWLEDIINAVLDTYLGHCIGKTPVETQQILQQHRTLQAKSQETYDCGLEIIAALTKIYRAQGADTEGCVAMRSNLESNWRRLNEILIEMSDRYATADAFYENVDLNLERIERLILLICRDLDNGMSLEDVRETYANERDEIVKAYENTKRIGVGLMERIQFPVAS---LPQTVDQTMIDQVQDVIKVKLFTLWLKIRELYYYLGQ----MIEITEVTERWQIIRVT----------IDKFFERLLHWEARWQEATSLPFTIPEAESLIEEHRLANDEIGGLWSQLLKDLAE-LSRDPQVGSLAEQAQ--ADAQRRMEEWQRRWERRMAELDLRLRLLLRLRDLGNEV-DDKRTRLAELKTERTVTRAG---PVADTVRDVAGLQRGVSDMHSKMESLFAETREKVHRDFERHIEPIEERWREYVKELELLQMFLELILRILQYLEKLDAFIEELTVELPSCR--------FRDEAEPWLQKIREFNRITDSFDCDWLSNAAIRLYGSSEKPRPVIERL----------RLIMARLLAFETSILDMEIVQRVTVTQSAPRRLLRELQDLSL-PVGARCHLAVEY---SSP---SKSADVEWQRNGRPLHTD---RLGGKWRLDEGPGYSRVTCDRVTVDDAGDIACLIRDGGSGVAMETSCRLQVLSP------PSFVRELQSIRVLEGEPILLQCQVRG-SPTPEVVWLKDNWPLRAG-VDCDVVVDNLDGICAVKVPTADRSHAGVYKCRATSDAGEAVSVAMVEVQEFIKSRFTRPLADQSVQEGGRLQLHV---DFEGEPAPEVTWFR------------------DSQRLFESPPRLLLSTGRGNSTCTIDPLRLEDAGLYSVQLRNPGGVQKTVCNIDVRPKGEAPRCWSQLMDANVLE--GSSTRLSCRISGNPPPRIVWRFNGRQLTPR-PGLRINSDTYSGVHTLEIDEATKEDDGEY-SLLAENPEGRVETSCRLFVESTKPVPSAPRFAGDICEELIANVSDKVTLQCTVHGHP--------------LPTVTWFKDERKIYTNDHL-IVSGMDELHSLVIPYVRLQDAGVYKIIASNSLGSAECRCTLRVND-EEQMAKRTTLVFHNTLVKEPPEFI-RLFRDEMCKVGDDVILECEIHGIPEPSVWWSFNSEPILDNDK-RFRKLSSGHVHSLFIKRVSDAETGRYSVTAENSSGVATCSALLVVEEP----GKTGSFEK--------VTRQSSWGSNSNLASP 1402          
BLAST of Fibronectin type III domain-containing protein vs. TrEMBL
Match: A0A267G7V2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014261g1 PE=4 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 1.447e-55
Identity = 172/656 (26.22%), Postives = 291/656 (44.36%), Query Frame = 3
Query: 2886 NNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQY--LFRVSSKDVA---KTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPK-TIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPE-ESKCSLKINGATVNDSGTYQAVLKETGQTQTTI--VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNL-VNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI--NNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDR----SQYPSNSKPLPP 4805
            N  P++ +     W         +     V++ D G    L R     VA      L++   P FV        L G+ + +   ++     SP   ++W K+  PL           N +G    ++P   ++H G Y C+ +++ GE V  + +   +  I S+   P++ + +              G  ++L V+F  + + +V W +D+Q L    PR+ +      S C+  I+   + D+G Y   L+  G  Q T+  +++ P   AP            +  S  + C ++  P    I W       +P   L +N+  Y  ++              L  D  T  D GEY L  EN  G       + V +    +   ++P+F   + +E+I+ +++KV ++C V G+P P + W K+  ++  +DHL +  + E H LVI   +  DAG+Y+  ASN+ GS   +C L+V                                N +    +RT ++F NT+V+ PP+F+  F DE+ K GDDV+L+C + G PEP +WWS+N+  I  N+ RF        + L +K +   ++GRYS+TAENSSG+ATCSAL++V+   K  S ++    S + SNS    P
Sbjct:  815 NGRPLHTDTLGGKWRLDEGPGYSRVTCDRVTVDDAGDIACLIRDGGSGVAMETSCRLQVLSPPSFVRELQSIRVLEGEPILLQCQVRG----SPTPEVVWLKDNWPLRAGVDCDIVVDNLDGICAVKVPTADRSHAGVYKCRATSDAGEAV-SVAMVEVQEFIKSRFTRPLADQSVQE------------GGRLQLHVDFEGEPAPEVTWFRDSQRLFESPPRLLLSTGRGNSTCT--IDPLRLEDAGLYSVQLRNPGGVQKTVCNIDVRPKGEAPRCWSQLMDANVLEGSSTRLSCRISGNPPPR-IVWRFNGRQLTPRPGLRINSDTYSGVHT-------------LEIDEATKEDDGEYSLLAENPEGRVETSCRLFVES---TKPVPSAPRFAGDICEELIANVSDKVTLQCTVHGHPLPTVTWFKDERKIYTNDHLIVSGMDELHSLVIPYVRLQDAGVYKIIASNSLGSAECRCTLRV--------------------------------NDEEQMAKRTTLVFHNTLVKEPPEFIRLFRDEMCKVGDDVILECEIHGIPEPSVWWSFNSEPILDNDKRFRKLSSGHVHSLFIKRVSDAETGRYSVTAENSSGVATCSALLVVEEPGKTGSFEKVTRQSSWGSNSNLASP 1402          

HSP 2 Score: 224.172 bits (570), Expect = 6.730e-55
Identity = 317/1497 (21.18%), Postives = 590/1497 (39.41%), Query Frame = 3
Query:  117 ITESSIPTAIAQVHQWIDVNGTAMIKSNQRLPYSFKEAEELRKLHEKIELKCMNFLAFYAHM-NLKTIPEDCEPMRQNMDIAIHNFSERVKARRHVVVSFFTFYRHLDELTDTFKGIREEDHIHLPDTLSDVQDVIEKYHNTTNLCLKKFSHLKEEAIRVKASLDMLLKLDNDLSTQIVDPALIKKVIKYLDELMNQTELELTSC-------YENQHLMEMEVKIESKMMFIEEEIMRSTSWMQIILDVIISRYNDTVVGKATVENDILQEQNKDYVKNLQMAHEYGTRLQDLYKKFCDQFDRETDRGDSVSDKFDELWNTAEIVSAESTERLKIASNLFHNLDSTLEIVEDLLMAINKDRENIEKKDSIFDHYQAKIYDVHGDYQNIKKIATHLFQKLQFDLMNKRLIPKSSCSAEIEQIEDMVKMKIFTLSVKIKALDRCLHNDEVPLIQTLAATKERSALDATDYDNAGIFDIIKKYLAFLNSSLSNW-ESKPLPKTLDQARKSIDAHKKLSGQSEDYWKDIQNTLSQYFGNSPKAIQSKEVKSMLSDAENQKRKWDKKWSSHLKRKLDPRLQLLLKIQNFNDVLGENMSTLDEF-----VTRPNHSLPLVIELKEELG-RMTIDPKWDKLKQLKNEAQSIHESDFDTPLNSLEAKLNSYNNRLNNFLQLESIIEEIHEFLPKLTSFKSEWHSRVNMHRDNPVEM--AELKDEA-------KQIHARIDEFDIEQFRKLATAIYGSSKRVEWLIDELVVDFRIPKQHRTISATHKAIENPIIPAKQAQVRTEKSETPNKNIESNGKLLLVNAESSCPTRLDFVLE-SLPRIDKDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANT---EPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVAKTHLEIGEKPEFVYHQFK-----ENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPK--FTQAHVGDYTCQVSNEFGED--VLKLQL---SAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKC-SLKINGATVNDSGTYQAVLKET--GQTQTT----IVEINPIQFAP-VIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTS-----------PKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKV--GETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSP 4424
            ++   +   + Q+  W+   GT ++ S + LP +F+EAE +RK HE+ E KCM  LA YA + +++T   +     + ++I I +F  R+++RR  VVS +TF+R   +L   FK               ++ D++    N      ++     EE       ++ LL+    L  Q    A   +++    E+++    +L           E   +  +E +   +++  E +  ++ +W++ I++ ++  Y    +GK  VE   + +Q++      Q  ++ G  +     K       +T+   ++    +  W     +  E ++R   A   + N+D  LE +E L++ I +D +N    + + + Y  +  ++   Y+N K+I   L +++QF + +   +P++     I+Q++D++K+K+FTL +KI+ L   L      +I+    T+    +  T          I K+   L    + W E+  LP T+ +A   I+ H+  + +    W  +   L++     P+     E     +DA+ +  +W ++W   +         LL      N+V  +  + L E      VTR     P+   +++  G +  +     K++ L  E +     DF+  +  +E +   Y   L        +I  I ++L KL +F  E            VE+     +DEA       ++ +   D FD +     A  +YGSS++   +I+ L          R I A   A E  I+  +  Q  T     P + +     L L        TR    +E S P       D++W ++   +  D       + +   G  ++  D     DAG   C +R+G S +   +   L V S       P F  +  +      EP+ L+  + G    PE   + +N P+      C     + + +      +      G Y  R +S       + + E  EF+  +F      ++   G  L + +   +F       + W +                  + + +FE P         G+ TC +     ED  +  +QL      +  + +  + P    P   SQL D  V    G S +L      +    +VW  + + L  R P ++I     S   +L+I+ AT  D G Y ++L E   G+ +T+    +    P+  AP    D  + + A  +  + + C V+ +P               PT     + R    N  L  ++G  +   L    V   D G Y +   NS G +     + V    E   K+T+           P+FI +L ++ +  + + VI+ C++ G P P + W  N E + ++D  + RK+  G  H L IK    ++ G Y   A N++G       L V +P      T   EK          R      NS+++SP
Sbjct:   41 LSREEVLNGVGQILDWVHGPGTKLLDSQRELPRNFEEAERIRKNHEQFEFKCMQALANYASLRDVRTNDNELAERLEKLEITIQDFLRRLQSRRQAVVSLYTFFRLRRDLDSYFK---------------EIADMLVWTDNQQQHQQQRI----EETEHYLRQVEKLLRFGESLYQQFCSEAERIRIVITFKEILDIVAAQLAEAKPLLAKQLEMLKIRLLETRRRLQLLVYERDASQTVAWLEDIINAVLDTYLGYCIGKTPVETQQILQQHRTLQAKSQETYDCGLEIIAALTKIYRAQGADTEGCVAMRSNLESNWRRLNEILIEMSDRYATADAFYENVDLNLERIERLILLICRDLDNGMSLEDVRETYANERDEIVKAYENTKRIGVGLMERIQFPVAS---LPQTVDQTMIDQVQDVIKVKLFTLWLKIRELYYYLGQ----MIEITEVTERWQIIRVT----------IDKFFERLLHWEARWQEATSLPFTIPEAESLIEEHRLANDEIGGLWSQLLKDLAE-LSRDPQVGSLAEQAQ--ADAQRRMEEWQRRWERRMAELDLRLRLLLRLRDLGNEV-DDKRTRLAELKTERTVTRAG---PVADTVRDVAGLQRGVSDMHSKMESLFAETREKVHRDFERHIEPIEERWREYVKELELLQMFLELILRILQYLEKLDAFIEEL----------TVELPSCHFRDEAEPWLQKIREFNRITDSFDCDWLSNAAIRLYGSSEKPRPVIERL----------RLIMARLLAFETSILDMEIVQRVTVTQSAPRRLLRELQDLSL-----PVGTRCHLAVEYSSP---SKSADVEWQRNGRPLHTDTLGG-KWRLDEGPGYSRVTCDRVTVDDAGDIACLIRDGGSGVAMETSCRLQVLSP------PSFVRELQSIRVLEGEPILLQCQVRG-SPTPEVVWLKDNWPLRAG-VDCDIVVDNLDGICAVKVPTADRSHAGVYKCRATSDAGEAVSVAMVEVQEFIKSRFTRPLADQSVQEGGRLQLHV---DFEGEPAPEVTWFR------------------DSQRLFESPPRLLLSTGRGNSTCTIDPLRLEDAGLYSVQLRNPGGVQKTVCNIDVRPKGEAPRCWSQLMDANVLE--GSSTRLSCRISGNPPPRIVWRFNGRQLTPR-PGLRINSDTYSGVHTLEIDEATKEDDGEY-SLLAENPEGRVETSCRLFVESTKPVPSAPRFAGDICEELIANVSDKVTLQCTVHGHP--------------LPTVTWFKDERKIYTNDHL-IVSGMDELHSLVIPYVRLQDAGVYKIIASNSLGSAECRCTLRVND-EEQMAKRTTLVFHNTLVKEPPEFI-RLFRDEMCKVGDDVILECEIHGIPEPSVWWSFNSEPILDNDK-RFRKLSSGHVHSLFIKRVSDAETGRYSVTAENSSGVATCSALLVVEEP----GKTGSFEK--------VTRQSSWGSNSNLASP 1402          
BLAST of Fibronectin type III domain-containing protein vs. TrEMBL
Match: A0A267EG85 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032336g1 PE=4 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 1.561e-54
Identity = 150/538 (27.88%), Postives = 253/538 (47.03%), Query Frame = 3
Query: 3222 NDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPE-ESKCSLKINGATVNDSGTYQAVLKETGQTQTTI--VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNL-VNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI--NNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDR----SQYPSNSKPLPP 4805
            N +G    ++P   ++H G Y C+ +++ GE V  + +   +  I S+   P++ + +              G  ++L V+F  + + +V W +D+Q L    PR+ +      S C+  I+   + D+G Y   L+  G  Q T+  +++ P   AP            +  S  + C ++  P    I W       +P   L +N+  Y  ++              L  D  T  D GEY L  EN  G       + V +    +   ++P+F   + +E+I+ +++KV ++C V G+P P + W K+  ++  +DHL +  + E H LVI   +  DAG+Y+  ASN+ GS   +C L+V                                N +    +RT ++F NT+V+ PP+F+  F DE+ K GDDV+L+C + G PEP +WWS+N+  I  N+ RF        + L +K +   ++GRYS+TAENSSG+ATCSAL++V+   K  S ++    S + SNS    P
Sbjct:  373 NLDGICAVKVPTADRSHAGVYKCRATSDAGEAV-SVAMVEVQEFIKSRFTRPLADQSVQE------------GGRLQLHVDFEGEPAPEVTWFRDSQRLFESPPRLLLSTGRGNSTCT--IDPLRLEDAGLYSVQLRNPGGVQKTVCNIDVRPKGEAPRCWSQLMDANVLEGSSTRLSCRISGSPPPR-IVWRFNGRQLTPRPGLRINSDTYSGVHT-------------LEIDEATKEDDGEYSLLAENPEGRVETRCRLFVES---TKPVPSAPRFAGDICEELIANVSDKVTLQCTVHGHPLPTVTWFKDERKIYTNDHLIVSGMDELHSLVIPYVRLQDAGVYKIIASNSLGSAECRCTLRV--------------------------------NDEEQMAKRTTLVFHNTLVKEPPEFIRLFRDEMCKVGDDVILECEIHGIPEPSVWWSFNSEPILDNDKRFRKLSSGHVHSLFIKRVSDAETGRYSVTAENSSGVATCSALLVVEEPGKTGSFEKVTRQSSWGSNSNLASP 846          
BLAST of Fibronectin type III domain-containing protein vs. TrEMBL
Match: A0A1I8HNT5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 3.327e-54
Identity = 308/1482 (20.78%), Postives = 590/1482 (39.81%), Query Frame = 3
Query:  117 ITESSIPTAIAQVHQWIDVNGTAMIKSNQRLPYSFKEAEELRKLHEKIELKCMNFLAFYAHM-NLKTIPEDCEPMRQNMDIAIHNFSERVKARRHVVVSFFTFYRHLDELTDTFKGIREEDHIHLPDTLSDVQDVIEKYHNTTNLCLKKFSHLKEEAIRVKASLDMLLKLDNDLSTQIVDPALIKKVIKYLDELMNQTELELTSC-------YENQHLMEMEVKIESKMMFIEEEIMRSTSWMQIILDVIISRYNDTVVGKATVENDILQEQNKDYVKNLQMAHEYGTRLQDLYKKFCDQFDRETDRGDSVSDKFDELWNTAEIVSAESTERLKIASNLFHNLDSTLEIVEDLLMAINKDRENIEKKDSIFDHYQAKIYDVHGDYQNIKKIATHLFQKLQFDLMNKRLIPKSSCSAEIEQIEDMVKMKIFTLSVKIKALDRCLHNDEVPLIQTLAATKERSALDATDYDNAGIFDIIKKYLAFLNSSLSNW-ESKPLPKTLDQARKSIDAHKKLSGQSEDYWKDIQNTLSQYFGNSPKAIQSKEVKSMLSDAENQKRKWDKKWSSHLKRKLDPRLQLLLKIQNFNDVLGENMSTLDEFVTRP--NHSLPLVIELKEELG-RMTIDPKWDKLKQLKNEAQSIHESDFDTPLNSLEAKLNSYNNRLNNFLQLESIIEEIHEFLPKLTSFKSEWHSRVNMHRDNPVEMAELKDEA-------KQIHARIDEFDIEQFRKLATAIYGSSKRVEWLIDELVVDFRIPKQHRTISATHKAIENPIIPAKQAQVRTEKSETPNKNIESNGKLLLVNAESSCPTRLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRI--LLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANT---EPLSLKLVLDGFKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFRVSSKDVAKTHLEIGEKPEFVYHQFK-----ENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPK--FTQAHVGDYTCQVSNEFGED--VLKLQL---SAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKC-SLKINGATVNDSGTYQAVLKET--GQTQTT----IVEINPIQFAP-VIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKV--GETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSP 4424
            ++   +   + Q+  W+   GT ++ S + LP +F+EAE +RK HE+ E KCM  LA YA + +++T   +     + ++I I +F  R+++RR  VVS +TF+R   +L   FK               ++ D++    N      ++     EE       ++ LL+    L  Q    A   +++    E+++    +L           E   +  +E +   +++  E +  ++ +W++ I++ ++  Y    +GK  VE   + +Q++      Q  ++ G  +     K       +T+   ++    +  W     +  E ++R   A   + N+D  LE +E L++ I +D +N    + + + Y  +  ++   Y+N K+I   L +++QF + +   +P++     I+Q++D++K+K+FTL +KI+ L   L      +I+    T+    +  T          I K+   L    + W E+  LP T+ +A   I+ H+  + +    W  +   L++     P+     E     +DA+ +  +W ++W   +         LL      N+V  +  + L E  T      + P+   +++  G +  +     K++ L  E +     DF+  +  +E +   Y   L        +I  I ++L KL +F  E    +   R         +DEA       ++ +   D FD +     A  +YGSS++   +I+ L          R I A   A E  I+  +  Q  T     P + +     L L    + C   +++   S P       D++W ++   +  D   R+    + +   G  ++  D     DAG   C +R+G S +   +   L V S       P F  +  +      EP+ L+  + G    PE   + +N P+      C     + + +      +      G Y  R +S       + + E  EF+  +F      ++   G  L + +   +F       + W +                  + + +FE P         G+ TC +     ED  +  +QL      +  + +  + P    P   SQL D  V    G S +L      +    +VW  + + L  R P ++I     S   +L+I+ AT  D G Y ++L E   G+ +T+    +    P+  AP    D  + + A  +  + + C V+ +P   ++ W           +L++   YK+I    N L     R  L  ++             E  A  ++++   T+         K  P+FI +L ++ +  + + VI+ C++ G P P + W  N E + ++D  + RK+  G  H L IK    ++ G Y   A N++G       L V +P      T   EK          R      NS+++SP
Sbjct:   17 LSREEVLNGVGQILDWVHGPGTKLLDSQRELPRNFEEAERIRKNHEQFEFKCMQALANYASLRDVRTNDNELAERLEKLEITIQDFLRRLQSRRQAVVSLYTFFRLRRDLDSYFK---------------EIADMLVWTDNQQQHQQQRI----EETEHYLRQVEKLLRFGESLYQQFCSEAERIRIVITFKEILDIVAAQLAEAKPLLAKQLEMLKIRLLETRRRLQLLVYERDASQTVAWLEDIINAVLDTYLGHCIGKTPVETQQILQQHRTLQAKSQETYDCGLEIIAALTKIYRAQGADTEGCVAMRSNLESNWRRLNEILIEMSDRYATADAFYENVDLNLERIERLILLICRDLDNGMSLEDVRETYANERDEIVKAYENTKRIGVGLMERIQFPVAS---LPQTVDQTMIDQVQDVIKVKLFTLWLKIRELYYYLGQ----MIEITEVTERWQIIRVT----------IDKFFERLLHWEARWQEATSLPFTIPEAESLIEEHRLANDEIGGLWSQLLKDLAE-LSRDPQVGSLAEQAQ--ADAQRRMEEWQRRWERRMAELDLRLRLLLRLRDLGNEV-DDKRTRLAELKTERTVTRAGPVADTVRDVAGLQRGVSDMHSKMESLFAETREKVHRDFERHIEPIEERWREYVKELELLQMFLELILRILQYLEKLDAFIEELTVELPSCR--------FRDEAEPWLQKIREFNRITDSFDCDWLSNAAIRLYGSSEKPRPVIERL----------RLIMARLLAFETSILDMEIVQRVTVTQSAPRRLLRELQDLSL-PVGARCHLAVEY---SSP---SKSADVEWQRNGRPLHTD---RLGGKWRLDEGPGYSRVTCDRVTVDDAGDIACLIRDGGSGVAMETSCRLQVLSP------PSFVRELQSIRVLEGEPILLQCQVRG-SPTPEVVWLKDNWPLRAG-VDCDVVVDNLDGICAVKVPTADRSHAGVYKCRATSDAGEAVSVAMVEVQEFIKSRFTRPLADQSVQEGGRLQLHV---DFEGEPAPEVTWFR------------------DSQRLFESPPRLLLSTGRGNSTCTIDPLRLEDAGLYSVQLRNPGGVQKTVCNIDVRPKGEAPRCWSQLMDANVLE--GSSTRLSCRISGNPPPRIVWRFNGRQLTPR-PGLRINSDTYSGVHTLEIDEATKEDDGEY-SLLAENPEGRVETSCRLFVESTKPVPSAPRFAGDICEELIANVSDKVTLQCTVHGHP-LPTVTWFKDERKIYTNDHLIDAGVYKIIAS--NSLGSAECRCTLRVND------------EEQMAKRTTLVFHNTLV--------KEPPEFI-RLFRDEMCKVGDDVILECEIHGIPEPSVWWSFNSEPILDNDK-RFRKLSSGHVHSLFIKRVSDAETGRYSVTAENSSGVATCSALLVVEEP----GKTGSFEK--------VTRQSSWGSNSNLASP 1360          

HSP 2 Score: 209.92 bits (533), Expect = 1.202e-50
Identity = 167/656 (25.46%), Postives = 283/656 (43.14%), Query Frame = 3
Query: 2886 NNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQY--LFRVSSKDVA---KTHLEIGEKPEFVYHQFKENSLLGDSLAISIPMKNFHKMSPK-TIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPE-ESKCSLKINGATVNDSGTYQAVLKETGQTQTTI--VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNL-VNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTSPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFI--NNPRFEMKRELDEYFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDR----SQYPSNSKPLPP 4805
            N  P++ +     W         +     V++ D G    L R     VA      L++   P FV        L G+ + +   ++     SP   ++W K+  PL           N +G    ++P   ++H G Y C+ +++ GE V  + +   +  I S+   P++ + +              G  ++L V+F  + + +V W +D+Q L    PR+ +      S C+  I+   + D+G Y   L+  G  Q T+  +++ P   AP            +  S  + C ++  P    I W       +P   L +N+  Y  ++              L  D  T  D GEY L  EN  G       + V +    +   ++P+F   + +E+I+ +++KV ++C V G+P P + W K+  ++  +DHL                   DAG+Y+  ASN+ GS   +C L+V                                N +    +RT ++F NT+V+ PP+F+  F DE+ K GDDV+L+C + G PEP +WWS+N+  I  N+ RF        + L +K +   ++GRYS+TAENSSG+ATCSAL++V+   K  S ++    S + SNS    P
Sbjct:  791 NGRPLHTDRLGGKWRLDEGPGYSRVTCDRVTVDDAGDIACLIRDGGSGVAMETSCRLQVLSPPSFVRELQSIRVLEGEPILLQCQVRG----SPTPEVVWLKDNWPLRAGVDCDVVVDNLDGICAVKVPTADRSHAGVYKCRATSDAGEAV-SVAMVEVQEFIKSRFTRPLADQSVQE------------GGRLQLHVDFEGEPAPEVTWFRDSQRLFESPPRLLLSTGRGNSTCT--IDPLRLEDAGLYSVQLRNPGGVQKTVCNIDVRPKGEAPRCWSQLMDANVLEGSSTRLSCRISGNPP-PRIVWRFNGRQLTPRPGLRINSDTYSGVHT-------------LEIDEATKEDDGEYSLLAENPEGRVETSCRLFVES---TKPVPSAPRFAGDICEELIANVSDKVTLQCTVHGHPLPTVTWFKDERKIYTNDHL------------------IDAGVYKIIASNSLGSAECRCTLRV--------------------------------NDEEQMAKRTTLVFHNTLVKEPPEFIRLFRDEMCKVGDDVILECEIHGIPEPSVWWSFNSEPILDNDKRFRKLSSGHVHSLFIKRVSDAETGRYSVTAENSSGVATCSALLVVEEPGKTGSFEKVTRQSSWGSNSNLASP 1360          
BLAST of Fibronectin type III domain-containing protein vs. TrEMBL
Match: A0A267HBC9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022489g1 PE=4 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 1.178e-53
Identity = 306/1474 (20.76%), Postives = 598/1474 (40.57%), Query Frame = 3
Query:  114 SITESSIPTAIAQVHQWIDVNGTAMIKSNQRLPYSFKEAEELRKLHEKIELKCMNFLAFYAHM-NLKTIPEDCEPMRQNMDIAIHNFSERVKARRHVVVSFFTFYRHLDELTDTFKGI----REEDHIHLPDTLSDVQDVIEKYHNTTNLCLKKFSHLKEEAIRVKASLDMLLKLDNDLSTQIVDPALIKKVIKYLDELMNQTELELTSCYENQHLMEMEVKIESKMMFIEEEIMRSTSWMQIILDVIISRYNDTVVGKATVENDILQEQNKDYVKNLQMAHEYGTRL-QDLYKKFCDQFDRETDRGDSVSDKFDELWNTAEIVSAESTERLKIASNLFHNLDSTLEIVEDLLMAINKDRENIEKKDSIFDHYQAKIYDVHGDYQNIKKIATHLFQKLQFDLMNKRLIPKSSCSAEIEQIEDMVKMKIFTLSVKIKALDRCLHNDEVPLIQTLAATKERSALDATDYDNAGIFDIIKKYLAFLNSSLSNWESKPLPKTLDQARKSIDAHKKLSGQSEDYWKDIQNTLSQYFGNSPKAIQSKEVKSMLSDAENQKRKWDKKWSSHLKRKLDPRLQLLLKIQNFNDVLGENMSTLDEFVTRPNHSLPLVIELKEELGRM-TIDPKWD-KLKQLKNEAQSIHESDFDTPLNSLEAKLNSYNNRLNNFLQLESIIEEIHEFLPKLTSFKSEWHSRVNMHRDNPVEMAELKDEAKQIHARI-------DEFDIEQFRKLATAIYGSSKRVEWLIDELVVDFRIPKQHRTISATHKAIENPIIPAKQAQVRTEKSETPNKNIESNGKL------LLVNAESSCPTRLDFVLESLPRIDKDQYDIQWYKDNEAILPDCDPRILLQCNSQSGKMKMHIDNCRESDAGQYWCEVRNGPSVIRKSSPVLLSVFSQKQGTVIPKFSEKTFAANT---EPLSLKLVLDG-----FKYAPESDLIFNNMPINVNHSSCPWSKVSSNEMIQFNHRSVSLKDVGQYLFR-VSSKDVAKTHLEIGEKPEFVYHQF------KENSLLGDSLAISIPMKNFHKMSPKTIIWXXXXXXXXXXXXSHKTYINDNGELVFEIPKFT-QAHVGDYTCQVS--NEFGEDVLKLQL---SAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYY--PEESKCSLKINGATVNDSGTYQAVLK-ETGQTQT---TIVEI-----NPIQFAP-VIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIELYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKTS-----------PKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDH-LKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCH-LQVIDPIGSVNT 4334
            + T   +   + ++  W+   GT ++ S + LP +F EAE +RK HE+ E KCM  LA YA + ++++   +     + ++I I +F  R++ RR +VVS +TF+R   E+   F  I    R E H+ + DT   +++V                   E  +R   +L   + L+++   QI+     ++++  ++E +   +L L    E   L  +E +   +++  + +  ++ +W+  I  ++I  Y    +GK  +E   L +Q +      +   EYG  L   L K   DQ  + T     +    D  W     +  E  +R   A   + N+D  LE +E L++ I +D +     + +   Y  +  ++   Y++ KKI   L ++++  + N   IP++     I+++ D++K+K+FTL +KI+ L   L       I+    T+    +  +          I K+   +    + W+   LP T+ +A   I+ H+K   +  + ++D+   L +   +      ++  +    DA+++K +W K+W  H++        LL       +V G  +  L +   R      +V E   E GR+  I P+   K++ L  E +     DF+  +  +EAK   +   L  F      I  + +F+ KL +F  E ++++ + R         ++EA+    +I         FD +    +AT ++G+ ++ + +I++L          R I+A  K  E  I+     ++ T ++ T   ++    K       L +   S C   +++ + S         D++W ++    LP          + Q G   +  D     DAG + C +R+   V+   +   L V         P F+ +   A     EPL L+  + G      ++  +  ++  N   ++ +          + +       V     G Y  R V+    A T   + E  EF+  QF      +E+   G+ L + +  +     +P+                   T+  D+  L    P+ + +   G  TC +       E +  +Q+   +  +  + +  + P+   P   S L D  V  + G  ++L        + +V W  +N+PL     R    +  P+    SL+I+ A  +D G Y+ V +   G+ +T    +VE       P  FAP    D  + + A  +  + + C V   P   ++ W     DG            ++       ++G  ++  L    V   D G Y +   N  G +     + V    E  +K+T+           P+F+ +L ++    + + VI+ C++ G P+P + W  NG+ + + D+  +       H L I+     + G Y   A N++G  V+ C  L +++  G   +
Sbjct:   40 NFTREEVQDWVGRILDWVHGPGTKLLDSQRELPTNFDEAERIRKNHEQFEFKCMKALATYAKLRDIRSDDNEVAEHIEKLEITIQDFLRRLQNRRQIVVSLYTFFRLQREIESYFSDISSILRRESHLRIEDTEHYLKEV-------------------ERVLRYAENLYQQIFLESERIKQILSS---QQILVIVNEYLADIKLRLGKQLEQMKLRILETRKYLQLLVYDRDSKQTVTWLDDITRIVIETYLKYNIGKTPMETQQLLQQYQTLKTKSKETFEYGMELIAALAKMLADQ-GKPTQACVEMRGSLDVNWRRLTDILGEIGDRYTAADAFYENVDLNLERIERLILLICRDLDTGITLEDVRKTYATERNEIVRAYESTKKIGVGLMERVRHAVAN---IPETVNQPMIDEVIDVIKVKLFTLWLKIRELYYYLGQ----AIEVTEITERWQVIRIS----------IDKFFERMLFWEARWKEGELPFTIPEAEYLINEHQKAKEEIRNLFQDVDMDLQKIVRDGDSVEVARMAEKAGLDAKDKKDEWMKRWERHMEILDMRYRLLLRLRDLDLEVDG-MVDRLGQLENRTVEETKIVTETVAEAGRLAAIVPEIRAKMQSLFKETRDQVRQDFERHIEPIEAKWQKFVKELELFQMFVDTILRMLQFIEKLYAFIEELNTQLPLCRG--------REEAEPWFQKILGYNKTTASFDCDWLLNVATRLFGNDEKPQPVIEKL----------RFIAAKLKMFETSIM-----EMVTVETITVVHSVRKERKFFRELADLTLTEGSPCSLEVEYAIPS------GTADVEWQRNGRP-LPTNKIGGKWILDDQDGFTSVACDGITVDDAGTFACVIRDPTGVM--ETNCRLRVLCP------PAFTMELQPARVNQDEPLLLQCKVKGSPNPDIQWFKDGQVLRRNFEYDIEN---------LDGVCALKVTRVDGSHAGVYSCRAVNQAGEANTSASV-EVKEFIRCQFLRTLPPEEHRQEGERLQLHVEFEG--DPTPEV------------------TWFRDDLRLAASPPRISIRTGGGSSTCTIDPLEPRDEGLYSVQIRNPAGVQKTVCNIGVRPLGEAPTFLSPLMDETV--AEGSQLRLTCRISGQPAPEVAWYFNNRPLGRYSRRGMRLHSDPDTGVHSLEIDSAGPDDEGEYRVVAENRDGRVETKCRVVVEPPSEDDTPAPFAPRFAGDISEELVAHVSDKVTLQCTVYGQP-LPTVTWH---KDG-----------VRLYTDDHVIVSGFEEQHSLVIPYVRLEDAGLYQIVASNDMGSADCRCTLRVIE-DEFVDKRTTLVFHNTVVKAPPEFV-RLFRDEFCKVGDDVILECEIDGIPDPAVWWSFNGQPIGDRDYRFRTSSNERVHSLYIQRVSTEETGRYSVTAENSSG--VATCSALLIVEETGKTGS 1383          

HSP 2 Score: 214.157 bits (544), Expect = 6.432e-52
Identity = 150/553 (27.12%), Postives = 245/553 (44.30%), Query Frame = 3
Query: 3222 NDNGELVFEIPKFTQAHVGDYTCQVSNEFGEDVLKLQLSAAEALISSQTLIPVSAKPISSSQLSDNYVTGSVGDSIKLDVEFPADVSSDVVWLKDNQPLNSRDPRIQIYYPEESKCSLKINGATVNDSGTYQAVLKETGQTQTTI--VEINPIQFAPVIQDFPQSIRAKQNGSINIVCVVNSYPSCHSINWSIKPADGSPTRNLVNNARYKMINKPLNKLTGNMQRIE---------LYFDNVTTSDGGEYCLRVENSAGWSSVMIPITVAALAEAQNKKT-SPKFIQKLDKEIISPINEKVIVRCKVSGNPNPILKWMKNGEELSESDHLKIRKVGETHELVIKNCKKSDAGIYEAQASNTNGSEVSKCHLQVIDPIGSVNTTKPLEKPISFTIIPTERYQPADDNSDISSPQRTQMIFSNTIVRSPPQFVTTFTDEIVKEGDDVVLKCCLIGYPEPLIWWSYNTHFINNPRFEMKRELDE--YFLILKNIQKGDSGRYSITAENSSGLATCSALVIVDSHNKNHSIDR----SQYPSNSKPLPPETYSNLV 4826
            N +G    ++ +   +H G Y+C+  N+ GE      +   E  I  Q L   +  P    Q          G+ ++L VEF  D + +V W +D+  L +  PRI I     S  +  I+     D G Y   ++     Q T+  + + P+  AP            +   + + C ++  P+   + W                      N+PL + +    R+          L  D+    D GEY +  EN  G       + V   +E       +P+F   + +E+++ +++KV ++C V G P P + W K+G  L   DH+ +    E H LVI   +  DAG+Y+  ASN  GS   +C L+VI+                            D+  D    +RT ++F NT+V++PP+FV  F DE  K GDDV+L+C + G P+P +WWS+N   I +  +  +   +E  + L ++ +   ++GRYS+TAENSSG+ATCSAL+IV+   K  S +     S   +NS  +P E+    V
Sbjct:  922 NLDGVCALKVTRVDGSHAGVYSCRAVNQAGEANTSASVEVKE-FIRCQFL--RTLPPEEHRQ---------EGERLQLHVEFEGDPTPEVTWFRDDLRLAASPPRISIRTGGGSS-TCTIDPLEPRDEGLYSVQIRNPAGVQKTVCNIGVRPLGEAPTFLSPLMDETVAEGSQLRLTCRISGQPA-PEVAWYFN-------------------NRPLGRYSRRGMRLHSDPDTGVHSLEIDSAGPDDEGEYRVVAENRDGRVETKCRVVVEPPSEDDTPAPFAPRFAGDISEELVAHVSDKVTLQCTVYGQPLPTVTWHKDGVRLYTDDHVIVSGFEEQHSLVIPYVRLEDAGLYQIVASNDMGSADCRCTLRVIE----------------------------DEFVD----KRTTLVFHNTVVKAPPEFVRLFRDEFCKVGDDVILECEIDGIPDPAVWWSFNGQPIGDRDYRFRTSSNERVHSLYIQRVSTEETGRYSVTAENSSGVATCSALLIVEETGKTGSYENAARLSSQATNSWAMPHESGQQFV 1409