StAR-related lipid transfer (START) domain containing 7

Overview
NameStAR-related lipid transfer (START) domain containing 7
Smed IDSMED30001778
Length (bp)1164
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of StAR-related lipid transfer (START) domain containing 7 (SMED30001778) t-SNE clustered cells

Violin plots show distribution of expression levels for StAR-related lipid transfer (START) domain containing 7 (SMED30001778) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001778

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 30

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30001778h1SMcG0002071 Contig2456newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001778h1SMcG0002071 Contig2456uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001778h1SMcG0003658 Contig2456newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001778h1SMcG0003658 Contig2456uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001778h1SMcG0002071 Contig2456newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001778h1SMcG0002071 Contig2456uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001778h1SMcG0003658 Contig2456newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001778h1SMcG0003658 Contig2456uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
head regionSMED30001778h1SMcG0003658 SmedASXL_016884SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30001778h1SMcG0003658 SmedASXL_016882SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30001778h1SMcG0003658 SmedASXL_016884SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30001778h1SMcG0003658 SmedASXL_016882SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30001778h1SMcG0003658 dd_Smed_v4_13117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30001778h1SMcG0003658 dd_Smed_v4_13117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30001778h1SMcG0003658 dd_Smed_v4_13117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30001778h1SMcG0003658 dd_Smed_v4_13117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30001778h1SMcG0003658 dd_Smed_v6_13117_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30001778h1SMcG0003658 dd_Smed_v6_13117_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
testisSMED30001778h1SMcG0001952 Contig5275GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
reproductive organSMED30001778h1SMcG0003657 Contig43078newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30001778h1SMcG0003657 Contig43078uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30001778h1SMcG0003657 PL08006A2C06smed_ncbi_20240424PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30001778h1SMcG0003657 Contig5275GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30001778h1SMcG0003658 PL08006A2C06smed_ncbi_20240424PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30001778h1SMcG0001952 Contig5275GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
reproductive organSMED30001778h1SMcG0003657 Contig43078newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30001778h1SMcG0003657 Contig43078uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30001778h1SMcG0003657 PL08006A2C06smed_ncbi_20240424PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30001778h1SMcG0003657 Contig5275GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30001778h1SMcG0003658 PL08006A2C06smed_ncbi_20240424PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Human
Match: STARD7 (StAR related lipid transfer domain containing 7 [Source:HGNC Symbol;Acc:HGNC:18063])

HSP 1 Score: 183.341 bits (464), Expect = 1.296e-53
Identity = 85/195 (43.59%), Postives = 125/195 (64.10%), Query Frame = 1
Query:  370 QDWEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALK 954
            Q WE +MD +  +LWRR   G    ++YRV GTYTD++ + F N Q+D  YRKKWD +VI L VI +D  + SE + WV+++PYP+ +R+Y+Y+RR+ +D EN + ++VSRA+  HP + +        P  VRV  Y S++ ++ H  +D+ G DY L Y DNP+   PR  + W  SSG+P F++KLH A LK
Sbjct:  139 QRWEMVMDKKHFKLWRRPITGTH-LYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAV-EHPSVPE-------SPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLK 324          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Human
Match: STARD7 (StAR related lipid transfer domain containing 7 [Source:HGNC Symbol;Acc:HGNC:18063])

HSP 1 Score: 119.783 bits (299), Expect = 3.832e-32
Identity = 52/111 (46.85%), Postives = 78/111 (70.27%), Query Frame = 1
Query:  370 QDWEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSR 702
            Q WE +MD +  +LWRR   G    ++YRV GTYTD++ + F N Q+D  YRKKWD +VI L VI +D  + SE + WV+++PYP+ +R+Y+Y+RR+ +D EN + ++VSR
Sbjct:   38 QRWEMVMDKKHFKLWRRPITGTH-LYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSR 147          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Human
Match: PCTP (phosphatidylcholine transfer protein [Source:HGNC Symbol;Acc:HGNC:8752])

HSP 1 Score: 96.2857 bits (238), Expect = 1.124e-22
Identity = 61/198 (30.81%), Postives = 102/198 (51.52%), Query Frame = 1
Query:  367 GQDWEKMMDTEEIRLWR--RKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLR-RFLIDAEN-GIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAA 948
            G DW+ +++T  I ++R   K  G    +EY+V G   D S     +  +D  YRK+WD  V     +++ E      + W   YP+P++NR+Y+YLR R  +D E   I ++++R+  S P L +          ++RV +Y   L +++  K    G   F+ Y+DNP   IP   + WA+ +GVP+F+K +  A 
Sbjct:   27 GADWQLLVETSGISIYRLLDKKTG---LYEYKVFGVLEDCSPTLLADIYMDSDYRKQWDQYV---KELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARST-SMPQLGE-------RSGVIRVKQYKQSLAIESDGK---KGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARAC 207          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Human
Match: PCTP (phosphatidylcholine transfer protein [Source:HGNC Symbol;Acc:HGNC:8752])

HSP 1 Score: 85.1149 bits (209), Expect = 1.060e-18
Identity = 56/186 (30.11%), Postives = 93/186 (50.00%), Query Frame = 1
Query:  367 GQDWEKMMDTEEIRLWR--RKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLR-RFLIDAEN-GIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSG 912
            G DW+ +++T  I ++R   K  G    +EY+V G   D S     +  +D  YRK+WD  V     +++ E      + W   YP+P++NR+Y+YLR R  +D E   I ++++R+  S P L +          ++RV +Y   L +++     K G   F+ Y+DNP   IP   + WA+  G
Sbjct:   27 GADWQLLVETSGISIYRLLDKKTG---LYEYKVFGVLEDCSPTLLADIYMDSDYRKQWDQYV---KELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARST-SMPQLGE-------RSGVIRVKQYKQSLAIESDG---KKGSKVFMYYFDNPGGQIPSWLINWAAKGG 195          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Human
Match: PCTP (phosphatidylcholine transfer protein [Source:HGNC Symbol;Acc:HGNC:8752])

HSP 1 Score: 83.1889 bits (204), Expect = 6.844e-18
Identity = 55/183 (30.05%), Postives = 92/183 (50.27%), Query Frame = 1
Query:  367 GQDWEKMMDTEEIRLWR--RKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLR-RFLIDAEN-GIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWAS 903
            G DW+ +++T  I ++R   K  G    +EY+V G   D S     +  +D  YRK+WD  V     +++ E      + W   YP+P++NR+Y+YLR R  +D E   I ++++R+  S P L +          ++RV +Y   L +++     K G   F+ Y+DNP   IP   + WA+
Sbjct:   27 GADWQLLVETSGISIYRLLDKKTG---LYEYKVFGVLEDCSPTLLADIYMDSDYRKQWDQYV---KELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARST-SMPQLGE-------RSGVIRVKQYKQSLAIESDG---KKGSKVFMYYFDNPGGQIPSWLINWAA 192          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Celegans
Match: C06H2.2 (pep chromosome:WBcel235:V:11125222:11127306:1 gene:WBGene00007386.1 transcript:C06H2.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C06H2.2)

HSP 1 Score: 143.28 bits (360), Expect = 4.589e-39
Identity = 75/198 (37.88%), Postives = 117/198 (59.09%), Query Frame = 1
Query:  367 GQDWEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSI----VRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAA 948
            G+ WE + + +++  +RR+  G  E +EY+  GTY DIS + F++ Q DL YRK+WD+ ++   +    EE  +E IRWVS +PYP+  REY+Y+RR  +  +   A++ S ++    F           PSI    VRV  Y S++ ++AHS ++  G+DY L Y DNP+ANIPR    W  + G P F++++H AA
Sbjct:   86 GKGWELLYEEKDMLAFRRRIDGPYEMYEYKCVGTYYDISPRTFLDAQNDLKYRKEWDDNIV--TIEVVKEENENELIRWVSKFPYPMYPREYVYVRRTWVSEDEKYAVLDSESVQPEVF-----------PSISESNVRVRSYTSRMSIRAHSNWESHGVDYILTYCDNPEANIPRYVYNWMVNKGGPYFLRQVHKAA 270          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Fly
Match: CG6565 (gene:FBgn0032513 transcript:FBtr0342631)

HSP 1 Score: 109.768 bits (273), Expect = 3.204e-26
Identity = 64/217 (29.49%), Postives = 111/217 (51.15%), Query Frame = 1
Query:  361 QFGQDWEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDE--ETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAI--GSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALKNPH*QSKTIFIKNLF 999
            Q  Q WE      E  +WRR+       + Y+V   + DI+A  F++ Q DL YR++WD+  + L +I +D    ++S  I W   +P   ANR+Y+Y RR++ D    +  + +R     ++P L             VRVT+Y S + ++    + +PG+ + L Y+D+P   IP+    W +   +P F+ K++  A KN +  S+ I +K++F
Sbjct:  187 QDDQKWEPYFSKNEFSIWRRQ--ERSSLYSYKVYARFDDITADDFLHVQTDLDYRRQWDDTALRLELISEDPVPGSNSHLIYWEMQWPRLFANRDYVYCRRYIKDDNKKLIFICNRGATHNTYPALS----------GKVRVTDYWSLMVIKPFRGFHEPGLHFVLTYFDDPGIPIPQNIKSWVTQKQMPEFLTKMY-VATKN-YACSRAIKMKDMF 389          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Fly
Match: CG6565 (gene:FBgn0032513 transcript:FBtr0080468)

HSP 1 Score: 109.768 bits (273), Expect = 3.204e-26
Identity = 64/217 (29.49%), Postives = 111/217 (51.15%), Query Frame = 1
Query:  361 QFGQDWEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDE--ETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAI--GSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALKNPH*QSKTIFIKNLF 999
            Q  Q WE      E  +WRR+       + Y+V   + DI+A  F++ Q DL YR++WD+  + L +I +D    ++S  I W   +P   ANR+Y+Y RR++ D    +  + +R     ++P L             VRVT+Y S + ++    + +PG+ + L Y+D+P   IP+    W +   +P F+ K++  A KN +  S+ I +K++F
Sbjct:  187 QDDQKWEPYFSKNEFSIWRRQ--ERSSLYSYKVYARFDDITADDFLHVQTDLDYRRQWDDTALRLELISEDPVPGSNSHLIYWEMQWPRLFANRDYVYCRRYIKDDNKKLIFICNRGATHNTYPALS----------GKVRVTDYWSLMVIKPFRGFHEPGLHFVLTYFDDPGIPIPQNIKSWVTQKQMPEFLTKMY-VATKN-YACSRAIKMKDMF 389          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Fly
Match: CG6565 (gene:FBgn0032513 transcript:FBtr0346420)

HSP 1 Score: 109.768 bits (273), Expect = 3.204e-26
Identity = 64/217 (29.49%), Postives = 111/217 (51.15%), Query Frame = 1
Query:  361 QFGQDWEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDE--ETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAI--GSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALKNPH*QSKTIFIKNLF 999
            Q  Q WE      E  +WRR+       + Y+V   + DI+A  F++ Q DL YR++WD+  + L +I +D    ++S  I W   +P   ANR+Y+Y RR++ D    +  + +R     ++P L             VRVT+Y S + ++    + +PG+ + L Y+D+P   IP+    W +   +P F+ K++  A KN +  S+ I +K++F
Sbjct:  187 QDDQKWEPYFSKNEFSIWRRQ--ERSSLYSYKVYARFDDITADDFLHVQTDLDYRRQWDDTALRLELISEDPVPGSNSHLIYWEMQWPRLFANRDYVYCRRYIKDDNKKLIFICNRGATHNTYPALS----------GKVRVTDYWSLMVIKPFRGFHEPGLHFVLTYFDDPGIPIPQNIKSWVTQKQMPEFLTKMY-VATKN-YACSRAIKMKDMF 389          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Zebrafish
Match: stard7 (StAR-related lipid transfer (START) domain containing 7 [Source:ZFIN;Acc:ZDB-GENE-030131-2310])

HSP 1 Score: 185.652 bits (470), Expect = 9.672e-55
Identity = 93/239 (38.91%), Postives = 142/239 (59.41%), Query Frame = 1
Query:  238 DSITDDEMSKNVEEFDSKLSKVSGEALSYRLTRSDLILNMNQFGQDWEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALK 954
            + I DDE+ +   E  +  S  S +      T  D         Q WE +M+ +  R+WRR   G+   FEYRV G+YTD++ + F N Q+D  YRKKWD +VI L+V+ +D  T +E + W +++PYP+ +R+Y+Y+RR+ +D EN + I+VSRA+  HP + +  E+       VRV  Y SK+ ++ H  +D+ G DY L Y D+P+   PR  + W  SSG+P F++KLH AAL+
Sbjct:  103 EKIRDDELRRCAWELQAVESVRSQDVSPKVATHVD---------QGWEVVMEKKNFRVWRRPVEGSH-LFEYRVFGSYTDVTPRQFFNVQLDTEYRKKWDALVIRLDVVDRDVNTGTEVVHWATHFPYPMYSRDYVYVRRYQVDLENNLMILVSRAV-KHPCVPETQEF-------VRVHSYQSKMVIRPHRSFDENGFDYLLTYSDDPQTVFPRYCVSWMVSSGMPDFLEKLHTAALR 323          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Zebrafish
Match: pctp (phosphatidylcholine transfer protein [Source:ZFIN;Acc:ZDB-GENE-081022-182])

HSP 1 Score: 90.1225 bits (222), Expect = 1.554e-20
Identity = 59/204 (28.92%), Postives = 103/204 (50.49%), Query Frame = 1
Query:  349 LNMNQFGQDWEKMMDTEEIRLWRRKYPGNEET--FEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLR--RFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAA 948
            L+  Q    WE   +T  ++++R     N+ET  +EY+V G+ +  S +      +DL YR++WD+ V  L+   + +    + I W   YP PL+NR+Y+Y+R  R L  +   I +V++++       +K          ++RV +Y   L +++    D  G   F+ Y+DNP   IP   + WA+ +GVPSF+  +  A 
Sbjct:   17 LDEPQLDGGWEFFTETMNVKIYRLY---NKETGLYEYKVFGSLSGCSPELCAEVYMDLNYRRQWDSYVKELH---EKDYNDQKAIYWEVKYPMPLSNRDYVYVRERRDLDVSGRKICVVLAKSTSVSQCPEK--------RGVIRVKDYKQSLAIESD---DSGGTKMFMNYFDNPGGMIPTWLVNWAAKTGVPSFLTDMKKAC 203          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Xenopus
Match: stard7 (StAR related lipid transfer domain containing 7 [Source:NCBI gene;Acc:100158578])

HSP 1 Score: 178.718 bits (452), Expect = 2.354e-52
Identity = 83/195 (42.56%), Postives = 126/195 (64.62%), Query Frame = 1
Query:  370 QDWEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALK 954
            Q WE ++D +E +LWRR   G    ++YRV G Y D++ + F N Q+D  YRKKWD +VI L++I +D  + SE I WV+++PYP+ +R+Y+Y+R++ ID EN I ++VSRA+  HP + +        P  VRV  Y S++ +Q H+ +D+ G DY L Y DNP+   PR  + W  SSG+P F++KLH A ++
Sbjct:  107 QGWELVIDNKEFKLWRRPIEGTH-LYQYRVFGCYRDVTPRQFFNVQLDTEYRKKWDALVIKLDIIERDALSGSEIIHWVTHFPYPMYSRDYVYVRKYHIDQENNIMVLVSRAV-EHPSVPE-------SPDYVRVRNYQSQMVIQPHTTFDENGFDYLLTYSDNPQTVFPRYCVNWMVSSGMPDFLEKLHMATVQ 292          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Xenopus
Match: ENSXETT00000038456.1 (uncharacterized LOC100145115 [Source:NCBI gene;Acc:100145115])

HSP 1 Score: 53.5286 bits (127), Expect = 1.758e-7
Identity = 50/205 (24.39%), Postives = 90/205 (43.90%), Query Frame = 1
Query:  376 WEKMMDTEEIRLWRRKYPGNEETFEYRVCG--TYTDISAKAFMNTQIDLTYRKKWD-NMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPP--SIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALKNPH*QSK 975
            W    +  +I +W +   G + +  + V G  T+ D+SA    +   D  YRKKWD NM+   ++          +  W    P PL NR+ + LR +L+  ++ + I  S            +++   PP   +VR    V+  ++  HS         +L   D P+ ++P+  +  +S    P  ++KLH A L+ P  ++K
Sbjct:   27 WVCSYNKADIGVWMKPSAG-KTSLVHTVKGRMTFPDVSADTVYDVLHDTEYRKKWDINMIETKDIALLSANADVGYYSWKC--PKPLKNRDVVTLRSWLVLPDSFMIINFS------------VKHKLYPPRKDLVRAVSLVAGYYI--HSTGSNTCTLTYLAQVD-PRGSLPKWVVNKSSKYLAPKILRKLHKACLQYPSWKNK 213          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Xenopus
Match: nr2f6 (nuclear receptor subfamily 2 group F member 6 [Source:Xenbase;Acc:XB-GENE-480818])

HSP 1 Score: 51.2174 bits (121), Expect = 9.304e-7
Identity = 44/201 (21.89%), Postives = 85/201 (42.29%), Query Frame = 1
Query:  370 QDWEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWD-NMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYY---DNPKANIPRTAMKWASSSGVPSFIKKLHDAALKNP 960
            + W    +   + +W  +    +   + ++C T  D+ A+   +   D +YRKKWD NM+   ++          +  W    P PL NR+++ LR +L    + + I  S            +++ K PP      +YV  + +Q        G +   +YY    +P+ ++P+  +   S    P  +KK++ A +K P
Sbjct:   21 EGWHCQYNKGGVTVWSEEQDSTKAVKKLKMCITCKDVPAEILYDVLHDTSYRKKWDSNMIETYDIGRLTVNADIGYYSWKC--PSPLKNRDFVTLRSWLPLGNDYMIINYS------------VKHPKHPPR----KDYVRAVSLQTGYLIKANGSNSCSLYYLTQVDPRGSLPKWVVNKVSQFVAPKAMKKIYKAGIKYP 203          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Mouse
Match: Stard7 (START domain containing 7 [Source:MGI Symbol;Acc:MGI:2139090])

HSP 1 Score: 182.185 bits (461), Expect = 2.484e-53
Identity = 84/195 (43.08%), Postives = 125/195 (64.10%), Query Frame = 1
Query:  370 QDWEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALK 954
            + WE +MD +  +LWRR   G    ++YRV GTYTD++ + F N Q+D  YRKKWD +VI L VI +D  + SE + WV+++PYP+ +R+Y+Y+RR+ +D EN + ++VSRA+  HP + +        P  VRV  Y S++ ++ H  +D+ G DY L Y DNP+   PR  + W  SSG+P F++KLH A LK
Sbjct:  142 EPWEMVMDKKHFKLWRRPITGTH-LYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDAVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNVMVLVSRAV-EHPSVPE-------SPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLK 327          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Mouse
Match: Stard7 (START domain containing 7 [Source:MGI Symbol;Acc:MGI:2139090])

HSP 1 Score: 159.844 bits (403), Expect = 1.689e-44
Identity = 73/166 (43.98%), Postives = 108/166 (65.06%), Query Frame = 1
Query:  457 VCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALK 954
            V GTYTD++ + F N Q+D  YRKKWD +VI L VI +D  + SE + WV+++PYP+ +R+Y+Y+RR+ +D EN + ++VSRA+  HP + +        P  VRV  Y S++ ++ H  +D+ G DY L Y DNP+   PR  + W  SSG+P F++KLH A LK
Sbjct:  206 VFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDAVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNVMVLVSRAV-EHPSVPE-------SPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLK 363          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Mouse
Match: Pctp (phosphatidylcholine transfer protein [Source:MGI Symbol;Acc:MGI:107375])

HSP 1 Score: 93.9745 bits (232), Expect = 6.770e-22
Identity = 60/202 (29.70%), Postives = 102/202 (50.50%), Query Frame = 1
Query:  367 GQDWEKMMDTEEIRLWRR-KYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLR-RFLIDAEN-GIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALKNPH 963
            G DW+ +++   I ++R    P     +EY+V G     S     +  +DL YRK+WD  V     +++ E        W   YP+PL+NR+Y+Y R R  +D +   I +V++++I +  F +K          ++RV +Y   L +++  K    G   F+ Y+DNP   IP   + WA+ +GVP+F+K +  A  +N H
Sbjct:   27 GADWQLLVEASGITIYRLLDQPSG--LYEYKVFGVLEGCSPALLADVYMDLDYRKQWDQYV---KELYEKESDEQMVAYWEVKYPFPLSNRDYVYTRQRRDLDVDGRKIYVVLAQSISAPQFPEK--------SGVIRVKQYKQSLAIESDGK---KGSRVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMVKAC-QNYH 211          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Mouse
Match: Stard7 (START domain containing 7 [Source:MGI Symbol;Acc:MGI:2139090])

HSP 1 Score: 48.9062 bits (115), Expect = 7.650e-7
Identity = 21/56 (37.50%), Postives = 33/56 (58.93%), Query Frame = 1
Query:  370 QDWEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWD 537
            + WE +MD +  +LWRR   G    ++YRV GTYTD++ + F N Q+     + W+
Sbjct:   64 EPWEMVMDKKHFKLWRRPITGTH-LYQYRVFGTYTDVTPRQFFNVQVSSFSLQVWN 118          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. UniProt/SwissProt
Match: sp|Q9NQZ5|STAR7_HUMAN (StAR-related lipid transfer protein 7, mitochondrial OS=Homo sapiens OX=9606 GN=STARD7 PE=1 SV=2)

HSP 1 Score: 183.341 bits (464), Expect = 6.222e-53
Identity = 85/195 (43.59%), Postives = 125/195 (64.10%), Query Frame = 1
Query:  370 QDWEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALK 954
            Q WE +MD +  +LWRR   G    ++YRV GTYTD++ + F N Q+D  YRKKWD +VI L VI +D  + SE + WV+++PYP+ +R+Y+Y+RR+ +D EN + ++VSRA+  HP + +        P  VRV  Y S++ ++ H  +D+ G DY L Y DNP+   PR  + W  SSG+P F++KLH A LK
Sbjct:  139 QRWEMVMDKKHFKLWRRPITGTH-LYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAV-EHPSVPE-------SPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLK 324          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. UniProt/SwissProt
Match: sp|Q8R1R3|STAR7_MOUSE (StAR-related lipid transfer protein 7, mitochondrial OS=Mus musculus OX=10090 GN=Stard7 PE=1 SV=2)

HSP 1 Score: 182.185 bits (461), Expect = 1.737e-52
Identity = 84/195 (43.08%), Postives = 125/195 (64.10%), Query Frame = 1
Query:  370 QDWEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALK 954
            + WE +MD +  +LWRR   G    ++YRV GTYTD++ + F N Q+D  YRKKWD +VI L VI +D  + SE + WV+++PYP+ +R+Y+Y+RR+ +D EN + ++VSRA+  HP + +        P  VRV  Y S++ ++ H  +D+ G DY L Y DNP+   PR  + W  SSG+P F++KLH A LK
Sbjct:  142 EPWEMVMDKKHFKLWRRPITGTH-LYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDAVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNVMVLVSRAV-EHPSVPE-------SPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLK 327          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. UniProt/SwissProt
Match: sp|Q9UKL6|PPCT_HUMAN (Phosphatidylcholine transfer protein OS=Homo sapiens OX=9606 GN=PCTP PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.400e-22
Identity = 61/198 (30.81%), Postives = 102/198 (51.52%), Query Frame = 1
Query:  367 GQDWEKMMDTEEIRLWR--RKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLR-RFLIDAEN-GIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAA 948
            G DW+ +++T  I ++R   K  G    +EY+V G   D S     +  +D  YRK+WD  V     +++ E      + W   YP+P++NR+Y+YLR R  +D E   I ++++R+  S P L +          ++RV +Y   L +++  K    G   F+ Y+DNP   IP   + WA+ +GVP+F+K +  A 
Sbjct:   27 GADWQLLVETSGISIYRLLDKKTG---LYEYKVFGVLEDCSPTLLADIYMDSDYRKQWDQYV---KELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARST-SMPQLGE-------RSGVIRVKQYKQSLAIESDGK---KGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARAC 207          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. UniProt/SwissProt
Match: sp|P02720|PPCT_BOVIN (Phosphatidylcholine transfer protein OS=Bos taurus OX=9913 GN=PCTP PE=1 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.914e-21
Identity = 56/198 (28.28%), Postives = 103/198 (52.02%), Query Frame = 1
Query:  367 GQDWEKMMDTEEIRLWRRKYPGNEET--FEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLR-RFLIDAENG-IAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAA 948
            G  WE +++T+ I ++R     +++T  + Y+V G   D       +  +DL YRK+WD  V     +++ E +    + W   YP+P++NR+Y+Y+R R  +D E   + ++++++     F +K          ++RV  Y  +L +Q+  K    G   F+ Y+DNP   IP   + WA+ +GVP+F+K +  A 
Sbjct:   27 GAAWELLVETQGISVYRLL---DQQTGLYAYKVFGVLEDCLPDLLADVYMDLAYRKQWDQYV---KELYEKECSGETVVYWQVKYPFPMSNRDYVYVRQRQELDFEGQKVHVILAQSTSEPQFPEK--------SGVIRVKHYKQRLAIQSDGKR---GSKVFMYYFDNPGGQIPSWVINWAAKNGVPNFLKDMVKAC 207          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. UniProt/SwissProt
Match: sp|P53808|PPCT_MOUSE (Phosphatidylcholine transfer protein OS=Mus musculus OX=10090 GN=Pctp PE=1 SV=2)

HSP 1 Score: 93.5893 bits (231), Expect = 6.462e-21
Identity = 60/202 (29.70%), Postives = 100/202 (49.50%), Query Frame = 1
Query:  367 GQDWEKMMDTEEIRLWRR-KYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLR--RFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALKNPH 963
            G DW+ +++   I ++R    P     +EY+V G     S     +  +DL YRK+WD  V     +++ E        W   YP+PL+NR+Y+Y R  R L      I +V++++I +  F +K          ++RV +Y   L +++  K    G   F+ Y+DNP   IP   + WA+ +GVP+F+K +  A  +N H
Sbjct:   27 GADWQLLVEASGITIYRLLDQPSG--LYEYKVFGVLEGCSPALLTDVYMDLDYRKQWDQYV---KELYEKESDEQMVAYWEVKYPFPLSNRDYVYTRQRRDLDVDRRKIYVVLAQSISAPQFPEK--------SGVIRVKQYKQSLAIESDGK---KGSRVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMVKAC-QNYH 211          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. TrEMBL
Match: T1EDW2 (START domain-containing protein OS=Helobdella robusta OX=6412 GN=20194764 PE=4 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 2.546e-58
Identity = 94/224 (41.96%), Postives = 151/224 (67.41%), Query Frame = 1
Query:  283 DSKLSKVSGEALSYRLTRSDLILNM-NQFGQDWEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAAL 951
            DS+L +V+ E         DLI  + +   ++WE ++   E+R+WR   P N + ++Y+V G+Y D+SA+AF NTQ+DL +RK+WD  VI L +I KD+++ SE + W++++PYPL++REY+Y+RR  +D +N + ++VSR+I  HP +     +       VRVTEY SK+ ++ H+ +D+ G DY L Y+D+PK++IP+ A  W ++SG+P F+ KLHDAAL
Sbjct:  156 DSELHQVTHEF--------DLIRQLKDNAKKEWEPVVSKSEVRIWRTPMP-NSDLYQYKVNGSYKDVSARAFYNTQVDLEFRKQWDRHVISLKIIDKDDDSGSEIVHWITHFPYPLSSREYVYVRRHEVDDKNKLMVIVSRSISGHPCVPDNTNH-------VRVTEYTSKMVIRPHTSFDENGFDYVLTYFDDPKSSIPKVAQCWMANSGIPDFVDKLHDAAL 363          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. TrEMBL
Match: K7FHD1 (StAR related lipid transfer domain containing 7 OS=Pelodiscus sinensis OX=13735 GN=STARD7 PE=4 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 1.213e-54
Identity = 96/233 (41.20%), Postives = 144/233 (61.80%), Query Frame = 1
Query:  256 EMSKNVEEFDSKLSKVSGEALSYRLTRSDLILNMNQFGQDWEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALK 954
            E  K++EE  SKL   SG      +++S + +        WE +MD +  +LWRR   G    ++YRV GTYTD++ + F N Q+D  YRKKWD++VI L+VI +D  T SE + WV+++PYP+ +R+Y+Y+RR+ +D EN + ++VSRA+  HP + +        P  VRV  Y S++ ++ H  +D+ G DY L Y DNP+   PR  + W  SSG+P F++KLH AALK
Sbjct:   25 EEMKHMEEV-SKLFHGSGAEHQKLVSKSHVDITAAHEEHPWEMVMDKKHFKLWRRPIEGTH-LYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDSLVIKLDVIERDLTTGSEVVHWVTHFPYPMYSRDYVYVRRYDVDQENNLMVLVSRAV-EHPGIPE-------DPEFVRVRTYESQMVIRPHKTFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHTAALK 247          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. TrEMBL
Match: M7B053 (StAR-related lipid transfer protein 7 OS=Chelonia mydas OX=8469 GN=UY3_17506 PE=4 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 3.429e-54
Identity = 95/237 (40.08%), Postives = 146/237 (61.60%), Query Frame = 1
Query:  244 ITDDEMSKNVEEFDSKLSKVSGEALSYRLTRSDLILNMNQFGQDWEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALK 954
            I   E  K++EE  S+L   SG      ++++ + +   +    WE +MD +  +LWRR   G    ++YRV GTYTD++ + F N Q+D  YRKKWD++VI L+VI +D  T SE + WV+++PYP+ +R+Y+Y+RR+ +D EN + ++VSRA+  HP + +        P  VRV  Y S++ ++ H  +D+ G DY L Y DNP+   PR  + W  SSG+P F++KLH AALK
Sbjct:   14 IGSAEEMKHMEEV-SRLFHGSGGEHQKLVSKAHVDITATREEHPWEMVMDKKHFKLWRRPIQGTH-LYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDSLVIKLDVIERDLSTGSEVVHWVTHFPYPMYSRDYVYVRRYNVDQENNLMVLVSRAV-DHPGVPE-------DPEFVRVRTYESQMVIRPHKTFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHTAALK 240          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. TrEMBL
Match: A0A0A0AH81 (START domain-containing protein (Fragment) OS=Charadrius vociferus OX=50402 GN=N301_04303 PE=4 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 2.875e-53
Identity = 88/195 (45.13%), Postives = 129/195 (66.15%), Query Frame = 1
Query:  370 QDWEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALK 954
            Q WE +MD +  +LWRR   G    ++YRV G+YTD++ + F N Q+D  YRKKWD++VI L+VI +D  T SE I WV+++PYP+ +R+Y+Y+RR+ +D EN + ++VSRA+  HP + +  EY       VRV  Y S++ ++ H  +D+ G DY L Y DNP+   PR  + W  SSG+P F++KLH AALK
Sbjct:   42 QPWEMIMDKKHFKLWRRPIEGTH-LYQYRVFGSYTDVTPRQFFNVQLDTEYRKKWDSLVIKLDVIERDLATGSEVIHWVTHFPYPMYSRDYVYVRRYSVDKENNLMVLVSRAV-EHPSVPEDPEY-------VRVRTYESQMVIRPHKTFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHTAALK 227          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. TrEMBL
Match: A0A093HRA0 (START domain-containing protein (Fragment) OS=Struthio camelus australis OX=441894 GN=N308_16028 PE=4 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 3.250e-53
Identity = 88/195 (45.13%), Postives = 128/195 (65.64%), Query Frame = 1
Query:  370 QDWEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALK 954
            Q WE +MD +  +LWRR   G    ++YRV GTYTD++ + F N Q+D  YRKKWD++VI L+VI +D  T SE I WV+++PYP+ +R+Y+Y+RR+ +D EN + ++VSRA+  HP + +  EY       VRV  Y S++ ++ H  +D+ G DY L Y DNP+   PR  + W  SSG+P F++KLH A LK
Sbjct:   34 QPWEMIMDKKHFKLWRRPIEGTH-LYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDSLVIKLDVIERDLATGSEVIHWVTHFPYPMYSRDYVYVRRYSVDKENNLMVLVSRAV-EHPSVPEDPEY-------VRVRTYESQMVIRPHKTFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHTATLK 219          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Cavefish
Match: stard7 (StAR related lipid transfer domain containing 7 [Source:NCBI gene;Acc:103023639])

HSP 1 Score: 183.341 bits (464), Expect = 1.218e-53
Identity = 91/239 (38.08%), Postives = 144/239 (60.25%), Query Frame = 1
Query:  238 DSITDDEMSKNVEEFDSKLSKVSGEALSYRLTRSDLILNMNQFGQDWEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALK 954
            + I DDEM +   E  +  +     A++ R++         Q    WE ++D +  R+WRR   G+   FEYRV G+YTDI+ + F N Q+D  YRKKWD +VI L+V+ +D  T SE + W +++PYP+ +R+Y+Y+RR+ +D +N + ++VSRA+  HP + +  +Y       VRV  Y S++ ++ H  +D+ G DY L Y D+P+   PR  + W  SSG+P F++KLH AAL+
Sbjct:  141 EKIRDDEMKRCAWELQALDAVKKQTAVAGRVSSV-------QTETGWEVVIDKKGFRVWRRPIEGSH-LFEYRVFGSYTDITPRQFFNVQLDTEYRKKWDALVIKLDVVDRDMNTGSEVVHWATHFPYPMYSRDYVYVRRYDVDVQNNLMVLVSRAV-EHPGVPETQDY-------VRVHSYRSRMVIRPHKSFDENGFDYLLTYSDDPQTVFPRYCLSWMVSSGMPDFLEKLHTAALR 363          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Cavefish
Match: pctp (phosphatidylcholine transfer protein [Source:ZFIN;Acc:ZDB-GENE-081022-182])

HSP 1 Score: 64.3142 bits (155), Expect = 3.786e-12
Identity = 43/148 (29.05%), Postives = 68/148 (45.95%), Query Frame = 1
Query:  532 WDNMVILLNV-------IFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSP--PSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAA 948
            W NMV   +        + + + +  + I W   YP+PL+NR+Y+Y+R       NG  I V         L K L   + P    ++RV +Y   L +++       G   F+ Y+DNP   IP   + WA+ SGVP+F+  +  A 
Sbjct:    1 WTNMVKFSSFSKDPGCKLHEKDYSGQKAIYWEVKYPFPLSNRDYVYVRERKDLEVNGRKIWV--------VLAKSLAVSQCPEKAGVIRVKDYKQSLALESDGAN---GTKVFMNYFDNPGGKIPPWLVNWAAKSGVPAFLTDMQKAC 137          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Cavefish
Match: pctp (phosphatidylcholine transfer protein [Source:ZFIN;Acc:ZDB-GENE-081022-182])

HSP 1 Score: 63.929 bits (154), Expect = 4.246e-12
Identity = 39/125 (31.20%), Postives = 60/125 (48.00%), Query Frame = 1
Query:  580 THSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSP--PSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAA 948
            +  + I W   YP+PL+NR+Y+Y+R       NG  I V         L K L   + P    ++RV +Y   L +++       G   F+ Y+DNP   IP   + WA+ SGVP+F+  +  A 
Sbjct:   16 SGQKAIYWEVKYPFPLSNRDYVYVRERKDLEVNGRKIWV--------VLAKSLAVSQCPEKAGVIRVKDYKQSLALESDGAN---GTKVFMNYFDNPGGKIPPWLVNWAAKSGVPAFLTDMQKAC 129          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Cavefish
Match: pctp (phosphatidylcholine transfer protein [Source:ZFIN;Acc:ZDB-GENE-081022-182])

HSP 1 Score: 64.3142 bits (155), Expect = 4.550e-12
Identity = 39/125 (31.20%), Postives = 60/125 (48.00%), Query Frame = 1
Query:  580 THSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSP--PSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAA 948
            +  + I W   YP+PL+NR+Y+Y+R       NG  I V         L K L   + P    ++RV +Y   L +++       G   F+ Y+DNP   IP   + WA+ SGVP+F+  +  A 
Sbjct:   34 SGQKAIYWEVKYPFPLSNRDYVYVRERKDLEVNGRKIWV--------VLAKSLAVSQCPEKAGVIRVKDYKQSLALESDGAN---GTKVFMNYFDNPGGKIPPWLVNWAAKSGVPAFLTDMQKAC 147          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Cavefish
Match: pctp (phosphatidylcholine transfer protein [Source:ZFIN;Acc:ZDB-GENE-081022-182])

HSP 1 Score: 63.5438 bits (153), Expect = 6.025e-12
Identity = 39/125 (31.20%), Postives = 60/125 (48.00%), Query Frame = 1
Query:  580 THSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSP--PSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAA 948
            +  + I W   YP+PL+NR+Y+Y+R       NG  I V         L K L   + P    ++RV +Y   L +++       G   F+ Y+DNP   IP   + WA+ SGVP+F+  +  A 
Sbjct:   16 SGQKAIYWEVKYPFPLSNRDYVYVRERKDLEVNGRKIWV--------VLAKSLAVSQCPEKAGVIRVKDYKQSLALESDGA---NGTKVFMNYFDNPGGKIPPWLVNWAAKSGVPAFLTDMQKAC 129          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Sea Lamprey
Match: stard7 (StAR-related lipid transfer (START) domain containing 7 [Source:ZFIN;Acc:ZDB-GENE-030131-2310])

HSP 1 Score: 152.14 bits (383), Expect = 2.701e-44
Identity = 80/196 (40.82%), Postives = 121/196 (61.73%), Query Frame = 1
Query:  376 WEKMMDTEEIRLWRRKYPGNE-ETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKP-GMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALKN 957
            WE +       LWRR       + ++YRV GTYTDIS + F+N Q+D+ YRK+WD +VI L++I  DE T SE I WV+++PYPL  R+Y+Y+RR  +D +N I ++VSR++  HP + +  ++       VRV  Y S++ V+AHS + +  G    L    +P+    R+ + W  SSG+P F++KLH AALK+
Sbjct:   25 WELVTQRPGFTLWRRPLSTTHTQLYQYRVYGTYTDISPQQFLNVQLDIEYRKRWDQLVIRLDLIDHDESTGSEVIHWVTHFPYPLYARDYVYVRRHWLDEKNNIMVLVSRSV-DHPDMPESSKF-------VRVRSYHSQMVVRAHSSFQEVNGSQPPLTPPHHPQRLFNRSCISWMVSSGMPDFLEKLHLAALKS 212          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Nematostella
Match: EDO46303 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQJ8])

HSP 1 Score: 159.844 bits (403), Expect = 1.430e-47
Identity = 81/198 (40.91%), Postives = 124/198 (62.63%), Query Frame = 1
Query:  376 WEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPP--SIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALKNPH 963
            WEK+ + E++ ++RR    +   +EY+V G++ DI+A++F  TQID  YRK+WD   I L+VI KD     E + W+  YPYPL +R+Y+++R+  ID ++   +++S+A  SHP         K P   + VRVT+Y S++ +  H  +D+ GMD+ L YYDNPK  IP     +A+S+G+P+FI KLH AA K  H
Sbjct:    3 WEKLTEEEQLSVYRRHM--DNGIYEYKVFGSFLDINARSFFFTQIDTNYRKQWDQYAIKLDVIDKDPAGDCEVLHWIMKYPYPLTSRDYVFVRKSKIDMQSNKMVLMSKAT-SHP---------KCPENNTHVRVTDYGSQMVILPHRTFDENGMDFVLSYYDNPKVTIPNVCTSYATSAGIPNFINKLHLAAKKVQH 188          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Nematostella
Match: EDO42511 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1I0])

HSP 1 Score: 97.0561 bits (240), Expect = 1.288e-23
Identity = 62/193 (32.12%), Postives = 94/193 (48.70%), Query Frame = 1
Query:  379 EKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGI--AIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAAL 951
            E   D    +++RR Y      ++Y++ G   D+         +DL YRKKWD+ V  L      EE+  + I W   YP+P++NR+Y Y+R       NGI   +V++R   SHP     +    +   +VRV +Y   L  Q+  K    G   F+ Y+DNP   IP   + WA+ +GVPSF+  +  A L
Sbjct:   27 ESAGDKVTCKIYRR-YKEESGLYDYKILGDLVDVPTDTCKAVYMDLDYRKKWDSYVKALEEF---EESGVKGIYWNVNYPFPMSNRDYTYIRELREFDINGIPTTVVIAR---SHP-----VASIPAKSGVVRVADYNQTLTFQSDGK---QGTKAFMYYFDNPGGMIPTWLINWAAKTGVPSFMTSMRKACL 204          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Nematostella
Match: EDO27423 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9A4])

HSP 1 Score: 93.5893 bits (231), Expect = 3.750e-23
Identity = 48/115 (41.74%), Postives = 74/115 (64.35%), Query Frame = 1
Query:  619 YPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALKNPH 963
            YPL +R+Y+++R+  ID ++   +++S+A  SHP   K  E +    + VRVT+Y S++ +  H  +D+ GMD+ L YYDNPK  IP     +A+S+G+P+FI KLH AA K  H
Sbjct:    1 YPLTSRDYVFVRKSKIDMQSNKMVLMSKAT-SHP---KCPENN----THVRVTDYGSQMVILPHRTFDENGMDFVLSYYDNPKVTIPNVCTSYATSAGIPNFINKLHLAAKKVQH 107          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Medaka
Match: stard7 (StAR related lipid transfer domain containing 7 [Source:NCBI gene;Acc:101173955])

HSP 1 Score: 178.718 bits (452), Expect = 8.070e-52
Identity = 82/193 (42.49%), Postives = 126/193 (65.28%), Query Frame = 1
Query:  376 WEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALK 954
            WE +M+ ++ R+W+R  P N   +EYRV G+Y D++ + F N Q+D  YRKKWD++VI L VI +D  T SE + W +++PYPL +R+Y+Y+RR+ +D  + + I+VSRA+  HP + +  E+       VRV  Y SK+ ++ H  +D+ G DY L Y D+P+   PR  + W  SSG+P F++KLH AAL+
Sbjct:  179 WEAVMEKKDFRVWKRPIP-NSHLYEYRVLGSYNDVTPRQFFNVQLDTEYRKKWDSLVIKLEVIDRDSMTGSEVVHWATHFPYPLYSRDYVYVRRYEVDINHNLMILVSRAV-QHPKVPETQEF-------VRVHSYQSKMVIRPHKSFDENGFDYLLTYSDDPQTVFPRYCVSWMVSSGMPDFLEKLHVAALR 362          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Medaka
Match: pctp (phosphatidylcholine transfer protein [Source:NCBI gene;Acc:101173942])

HSP 1 Score: 85.1149 bits (209), Expect = 1.640e-18
Identity = 61/204 (29.90%), Postives = 98/204 (48.04%), Query Frame = 1
Query:  349 LNMNQFGQDWEKMMDTEEIRLWRRKYPGNEET--FEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENG--IAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAA 948
            L+  Q    WE   +T  +++ R     ++ET  +EY+V G     SA+   +  +DLTYRK WD     L     D ET    I W   YP+PL+NR+Y+Y+R       NG  I ++++R+       +K          ++RV +Y   + +++       G   F+ Y+DNP   IP+  + WA+ SGVP F+  +  A 
Sbjct:   57 LDEPQLDGGWELFTETMGVQIHRLL---DKETGLYEYKVFGVLATCSAELCADVYMDLTYRKHWDKYAKELYEKDFDGETA---IYWEVKYPFPLSNRDYVYVRERRDLDVNGRKIWVILARSSPETACPEK--------SGVLRVNDYKQSVALESDGA---NGTRVFMNYFDNPGGMIPKWVINWAAKSGVPGFLTDMQKAC 243          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Medaka
Match: pctp (phosphatidylcholine transfer protein [Source:NCBI gene;Acc:101173942])

HSP 1 Score: 81.6481 bits (200), Expect = 4.972e-17
Identity = 53/170 (31.18%), Postives = 83/170 (48.82%), Query Frame = 1
Query:  445 FEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENG--IAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAA 948
            +EY+V G     SA+   +  +DLTYRK WD     L     D ET    I W   YP+PL+NR+Y+Y+R       NG  I ++++R+       +K          ++RV +Y   + +++       G   F+ Y+DNP   IP+  + WA+ SGVP F+  +  A 
Sbjct:  140 YEYKVFGVLATCSAELCADVYMDLTYRKHWDKYAKELYEKDFDGETA---IYWEVKYPFPLSNRDYVYVRERRDLDVNGRKIWVILARSSPETACPEK--------SGVLRVNDYKQSVALESDGA---NGTRVFMNYFDNPGGMIPKWVINWAAKSGVPGFLTDMQKAC 295          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Medaka
Match: stard14 (START domain-containing protein 10 [Source:NCBI gene;Acc:101168965])

HSP 1 Score: 47.7506 bits (112), Expect = 8.270e-6
Identity = 45/199 (22.61%), Postives = 81/199 (40.70%), Query Frame = 1
Query:  376 WEKMMDTEEIRLWRRKYPGNE--ETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWD-NMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFL-IYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALKNP 960
            W+   +  ++++W    P N   +  + R   T  D+SA    +   D  YRK WD NM+   ++    +     +  W    P PL NR+ + LR + +  +  I I  S     +P             ++VR    ++  ++    K   P    F+ +   +PK ++P+  +  AS    P  +K +H A  K P
Sbjct:   27 WQSKYNKNDMQVWIENPPPNSAPKVHKIRCKMTIKDVSAATMYDVIHDGEYRKTWDPNMLDSFDIARLSDNADVGYYSWNC--PKPLKNRDVVTLRSWQVKDDEYIIINFSVKHPKYPAQG----------NLVRAVSMLTGYYI----KNTGPNSCTFIYLSQADPKGSLPKWVVNKASQVLAPRVLKSVHKAGQKYP 209          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Planmine SMEST
Match: SMESG000018487.1 (SMESG000018487.1)

HSP 1 Score: 520.776 bits (1340), Expect = 0.000e+0
Identity = 272/274 (99.27%), Postives = 274/274 (100.00%), Query Frame = 1
Query:  142 MKLKKTWNSKLKNXXXXXXXXXXXXXXXXXXXDSITDDEMSKNVEEFDSKLSKVSGEALSYRLTRSDLILNMNQFGQDWEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALKNPH 963
            MKLKKTWNSKLKNSNSRILSISFILLSHIRRSDSITDDEMSKNVEEFDSKLSKVSGEALSYRLTRSDLILNMNQFG+DWEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAK+FMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALKNPH
Sbjct:    1 MKLKKTWNSKLKNSNSRILSISFILLSHIRRSDSITDDEMSKNVEEFDSKLSKVSGEALSYRLTRSDLILNMNQFGKDWEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAKSFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAALKNPH 274          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Planmine SMEST
Match: SMESG000005586.1 (SMESG000005586.1)

HSP 1 Score: 215.698 bits (548), Expect = 4.388e-66
Identity = 93/201 (46.27%), Postives = 145/201 (72.14%), Query Frame = 1
Query:  352 NMNQFGQD-WEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAKAFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANREYIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVSKLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLHDAAL 951
            N+  F  D W ++++T+ ++LWRR +P N + FEYR+CGT+ DISA++F   QID+ YRK+WDN+++ LN+I  D ET ++ IRW+++YPYP+++REYI+ RR  +   N  AI+VS+A       +K   + K+  S VR+ +Y S +++Q+H+ ++K GMDYFLIYYD+PK N P  A+ W S++G+PSFI+K+H A+L
Sbjct:  151 NLEGFIDDSWTQLINTKTVKLWRRPFPSNPKVFEYRLCGTFDDISARSFYEVQIDIEYRKQWDNLIVDLNIIKTDRETETDTIRWITHYPYPMSDREYIFKRRSCVLQNNRSAIIVSKA-------NKDESFSKTNSSTVRILDYKSLMYIQSHNHFNKVGMDYFLIYYDDPKTNFPSAAVSWMSTTGIPSFIEKVHKASL 344          
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Planmine SMEST
Match: SMESG000018486.1 (SMESG000018486.1)

HSP 1 Score: 55.4546 bits (132), Expect = 5.518e-8
Identity = 26/26 (100.00%), Postives = 26/26 (100.00%), Query Frame = -2
Query: 1086 DSKNGLLLDIISLLNAFQDPKEFRTQ 1163
            DSKNGLLLDIISLLNAFQDPKEFRTQ
Sbjct: 2136 DSKNGLLLDIISLLNAFQDPKEFRTQ 2161          
The following BLAST results are available for this feature:
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STARD71.296e-5343.59StAR related lipid transfer domain containing 7 [S... [more]
STARD73.832e-3246.85StAR related lipid transfer domain containing 7 [S... [more]
PCTP1.124e-2230.81phosphatidylcholine transfer protein [Source:HGNC ... [more]
PCTP1.060e-1830.11phosphatidylcholine transfer protein [Source:HGNC ... [more]
PCTP6.844e-1830.05phosphatidylcholine transfer protein [Source:HGNC ... [more]
back to top
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C06H2.24.589e-3937.88pep chromosome:WBcel235:V:11125222:11127306:1 gene... [more]
back to top
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG65653.204e-2629.49gene:FBgn0032513 transcript:FBtr0342631[more]
CG65653.204e-2629.49gene:FBgn0032513 transcript:FBtr0080468[more]
CG65653.204e-2629.49gene:FBgn0032513 transcript:FBtr0346420[more]
back to top
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
stard79.672e-5538.91StAR-related lipid transfer (START) domain contain... [more]
pctp1.554e-2028.92phosphatidylcholine transfer protein [Source:ZFIN;... [more]
back to top
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
stard72.354e-5242.56StAR related lipid transfer domain containing 7 [S... [more]
ENSXETT00000038456.11.758e-724.39uncharacterized LOC100145115 [Source:NCBI gene;Acc... [more]
nr2f69.304e-721.89nuclear receptor subfamily 2 group F member 6 [Sou... [more]
back to top
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Stard72.484e-5343.08START domain containing 7 [Source:MGI Symbol;Acc:M... [more]
Stard71.689e-4443.98START domain containing 7 [Source:MGI Symbol;Acc:M... [more]
Pctp6.770e-2229.70phosphatidylcholine transfer protein [Source:MGI S... [more]
Stard77.650e-737.50START domain containing 7 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NQZ5|STAR7_HUMAN6.222e-5343.59StAR-related lipid transfer protein 7, mitochondri... [more]
sp|Q8R1R3|STAR7_MOUSE1.737e-5243.08StAR-related lipid transfer protein 7, mitochondri... [more]
sp|Q9UKL6|PPCT_HUMAN5.400e-2230.81Phosphatidylcholine transfer protein OS=Homo sapie... [more]
sp|P02720|PPCT_BOVIN1.914e-2128.28Phosphatidylcholine transfer protein OS=Bos taurus... [more]
sp|P53808|PPCT_MOUSE6.462e-2129.70Phosphatidylcholine transfer protein OS=Mus muscul... [more]
back to top
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1EDW22.546e-5841.96START domain-containing protein OS=Helobdella robu... [more]
K7FHD11.213e-5441.20StAR related lipid transfer domain containing 7 OS... [more]
M7B0533.429e-5440.08StAR-related lipid transfer protein 7 OS=Chelonia ... [more]
A0A0A0AH812.875e-5345.13START domain-containing protein (Fragment) OS=Char... [more]
A0A093HRA03.250e-5345.13START domain-containing protein (Fragment) OS=Stru... [more]
back to top
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stard71.218e-5338.08StAR related lipid transfer domain containing 7 [S... [more]
pctp3.786e-1229.05phosphatidylcholine transfer protein [Source:ZFIN;... [more]
pctp4.246e-1231.20phosphatidylcholine transfer protein [Source:ZFIN;... [more]
pctp4.550e-1231.20phosphatidylcholine transfer protein [Source:ZFIN;... [more]
pctp6.025e-1231.20phosphatidylcholine transfer protein [Source:ZFIN;... [more]
back to top
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
stard72.701e-4440.82StAR-related lipid transfer (START) domain contain... [more]
back to top
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO463031.430e-4740.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425111.288e-2332.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274233.750e-2341.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
stard78.070e-5242.49StAR related lipid transfer domain containing 7 [S... [more]
pctp1.640e-1829.90phosphatidylcholine transfer protein [Source:NCBI ... [more]
pctp4.972e-1731.18phosphatidylcholine transfer protein [Source:NCBI ... [more]
stard148.270e-622.61START domain-containing protein 10 [Source:NCBI ge... [more]
back to top
BLAST of StAR-related lipid transfer (START) domain containing 7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000018487.10.000e+099.27SMESG000018487.1[more]
SMESG000005586.14.388e-6646.27SMESG000005586.1[more]
SMESG000018486.15.518e-8100.00SMESG000018486.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001778 ID=SMED30001778|Name=StAR-related lipid transfer (START) domain containing 7|organism=Schmidtea mediterranea sexual|type=transcript|length=1164bp
ATTTTATTATATTAAGTTTCATTTAAATAATCCTTATTGATGCATAATCT
ATGGAAAACACTAAGAAACAGCACATTTAATACTAAGCATTTTTTACTAA
TATTACCTGAAAAATTATTTTTTCAAAATTTTAATAAAATTATGAAACTG
AAGAAAACATGGAATTCTAAGTTGAAAAATTCGAATTCAAGAATTTTATC
CATAAGCTTTATTTTACTTTCCCACATCAGACGAAGTGATAGTATCACTG
ATGATGAAATGTCGAAGAACGTTGAAGAATTCGATAGTAAACTTTCTAAA
GTCTCCGGAGAAGCTTTGTCTTACCGATTAACAAGATCAGATTTAATATT
GAATATGAATCAATTTGGTCAAGACTGGGAAAAAATGATGGATACAGAAG
AAATTAGGTTATGGAGGAGAAAATATCCTGGGAATGAAGAGACCTTTGAA
TATAGAGTATGTGGTACATATACCGATATCAGTGCTAAAGCTTTTATGAA
CACACAAATAGATTTAACCTATCGGAAAAAATGGGATAATATGGTGATTT
TGCTAAATGTTATCTTTAAAGATGAAGAAACGCATAGTGAATTTATTCGT
TGGGTTTCTTATTACCCATATCCATTGGCAAATAGAGAATACATCTATTT
AAGAAGATTTCTAATTGATGCCGAAAACGGAATCGCCATTGTTGTTTCAA
GAGCTATTGGAAGTCATCCATTTCTAGACAAAATTTTAGAATATGACAAA
TCCCCTCCATCTATAGTCCGAGTGACGGAATATGTATCAAAATTATTTGT
TCAAGCTCATTCAAAATATGATAAACCTGGAATGGATTATTTTTTAATTT
ATTATGACAACCCAAAAGCAAATATTCCCAGGACTGCAATGAAATGGGCT
TCATCATCAGGAGTTCCGTCATTTATCAAAAAACTGCATGATGCTGCCTT
GAAAAATCCTCATTGACAATCAAAAACAATATTTATTAAAAATTTATTTT
CCAAAAAGATACATGTATAAAAATTTAGTAATTATATGAACAGCATAACA
AAGAAATGTTTTTAAAAATAAATTTTATAAAATTATTGTGTTCGAAATTC
CTTTGGGTCTTGAAATGCATTGAGTAATGAAATAATATCCAACAATAAAC
CATTTTTCGAATCA
back to top

protein sequence of SMED30001778-orf-1

>SMED30001778-orf-1 ID=SMED30001778-orf-1|Name=SMED30001778-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=309bp
MHNLWKTLRNSTFNTKHFLLILPEKLFFQNFNKIMKLKKTWNSKLKNSNS
RILSISFILLSHIRRSDSITDDEMSKNVEEFDSKLSKVSGEALSYRLTRS
DLILNMNQFGQDWEKMMDTEEIRLWRRKYPGNEETFEYRVCGTYTDISAK
AFMNTQIDLTYRKKWDNMVILLNVIFKDEETHSEFIRWVSYYPYPLANRE
YIYLRRFLIDAENGIAIVVSRAIGSHPFLDKILEYDKSPPSIVRVTEYVS
KLFVQAHSKYDKPGMDYFLIYYDNPKANIPRTAMKWASSSGVPSFIKKLH
DAALKNPH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000208testis
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR002913START_lipid-bd_dom
IPR023393START-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0008289lipid binding
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0005739mitochondrion
Vocabulary: biological process
TermDefinition
GO:1903955positive regulation of protein targeting to mitochondrion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR023393START-like domain superfamilyGENE3DG3DSA:3.30.530.20coord: 98..307
e-value: 2.3E-54
score: 185.9
IPR002913START domainPFAMPF01852STARTcoord: 102..306
e-value: 2.0E-9
score: 37.2
IPR002913START domainPROSITEPS50848STARTcoord: 113..308
score: 20.977
NoneNo IPR availablePANTHERPTHR19308PHOSPHATIDYLCHOLINE TRANSFER PROTEINcoord: 37..305
NoneNo IPR availablePANTHERPTHR19308:SF8STAR-RELATED LIPID TRANSFER PROTEIN 7, MITOCHONDRIALcoord: 37..305
NoneNo IPR availableSUPERFAMILYSSF55961Bet v1-likecoord: 106..303