Flotillin-1

Overview
NameFlotillin-1
Smed IDSMED30001755
Length (bp)1323
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Flotillin-1 (SMED30001755) t-SNE clustered cells

Violin plots show distribution of expression levels for Flotillin-1 (SMED30001755) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Flotillin-1 (SMED30001755) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Flotillin-1 (SMED30001755) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001755

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30001755SMESG000062944.1 dd_Smed_v4_4656_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001755SMESG000062944.1 dd_Smed_v6_4656_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Flotillin-1 vs. Ensembl Human
Match: FLOT1 (flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757])

HSP 1 Score: 477.633 bits (1228), Expect = 5.053e-167
Identity = 237/414 (57.25%), Postives = 333/414 (80.43%), Query Frame = 3
Query:   33 FIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            F  CGPNEAMVVSG     PVM++GGR FV P I ++Q+ISLNT+TL + S ++YT+ GVP++VTG+AQ+KI G +K MLA AC+ FLGKTE EI  IA ETLE HQRAIM +MTVEEIYKDR+KFS  VF+VASSD++NMGISVVSYTLKDI DD+ YL +LG+ARTAQV++DARIGEAEAK+D+GI+EA A+Q K +AQ  +++E+AK+ RDYELKKA ++ EV T+RA++D +Y +Q AKT+Q I+E+ +Q++V+ER +++ V+  EI R++K LEA VRK A+AE+Y+LE+L EAE +++  +AEAEA  ++++G AEA AI  +A A+A QM  KAEA+Q YQEAA+L+M L+ LPQ+A E++ P+++ +KI+++ +GSG +GA+K+T E+L+I+ +LP  ++ +TG +
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVS 415          
BLAST of Flotillin-1 vs. Ensembl Human
Match: FLOT1 (flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757])

HSP 1 Score: 477.633 bits (1228), Expect = 5.053e-167
Identity = 237/414 (57.25%), Postives = 333/414 (80.43%), Query Frame = 3
Query:   33 FIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            F  CGPNEAMVVSG     PVM++GGR FV P I ++Q+ISLNT+TL + S ++YT+ GVP++VTG+AQ+KI G +K MLA AC+ FLGKTE EI  IA ETLE HQRAIM +MTVEEIYKDR+KFS  VF+VASSD++NMGISVVSYTLKDI DD+ YL +LG+ARTAQV++DARIGEAEAK+D+GI+EA A+Q K +AQ  +++E+AK+ RDYELKKA ++ EV T+RA++D +Y +Q AKT+Q I+E+ +Q++V+ER +++ V+  EI R++K LEA VRK A+AE+Y+LE+L EAE +++  +AEAEA  ++++G AEA AI  +A A+A QM  KAEA+Q YQEAA+L+M L+ LPQ+A E++ P+++ +KI+++ +GSG +GA+K+T E+L+I+ +LP  ++ +TG +
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVS 415          
BLAST of Flotillin-1 vs. Ensembl Human
Match: FLOT1 (flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757])

HSP 1 Score: 477.633 bits (1228), Expect = 5.053e-167
Identity = 237/414 (57.25%), Postives = 333/414 (80.43%), Query Frame = 3
Query:   33 FIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            F  CGPNEAMVVSG     PVM++GGR FV P I ++Q+ISLNT+TL + S ++YT+ GVP++VTG+AQ+KI G +K MLA AC+ FLGKTE EI  IA ETLE HQRAIM +MTVEEIYKDR+KFS  VF+VASSD++NMGISVVSYTLKDI DD+ YL +LG+ARTAQV++DARIGEAEAK+D+GI+EA A+Q K +AQ  +++E+AK+ RDYELKKA ++ EV T+RA++D +Y +Q AKT+Q I+E+ +Q++V+ER +++ V+  EI R++K LEA VRK A+AE+Y+LE+L EAE +++  +AEAEA  ++++G AEA AI  +A A+A QM  KAEA+Q YQEAA+L+M L+ LPQ+A E++ P+++ +KI+++ +GSG +GA+K+T E+L+I+ +LP  ++ +TG +
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVS 415          
BLAST of Flotillin-1 vs. Ensembl Human
Match: FLOT1 (flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757])

HSP 1 Score: 477.633 bits (1228), Expect = 5.053e-167
Identity = 237/414 (57.25%), Postives = 333/414 (80.43%), Query Frame = 3
Query:   33 FIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            F  CGPNEAMVVSG     PVM++GGR FV P I ++Q+ISLNT+TL + S ++YT+ GVP++VTG+AQ+KI G +K MLA AC+ FLGKTE EI  IA ETLE HQRAIM +MTVEEIYKDR+KFS  VF+VASSD++NMGISVVSYTLKDI DD+ YL +LG+ARTAQV++DARIGEAEAK+D+GI+EA A+Q K +AQ  +++E+AK+ RDYELKKA ++ EV T+RA++D +Y +Q AKT+Q I+E+ +Q++V+ER +++ V+  EI R++K LEA VRK A+AE+Y+LE+L EAE +++  +AEAEA  ++++G AEA AI  +A A+A QM  KAEA+Q YQEAA+L+M L+ LPQ+A E++ P+++ +KI+++ +GSG +GA+K+T E+L+I+ +LP  ++ +TG +
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVS 415          
BLAST of Flotillin-1 vs. Ensembl Human
Match: FLOT1 (flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757])

HSP 1 Score: 477.633 bits (1228), Expect = 5.053e-167
Identity = 237/414 (57.25%), Postives = 333/414 (80.43%), Query Frame = 3
Query:   33 FIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            F  CGPNEAMVVSG     PVM++GGR FV P I ++Q+ISLNT+TL + S ++YT+ GVP++VTG+AQ+KI G +K MLA AC+ FLGKTE EI  IA ETLE HQRAIM +MTVEEIYKDR+KFS  VF+VASSD++NMGISVVSYTLKDI DD+ YL +LG+ARTAQV++DARIGEAEAK+D+GI+EA A+Q K +AQ  +++E+AK+ RDYELKKA ++ EV T+RA++D +Y +Q AKT+Q I+E+ +Q++V+ER +++ V+  EI R++K LEA VRK A+AE+Y+LE+L EAE +++  +AEAEA  ++++G AEA AI  +A A+A QM  KAEA+Q YQEAA+L+M L+ LPQ+A E++ P+++ +KI+++ +GSG +GA+K+T E+L+I+ +LP  ++ +TG +
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVS 415          
BLAST of Flotillin-1 vs. Ensembl Fly
Match: Flo1 (gene:FBgn0024754 transcript:FBtr0087351)

HSP 1 Score: 506.908 bits (1304), Expect = 7.247e-179
Identity = 257/418 (61.48%), Postives = 346/418 (82.78%), Query Frame = 3
Query:   21 MVWGFIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            M WGF+ CGPNEA+VVSGC + KP+++ GGR FVWPV  ++Q+ISLNTMTL + SP +YT  GVP++VTG+AQ+K+ G ++ ML TACEQFLGK+E EI  IA  TLE HQRAIMG+MTVEEIYKDRKKFS  VFEVASSD+ NMGI+VVSYT+KD++D+EGYL++LG ARTA+VKRDARIGEAEA+ ++ IKEA+AE+ + AA+  ND +IAK+ RD+ELKKA ++ EVQTK+AE++ +Y++QAAKT+Q IKEE MQ+KVIER ++I V+  EI+R+++ LEAT+R+ A+AEK+R+EKL EA   R+  EAEAEAE I+++G AEA AI  KA+A+A QM +KAEA++EY+EAA + M LD LP++AAEVAAP+S   KI+M+ +G+G+IGA+KLT E+L I+ K+P ++++ITG +
Sbjct:    1 MTWGFVTCGPNEALVVSGCCYMKPLLVPGGRAFVWPVGQQVQRISLNTMTLQVESPCVYTSQGVPISVTGIAQVKVQGQNEDMLLTACEQFLGKSEAEINHIALVTLEGHQRAIMGSMTVEEIYKDRKKFSKQVFEVASSDLANMGITVVSYTIKDLRDEEGYLRSLGMARTAEVKRDARIGEAEARAEAHIKEAIAEEQRMAARFLNDTDIAKAQRDFELKKAAYDVEVQTKKAEAEMAYELQAAKTKQRIKEEQMQVKVIERTQEIAVQEQEIMRRERELEATIRRPAEAEKFRMEKLAEANKQRVVMEAEAEAESIRIRGEAEAFAIAAKAKAEAEQMAMKAEAYREYREAAMVEMLLDTLPKVAAEVAAPLSQAKKITMVSSGTGDIGAAKLTGEVLSIVNKVPELVKNITGVD 418          
BLAST of Flotillin-1 vs. Ensembl Fly
Match: Flo1 (gene:FBgn0024754 transcript:FBtr0087352)

HSP 1 Score: 501.13 bits (1289), Expect = 1.630e-176
Identity = 257/422 (60.90%), Postives = 346/422 (81.99%), Query Frame = 3
Query:   21 MVWGFIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDE----GYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            M WGF+ CGPNEA+VVSGC + KP+++ GGR FVWPV  ++Q+ISLNTMTL + SP +YT  GVP++VTG+AQ+K+ G ++ ML TACEQFLGK+E EI  IA  TLE HQRAIMG+MTVEEIYKDRKKFS  VFEVASSD+ NMGI+VVSYT+KD++D+E    GYL++LG ARTA+VKRDARIGEAEA+ ++ IKEA+AE+ + AA+  ND +IAK+ RD+ELKKA ++ EVQTK+AE++ +Y++QAAKT+Q IKEE MQ+KVIER ++I V+  EI+R+++ LEAT+R+ A+AEK+R+EKL EA   R+  EAEAEAE I+++G AEA AI  KA+A+A QM +KAEA++EY+EAA + M LD LP++AAEVAAP+S   KI+M+ +G+G+IGA+KLT E+L I+ K+P ++++ITG +
Sbjct:    1 MTWGFVTCGPNEALVVSGCCYMKPLLVPGGRAFVWPVGQQVQRISLNTMTLQVESPCVYTSQGVPISVTGIAQVKVQGQNEDMLLTACEQFLGKSEAEINHIALVTLEGHQRAIMGSMTVEEIYKDRKKFSKQVFEVASSDLANMGITVVSYTIKDLRDEEGDSKGYLRSLGMARTAEVKRDARIGEAEARAEAHIKEAIAEEQRMAARFLNDTDIAKAQRDFELKKAAYDVEVQTKKAEAEMAYELQAAKTKQRIKEEQMQVKVIERTQEIAVQEQEIMRRERELEATIRRPAEAEKFRMEKLAEANKQRVVMEAEAEAESIRIRGEAEAFAIAAKAKAEAEQMAMKAEAYREYREAAMVEMLLDTLPKVAAEVAAPLSQAKKITMVSSGTGDIGAAKLTGEVLSIVNKVPELVKNITGVD 422          
BLAST of Flotillin-1 vs. Ensembl Fly
Match: Flo2 (gene:FBgn0264078 transcript:FBtr0073952)

HSP 1 Score: 325.865 bits (834), Expect = 8.883e-108
Identity = 185/412 (44.90%), Postives = 281/412 (68.20%), Query Frame = 3
Query:   45 GPNEAMVVSG--CFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            GPNEA++VSG  C   K   I GG  + W ++  +Q++SLN MTL      + T  GVP+TVTGVAQ KI  +D+ +L TA EQFLGK+  EI+    +TLE H RAI+G +TVEE+YKDR +F++ V EVA+ D+  MGI ++S+T+KD+ DD  YL +LG+A+TA VKRDA  G AEA +D+GI+EA  E+     + S D +I  ++R Y+L+KANF++E+ T +AES  +Y++QAAK +Q I+ E +QI+V+ER ++IE+E  E+ R+D+ L  TV+  A+AE +RL+ L +A+  +    A AEAE+I+  G AEA AI L  +A+A +M +KA  +++Y +AA +N+ L+ LP++AAEVAAP++  D+I +I       G   +T+++  ++ +LP  I ++TG +
Sbjct:    8 GPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGVPLTVTGVAQCKIMKADE-LLGTASEQFLGKSVKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLGKAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVKYSTDTKIEDNTRMYKLQKANFDQEINTAKAESQLAYELQAAKIRQRIRNEEIQIEVVERRKQIEIESQEVQRKDRELTGTVKLPAEAEAFRLQTLAQAKQCQTIEGARAEAERIRKIGSAEAHAIELVGKAEAERMRMKAHVYKQYGDAAIMNIVLESLPKIAAEVAAPLAKTDEIVLIG------GNDNITNDVTRLVAQLPPSINALTGVD 412          
BLAST of Flotillin-1 vs. Ensembl Fly
Match: Flo2 (gene:FBgn0264078 transcript:FBtr0073950)

HSP 1 Score: 325.865 bits (834), Expect = 8.883e-108
Identity = 185/412 (44.90%), Postives = 281/412 (68.20%), Query Frame = 3
Query:   45 GPNEAMVVSG--CFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            GPNEA++VSG  C   K   I GG  + W ++  +Q++SLN MTL      + T  GVP+TVTGVAQ KI  +D+ +L TA EQFLGK+  EI+    +TLE H RAI+G +TVEE+YKDR +F++ V EVA+ D+  MGI ++S+T+KD+ DD  YL +LG+A+TA VKRDA  G AEA +D+GI+EA  E+     + S D +I  ++R Y+L+KANF++E+ T +AES  +Y++QAAK +Q I+ E +QI+V+ER ++IE+E  E+ R+D+ L  TV+  A+AE +RL+ L +A+  +    A AEAE+I+  G AEA AI L  +A+A +M +KA  +++Y +AA +N+ L+ LP++AAEVAAP++  D+I +I       G   +T+++  ++ +LP  I ++TG +
Sbjct:    8 GPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGVPLTVTGVAQCKIMKADE-LLGTASEQFLGKSVKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLGKAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVKYSTDTKIEDNTRMYKLQKANFDQEINTAKAESQLAYELQAAKIRQRIRNEEIQIEVVERRKQIEIESQEVQRKDRELTGTVKLPAEAEAFRLQTLAQAKQCQTIEGARAEAERIRKIGSAEAHAIELVGKAEAERMRMKAHVYKQYGDAAIMNIVLESLPKIAAEVAAPLAKTDEIVLIG------GNDNITNDVTRLVAQLPPSINALTGVD 412          
BLAST of Flotillin-1 vs. Ensembl Fly
Match: Flo2 (gene:FBgn0264078 transcript:FBtr0330217)

HSP 1 Score: 325.479 bits (833), Expect = 1.612e-107
Identity = 185/412 (44.90%), Postives = 281/412 (68.20%), Query Frame = 3
Query:   45 GPNEAMVVSG--CFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            GPNEA++VSG  C   K   I GG  + W ++  +Q++SLN MTL      + T  GVP+TVTGVAQ KI  +D+ +L TA EQFLGK+  EI+    +TLE H RAI+G +TVEE+YKDR +F++ V EVA+ D+  MGI ++S+T+KD+ DD  YL +LG+A+TA VKRDA  G AEA +D+GI+EA  E+     + S D +I  ++R Y+L+KANF++E+ T +AES  +Y++QAAK +Q I+ E +QI+V+ER ++IE+E  E+ R+D+ L  TV+  A+AE +RL+ L +A+  +    A AEAE+I+  G AEA AI L  +A+A +M +KA  +++Y +AA +N+ L+ LP++AAEVAAP++  D+I +I       G   +T+++  ++ +LP  I ++TG +
Sbjct:    8 GPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGVPLTVTGVAQCKIMKADE-LLGTASEQFLGKSVKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLGKAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVKYSTDTKIEDNTRMYKLQKANFDQEINTAKAESQLAYELQAAKIRQRIRNEEIQIEVVERRKQIEIESQEVQRKDRELTGTVKLPAEAEAFRLQTLAQAKQCQTIEGARAEAERIRKIGSAEAHAIELVGKAEAERMRMKAHVYKQYGDAAIMNIVLESLPKIAAEVAAPLAKTDEIVLIG------GNDNITNDVTRLVAQLPPSINALTGVD 412          
BLAST of Flotillin-1 vs. Ensembl Zebrafish
Match: flot1a (flotillin 1a [Source:ZFIN;Acc:ZDB-GENE-020430-1])

HSP 1 Score: 464.151 bits (1193), Expect = 6.409e-162
Identity = 240/414 (57.97%), Postives = 324/414 (78.26%), Query Frame = 3
Query:   33 FIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            F  CGPNEAMVVSG     PVMISGGR FV+P + ++Q+ISLNT+TL + S ++YT+ GVP++VTG+AQ+KI G +K MLA AC+ FLGK++ EI  IA ETLE HQRAI+ ++TVEEIYKDRKKFS  VF+VASSD++NMGISVVSYTLKD+ DD+ YL +LG+ARTAQV++DARIGEA+ K+D+ I+EA A Q K +AQ  N++E+AK+ RDYELKKA ++ EV TK+AES+ +Y +Q AKT+Q I+EE MQ+ V+ER ++I ++  EI R++K LEA V+K A+AE+YRLEKL EAE  ++  EAEAEAE I+++G AEA A+  K  A+A QM  KAEA+Q Y+E A ++M L+ LP +A E++ P+S  +K++M+ +G  EIGA+KLT E+L+IM KLP  I+ +TG N
Sbjct:    2 FYTCGPNEAMVVSGFCRSPPVMISGGRVFVFPCVQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQMKIQGQNKQMLAAACQMFLGKSDSEIAHIALETLEGHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLVNMGISVVSYTLKDVHDDQDYLHSLGKARTAQVQKDARIGEAKNKRDAVIREAHAMQEKVSAQYMNEIEMAKAQRDYELKKAIYDIEVFTKKAESEMAYQLQVAKTKQRIEEEKMQVLVVERSQQITLQEQEISRKEKELEAKVKKPAEAERYRLEKLAEAERLQLIMEAEAEAESIRVRGEAEAYAVEAKGRAEAEQMAKKAEAFQHYKEGAMVDMLLEKLPMMADEISKPLSATNKVTMVSSGGSEIGAAKLTGEVLDIMTKLPETIEKLTGVN 415          
BLAST of Flotillin-1 vs. Ensembl Zebrafish
Match: flot1a (flotillin 1a [Source:ZFIN;Acc:ZDB-GENE-020430-1])

HSP 1 Score: 462.996 bits (1190), Expect = 2.435e-161
Identity = 240/414 (57.97%), Postives = 324/414 (78.26%), Query Frame = 3
Query:   33 FIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            F  CGPNEAMVVSG     PVMISGGR FV+P + ++Q+ISLNT+TL + S ++YT+ GVP++VTG+AQ+KI G +K MLA AC+ FLGK++ EI  IA ETLE HQRAI+ ++TVEEIYKDRKKFS  VF+VASSD++NMGISVVSYTLKD+ DD+ YL +LG+ARTAQV++DARIGEA+ K+D+ I+EA A Q K +AQ  N++E+AK+ RDYELKKA ++ EV TK+AES+ +Y +Q AKT+Q I+EE MQ+ V+ER ++I ++  EI R++K LEA V+K A+AE+YRLEKL EAE  ++  EAEAEAE I+++G AEA A+  K  A+A QM  KAEA+Q Y+E A ++M L+ LP +A E++ P+S  +K++M+ +G  EIGA+KLT E+L+IM KLP  I+ +TG N
Sbjct:    2 FYTCGPNEAMVVSGFCRSPPVMISGGRVFVFPCVQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQMKIQGQNKQMLAAACQMFLGKSDSEIAHIALETLEGHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLVNMGISVVSYTLKDVHDDQDYLHSLGKARTAQVQKDARIGEAKNKRDAVIREAHAMQEKVSAQYMNEIEMAKAQRDYELKKAIYDIEVFTKKAESEMAYQLQVAKTKQRIEEEKMQVLVVERSQQITLQEQEISRKEKELEAKVKKPAEAERYRLEKLAEAERLQLIMEAEAEAESIRVRGEAEAYAVEAKGRAEAEQMAKKAEAFQHYKEGAMVDMLLEKLPMMADEISKPLSATNKVTMVSSGGSEIGAAKLTGEVLDIMTKLPETIEKLTGVN 415          
BLAST of Flotillin-1 vs. Ensembl Zebrafish
Match: flot1b (flotillin 1b [Source:ZFIN;Acc:ZDB-GENE-020430-2])

HSP 1 Score: 458.759 bits (1179), Expect = 8.253e-160
Identity = 233/414 (56.28%), Postives = 324/414 (78.26%), Query Frame = 3
Query:   33 FIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            F  CGPNEAMVVSGC    P+MI+GGR FV P I ++Q+I+LNT+TL + S ++YT+ GVP++VTG+AQ+KI G +K MLA AC+ F+GK+E EI +IA ETLE HQRAI+ ++TVEEIY+DRKKFS  VF+VASSD++NMGI VVSYTLKD+ DD+ YL +LG+ARTAQV+RDARIGEA+ K+D+ I+EA A Q K +AQ  N++E+AK+ RD+ELKKA ++ EV TK+AES+ +Y +Q AKT+Q I+EE MQ++V+ER ++I ++  EI R++K LEA +RK A+AE+YR+EKL EAE  ++  EAEAEAE I++KG AEA A+  K  A+A QM  KAEA++ Y+E A ++M L+ LP +A E++ P+    K++M+ +G  E+GA+KLT E+L+IM +LPG ++ +TG N
Sbjct:    2 FYTCGPNEAMVVSGCGRAPPLMIAGGRVFVIPCIQQIQRITLNTLTLNVKSDKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFMGKSEGEIANIALETLEGHQRAIIAHLTVEEIYQDRKKFSEQVFKVASSDLVNMGIGVVSYTLKDVHDDQDYLSSLGKARTAQVQRDARIGEAQFKRDAVIREAHAMQEKVSAQYKNEIEMAKAQRDFELKKAAYDVEVNTKKAESEMAYQLQVAKTKQRIEEEKMQVQVVERTQQIMLQEQEITRREKELEAKIRKPAEAERYRIEKLAEAERLQLIMEAEAEAESIRMKGEAEAFALEAKGRAEAEQMAKKAEAFKGYKEGAMVDMLLEKLPLMAEEISKPLCAAQKVTMVSSGGSEVGAAKLTGEVLDIMTRLPGAVEKLTGVN 415          
BLAST of Flotillin-1 vs. Ensembl Zebrafish
Match: flot2a (flotillin 2a [Source:NCBI gene;Acc:245698])

HSP 1 Score: 306.99 bits (785), Expect = 2.431e-100
Identity = 183/412 (44.42%), Postives = 279/412 (67.72%), Query Frame = 3
Query:   45 GPNEAMVVSG--CFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            GPNEA+VVSG  C         GG  + W +I  +QKI+L  MTL      + T  GV +TVTGVAQ+K+  +D  +L  ACEQFLGKT  EI+ +  +TLE H R+I+G +TVE+IY+DR +F+  V EVA+ D+  MGI ++S+T+KD+ D   YL +LG+++TA V+RDA IG AEA++D+GI+EA  ++     +   D ++A S R+ E++KA F +EV TK+AE+  +Y++QAAK QQ I+ E ++I+V++R ++I +E  EILR DK L ATVR+ A+AE +++E+L EA+  +    A+AEAEKIK  G AEA +I    +A+A +M LKAEA+Q+Y EAA+  + L+ LP++A +VAAP+   ++I +I +G G     ++T E+  ++ +LP  + ++TG +
Sbjct:    8 GPNEALVVSGGCCGSDGKTYTVGGWAWAWWLITDIQKITLEIMTLQPKCEDVETAEGVAITVTGVAQVKVM-TDNELLGYACEQFLGKTVTEIKSVILQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKSQTAAVQRDADIGVAEAERDAGIREAECKKEMMDIKFQADTKMADSKRELEMQKAAFNQEVNTKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQISIEEKEILRTDKELIATVRRPAEAEAFKMEQLAEAKKIKKVLTAQAEAEKIKRIGEAEAGSIEAVGKAEAEKMRLKAEAYQQYGEAAKTALVLEALPKIAGKVAAPLGRTNEI-VILSGDG----GRVTGEVNRLLAELPVSVNALTGVD 413          
BLAST of Flotillin-1 vs. Ensembl Zebrafish
Match: flot2b (flotillin 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1368])

HSP 1 Score: 293.508 bits (750), Expect = 5.356e-95
Identity = 182/415 (43.86%), Postives = 280/415 (67.47%), Query Frame = 3
Query:   36 IVCGPNEAMVVSG--CFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            +  GPNEA+VVSG  C       + GG  + W +I   Q+I+L  MTL      + T  GV +TVTGVAQ+K+  +DK +LA ACEQFLGK+  EI+ +  +TLE H R+I+G +TVE+IY+DR +F+  V EVA+ D+  MGI ++S+T+KD+ D   YL +LG+ +TA V+RDA IG AEA++D+GI+EA  ++     +   D ++A S R+ EL+KA F +EV TK+AES  +Y++QAAK QQ I+ E ++I+V++R ++I +E  EI R +K L ATV++ A+AE Y++E+L E    +    A+AEAEKI+  G AEA +I    +A+A +M LKAEA+Q+Y EAA+  + LD LP++A +V+AP++  ++I +I +G G    S++T E+  ++ +LP  + ++TG +
Sbjct:    5 LTVGPNEALVVSGACCGSDAKTYVVGGWAWAWWLISDTQRITLEIMTLQPKCEDVETAEGVAITVTGVAQVKVM-TDKDLLAIACEQFLGKSVMEIKAVVLQTLEGHLRSILGTLTVEQIYQDRDQFARLVREVAAPDVGRMGIEILSFTIKDVYDKLDYLSSLGKTQTAAVQRDADIGVAEAERDAGIREAECKKEMMDVKFLADTKMADSKRELELQKAAFNQEVNTKKAESQLAYELQAAKEQQKIRLEEIEIEVVQRKKQISIEEREIERTEKELIATVKRPAEAEAYKMEQLAEGYKMQKVLTAQAEAEKIRKIGEAEAISISSVGKAEAERMRLKAEAYQQYGEAAKTALVLDALPKIAGKVSAPLARTNEI-VILSGDG----SRVTGEVNRLLAELPVSVNALTGVD 413          
BLAST of Flotillin-1 vs. Ensembl Xenopus
Match: flot1 (flotillin 1 [Source:NCBI gene;Acc:733927])

HSP 1 Score: 457.988 bits (1177), Expect = 1.986e-159
Identity = 235/405 (58.02%), Postives = 321/405 (79.26%), Query Frame = 3
Query:   63 VVSGCFFRKP-VMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            V S CF R P VMI+GGR FV P + ++Q+ISLNT+TL + S ++YT+ GVP++VTG+AQ+KI G +K MLA AC+ FLGKTE+E+  I+ ETLE HQRAIM +MTVEEIYKDR+KFS  VF+VASSD++NMGISVVSYTLKDI DD+ YL +LG+ARTAQV++DARIGEA AKKD+GIKEA A Q K +AQ  N++E+AK+ RD+ELKKA ++ EV T++AESD +Y +Q AKT+Q I+E+ +Q++V+ER ++I+++  EI R++K LEA ++K A+AE+YRLEKL EAE  ++  EAEAEAE I++KG A A A+ +KA ADA QM  KAEA+QEYQ+AA ++M L+ LP++A  ++ PM+   KI MI +G  E+GASK+T E+L+I+ +LP  ++ +TG N
Sbjct:    2 VFSLCFCRSPPVMIAGGRVFVLPCVQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTENEVAQISLETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAVAKKDAGIKEAQAMQEKVSAQYVNEIEMAKAQRDFELKKAAYDLEVNTRKAESDLAYQLQVAKTKQKIEEQKVQVQVVERAQQIQLQDQEISRKEKELEAKIKKPAEAERYRLEKLAEAERMKLITEAEAEAEAIRVKGEALAYAVEVKARADAEQMAKKAEAFQEYQDAAIVDMLLEKLPEVAEAISKPMTEVKKIKMISSGGSEVGASKITGEVLDILNRLPDTVEKLTGIN 406          
BLAST of Flotillin-1 vs. Ensembl Xenopus
Match: flot1 (flotillin 1 [Source:NCBI gene;Acc:733927])

HSP 1 Score: 455.677 bits (1171), Expect = 1.869e-158
Identity = 234/404 (57.92%), Postives = 320/404 (79.21%), Query Frame = 3
Query:   66 VSGCFFRKP-VMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            V  CF R P VMI+GGR FV P + ++Q+ISLNT+TL + S ++YT+ GVP++VTG+AQ+KI G +K MLA AC+ FLGKTE+E+  I+ ETLE HQRAIM +MTVEEIYKDR+KFS  VF+VASSD++NMGISVVSYTLKDI DD+ YL +LG+ARTAQV++DARIGEA AKKD+GIKEA A Q K +AQ  N++E+AK+ RD+ELKKA ++ EV T++AESD +Y +Q AKT+Q I+E+ +Q++V+ER ++I+++  EI R++K LEA ++K A+AE+YRLEKL EAE  ++  EAEAEAE I++KG A A A+ +KA ADA QM  KAEA+QEYQ+AA ++M L+ LP++A  ++ PM+   KI MI +G  E+GASK+T E+L+I+ +LP  ++ +TG N
Sbjct:    2 VYKCFCRSPPVMIAGGRVFVLPCVQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTENEVAQISLETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAVAKKDAGIKEAQAMQEKVSAQYVNEIEMAKAQRDFELKKAAYDLEVNTRKAESDLAYQLQVAKTKQKIEEQKVQVQVVERAQQIQLQDQEISRKEKELEAKIKKPAEAERYRLEKLAEAERMKLITEAEAEAEAIRVKGEALAYAVEVKARADAEQMAKKAEAFQEYQDAAIVDMLLEKLPEVAEAISKPMTEVKKIKMISSGGSEVGASKITGEVLDILNRLPDTVEKLTGIN 405          
BLAST of Flotillin-1 vs. Ensembl Xenopus
Match: flot1 (flotillin 1 [Source:NCBI gene;Acc:733927])

HSP 1 Score: 453.366 bits (1165), Expect = 2.030e-157
Identity = 232/402 (57.71%), Postives = 318/402 (79.10%), Query Frame = 3
Query:   69 SGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            SG     PVMI+GGR FV P + ++Q+ISLNT+TL + S ++YT+ GVP++VTG+AQ+KI G +K MLA AC+ FLGKTE+E+  I+ ETLE HQRAIM +MTVEEIYKDR+KFS  VF+VASSD++NMGISVVSYTLKDI DD+ YL +LG+ARTAQV++DARIGEA AKKD+GIKEA A Q K +AQ  N++E+AK+ RD+ELKKA ++ EV T++AESD +Y +Q AKT+Q I+E+ +Q++V+ER ++I+++  EI R++K LEA ++K A+AE+YRLEKL EAE  ++  EAEAEAE I++KG A A A+ +KA ADA QM  KAEA+QEYQ+AA ++M L+ LP++A  ++ PM+   KI MI +G  E+GASK+T E+L+I+ +LP  ++ +TG N
Sbjct:   18 SGFCRSPPVMIAGGRVFVLPCVQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTENEVAQISLETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAVAKKDAGIKEAQAMQEKVSAQYVNEIEMAKAQRDFELKKAAYDLEVNTRKAESDLAYQLQVAKTKQKIEEQKVQVQVVERAQQIQLQDQEISRKEKELEAKIKKPAEAERYRLEKLAEAERMKLITEAEAEAEAIRVKGEALAYAVEVKARADAEQMAKKAEAFQEYQDAAIVDMLLEKLPEVAEAISKPMTEVKKIKMISSGGSEVGASKITGEVLDILNRLPDTVEKLTGIN 419          
BLAST of Flotillin-1 vs. Ensembl Xenopus
Match: flot1 (flotillin 1 [Source:NCBI gene;Acc:733927])

HSP 1 Score: 452.981 bits (1164), Expect = 2.777e-157
Identity = 232/402 (57.71%), Postives = 318/402 (79.10%), Query Frame = 3
Query:   69 SGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            SG     PVMI+GGR FV P + ++Q+ISLNT+TL + S ++YT+ GVP++VTG+AQ+KI G +K MLA AC+ FLGKTE+E+  I+ ETLE HQRAIM +MTVEEIYKDR+KFS  VF+VASSD++NMGISVVSYTLKDI DD+ YL +LG+ARTAQV++DARIGEA AKKD+GIKEA A Q K +AQ  N++E+AK+ RD+ELKKA ++ EV T++AESD +Y +Q AKT+Q I+E+ +Q++V+ER ++I+++  EI R++K LEA ++K A+AE+YRLEKL EAE  ++  EAEAEAE I++KG A A A+ +KA ADA QM  KAEA+QEYQ+AA ++M L+ LP++A  ++ PM+   KI MI +G  E+GASK+T E+L+I+ +LP  ++ +TG N
Sbjct:   18 SGFCRSPPVMIAGGRVFVLPCVQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTENEVAQISLETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAVAKKDAGIKEAQAMQEKVSAQYVNEIEMAKAQRDFELKKAAYDLEVNTRKAESDLAYQLQVAKTKQKIEEQKVQVQVVERAQQIQLQDQEISRKEKELEAKIKKPAEAERYRLEKLAEAERMKLITEAEAEAEAIRVKGEALAYAVEVKARADAEQMAKKAEAFQEYQDAAIVDMLLEKLPEVAEAISKPMTEVKKIKMISSGGSEVGASKITGEVLDILNRLPDTVEKLTGIN 419          
BLAST of Flotillin-1 vs. Ensembl Xenopus
Match: flot1 (flotillin 1 [Source:NCBI gene;Acc:733927])

HSP 1 Score: 450.669 bits (1158), Expect = 2.881e-156
Identity = 232/402 (57.71%), Postives = 318/402 (79.10%), Query Frame = 3
Query:   69 SGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            SG     PVMI+GGR FV P + ++Q+ISLNT+TL + S ++YT+ GVP++VTG+AQ+KI G +K MLA AC+ FLGKTE+E+  I+ ETLE HQRAIM +MTVEEIYKDR+KFS  VF+VASSD++NMGISVVSYTLKDI DD+ YL +LG+ARTAQV++DARIGEA AKKD+GIKEA A Q K +AQ  N++E+AK+ RD+ELKKA ++ EV T++AESD +Y +Q AKT+Q I+E+ +Q++V+ER ++I+++  EI R++K LEA ++K A+AE+YRLEKL EAE  ++  EAEAEAE I++KG A A A+ +KA ADA QM  KAEA+QEYQ+AA ++M L+ LP++A  ++ PM+   KI MI +G  E+GASK+T E+L+I+ +LP  ++ +TG N
Sbjct:   18 SGFCRSPPVMIAGGRVFVLPCVQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTENEVAQISLETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAVAKKDAGIKEAQAMQEKVSAQYVNEIEMAKAQRDFELKKAAYDLEVNTRKAESDLAYQLQVAKTKQKIEEQKVQVQVVERAQQIQLQDQEISRKEKELEAKIKKPAEAERYRLEKLAEAERMKLITEAEAEAEAIRVKGEALAYAVEVKARADAEQMAKKAEAFQEYQDAAIVDMLLEKLPEVAEAISKPMTEVKKIKMISSGGSEVGASKITGEVLDILNRLPDTVEKLTGIN 419          
BLAST of Flotillin-1 vs. Ensembl Mouse
Match: Flot1 (flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500])

HSP 1 Score: 483.026 bits (1242), Expect = 2.503e-169
Identity = 240/414 (57.97%), Postives = 334/414 (80.68%), Query Frame = 3
Query:   33 FIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            F  CGPNEAMVVSG     PVM++GGR FV P I ++Q+ISLNT+TL + S ++YT+ GVP++VTG+AQ+KI G +K MLA AC+ FLGKTE EI  IA ETLE HQRAIM +MTVEEIYKDR+KFS  VF+VASSD++NMGISVVSYTLKDI DD+ YL +LG+ARTAQV++DARIGEAEAK+D+GI+EA A+Q K +AQC +++E+AK+ RDYELKKA ++ EV T+RA++D +Y +Q AKT+Q I+E+ +Q++V+ER +++ V+  EI R++K LEA VRK A+AE+YRLE+L EAE  ++  +AEAEAE ++++G AEA AI  +A A+A QM  KAEA+Q YQEAA+L+M L+ LPQ+A E++ P+++ +KI+++ +GSG +GA+K+T E+L+I+ +LP  ++ +TG +
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQCLSEIEMAKAQRDYELKKATYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYRLERLAEAEKAQLIMQAEAEAESVRMRGEAEAFAIGARARAEAEQMAKKAEAFQMYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILSRLPESVERLTGVS 415          
BLAST of Flotillin-1 vs. Ensembl Mouse
Match: Flot1 (flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500])

HSP 1 Score: 395.201 bits (1014), Expect = 2.053e-135
Identity = 207/414 (50.00%), Postives = 297/414 (71.74%), Query Frame = 3
Query:   33 FIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            F  CGPNEAMVVSG     PVM++GGR FV P I ++Q+ISLNT+TL + S ++YT+ GVP++VTG+AQ                                                EIYKDR+KFS  VF+VASSD++NMGISVVSYTLKDI DD+ YL +LG+ARTAQV++DARIGEAEAK+D+GI+EA A+Q K +AQC +++E+AK+ RDYELKKA ++ EV T+RA++D +Y +Q AKT+Q I+E+ +Q++V+ER +++ V+  EI R++K LEA VRK A+AE+YRLE+L EAE  ++  +AEAEAE ++++G AEA AI  +A A+A QM  KAEA+Q YQEAA+L+M L+ LPQ+A E++ P+++ +KI+++ +GSG +GA+K+T E+L+I+ +LP  ++ +TG +
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQ------------------------------------------------EIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQCLSEIEMAKAQRDYELKKATYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYRLERLAEAEKAQLIMQAEAEAESVRMRGEAEAFAIGARARAEAEQMAKKAEAFQMYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILSRLPESVERLTGVS 367          
BLAST of Flotillin-1 vs. Ensembl Mouse
Match: Flot2 (flotillin 2 [Source:MGI Symbol;Acc:MGI:103309])

HSP 1 Score: 311.227 bits (796), Expect = 7.921e-102
Identity = 181/412 (43.93%), Postives = 281/412 (68.20%), Query Frame = 3
Query:   45 GPNEAMVVSG--CFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            GPNEA+VVSG  C       + GG  + W  I   Q++SL  MT++     I T  GVP+ VTGVAQ+KI  ++K +LA ACEQFLGK   +I+++  +TLE H R+I+G +TVE+IY+DR +F+  V EVA+ D+  MGI ++S+T+KD+ D   YL +LG+ +TA V+RDA IG AEA++D+GI+EA  ++     +   D +IA S R +EL+K+ F +EV  K AE+  +Y++Q A+ QQ I++E ++I+V++R ++I VE  EILR DK L ATVR+ A+AE +R++++ E E  +    A+AEAEKI+  G AEA  I    +A+A +M LKAEA+Q+Y +AA++ + L+ LPQ+AA+++AP++  D+I ++   SG+   SK+TSE+  ++ +LP  + ++TG +
Sbjct:    8 GPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRLSLEVMTILCRCENIETSEGVPLFVTGVAQVKIM-TEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKISAPLTKVDEIVVL---SGD--NSKVTSEVNRLLAELPASVHALTGVD 413          
BLAST of Flotillin-1 vs. Ensembl Mouse
Match: Flot2 (flotillin 2 [Source:MGI Symbol;Acc:MGI:103309])

HSP 1 Score: 307.76 bits (787), Expect = 1.722e-100
Identity = 182/412 (44.17%), Postives = 280/412 (67.96%), Query Frame = 3
Query:   45 GPNEAMVVSG--CFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            GPNEA+VVSG  C       + GG  + W  I   Q+ISL  MTL      + T  GV +TVTGVAQ+KI  ++K +LA ACEQFLGK   +I+++  +TLE H R+I+G +TVE+IY+DR +F+  V EVA+ D+  MGI ++S+T+KD+ D   YL +LG+ +TA V+RDA IG AEA++D+GI+EA  ++     +   D +IA S R +EL+K+ F +EV  K AE+  +Y++Q A+ QQ I++E ++I+V++R ++I VE  EILR DK L ATVR+ A+AE +R++++ E E  +    A+AEAEKI+  G AEA  I    +A+A +M LKAEA+Q+Y +AA++ + L+ LPQ+AA+++AP++  D+I ++   SG+   SK+TSE+  ++ +LP  + ++TG +
Sbjct:    8 GPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIM-TEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKISAPLTKVDEIVVL---SGD--NSKVTSEVNRLLAELPASVHALTGVD 413          
BLAST of Flotillin-1 vs. Ensembl Mouse
Match: Flot1 (flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500])

HSP 1 Score: 285.804 bits (730), Expect = 3.374e-95
Identity = 133/195 (68.21%), Postives = 163/195 (83.59%), Query Frame = 3
Query:   33 FIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQ 617
            F  CGPNEAMVVSG     PVM++GGR FV P I ++Q+ISLNT+TL + S ++YT+ GVP++VTG+AQ+KI G +K MLA AC+ FLGKTE EI  IA ETLE HQRAIM +MTVEEIYKDR+KFS  VF+VASSD++NMGISVVSYTLKDI DD+ YL +LG+ARTAQV++DARIGEAEAK+D+GI+EA A+Q
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQ 196          
BLAST of Flotillin-1 vs. UniProt/SwissProt
Match: sp|O61491|FLOT1_DROME (Flotillin-1 OS=Drosophila melanogaster OX=7227 GN=Flo1 PE=2 SV=1)

HSP 1 Score: 506.908 bits (1304), Expect = 7.264e-178
Identity = 257/418 (61.48%), Postives = 346/418 (82.78%), Query Frame = 3
Query:   21 MVWGFIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            M WGF+ CGPNEA+VVSGC + KP+++ GGR FVWPV  ++Q+ISLNTMTL + SP +YT  GVP++VTG+AQ+K+ G ++ ML TACEQFLGK+E EI  IA  TLE HQRAIMG+MTVEEIYKDRKKFS  VFEVASSD+ NMGI+VVSYT+KD++D+EGYL++LG ARTA+VKRDARIGEAEA+ ++ IKEA+AE+ + AA+  ND +IAK+ RD+ELKKA ++ EVQTK+AE++ +Y++QAAKT+Q IKEE MQ+KVIER ++I V+  EI+R+++ LEAT+R+ A+AEK+R+EKL EA   R+  EAEAEAE I+++G AEA AI  KA+A+A QM +KAEA++EY+EAA + M LD LP++AAEVAAP+S   KI+M+ +G+G+IGA+KLT E+L I+ K+P ++++ITG +
Sbjct:    1 MTWGFVTCGPNEALVVSGCCYMKPLLVPGGRAFVWPVGQQVQRISLNTMTLQVESPCVYTSQGVPISVTGIAQVKVQGQNEDMLLTACEQFLGKSEAEINHIALVTLEGHQRAIMGSMTVEEIYKDRKKFSKQVFEVASSDLANMGITVVSYTIKDLRDEEGYLRSLGMARTAEVKRDARIGEAEARAEAHIKEAIAEEQRMAARFLNDTDIAKAQRDFELKKAAYDVEVQTKKAEAEMAYELQAAKTKQRIKEEQMQVKVIERTQEIAVQEQEIMRRERELEATIRRPAEAEKFRMEKLAEANKQRVVMEAEAEAESIRIRGEAEAFAIAAKAKAEAEQMAMKAEAYREYREAAMVEMLLDTLPKVAAEVAAPLSQAKKITMVSSGTGDIGAAKLTGEVLSIVNKVPELVKNITGVD 418          
BLAST of Flotillin-1 vs. UniProt/SwissProt
Match: sp|O08917|FLOT1_MOUSE (Flotillin-1 OS=Mus musculus OX=10090 GN=Flot1 PE=1 SV=1)

HSP 1 Score: 483.026 bits (1242), Expect = 1.751e-168
Identity = 240/414 (57.97%), Postives = 334/414 (80.68%), Query Frame = 3
Query:   33 FIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            F  CGPNEAMVVSG     PVM++GGR FV P I ++Q+ISLNT+TL + S ++YT+ GVP++VTG+AQ+KI G +K MLA AC+ FLGKTE EI  IA ETLE HQRAIM +MTVEEIYKDR+KFS  VF+VASSD++NMGISVVSYTLKDI DD+ YL +LG+ARTAQV++DARIGEAEAK+D+GI+EA A+Q K +AQC +++E+AK+ RDYELKKA ++ EV T+RA++D +Y +Q AKT+Q I+E+ +Q++V+ER +++ V+  EI R++K LEA VRK A+AE+YRLE+L EAE  ++  +AEAEAE ++++G AEA AI  +A A+A QM  KAEA+Q YQEAA+L+M L+ LPQ+A E++ P+++ +KI+++ +GSG +GA+K+T E+L+I+ +LP  ++ +TG +
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQCLSEIEMAKAQRDYELKKATYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYRLERLAEAEKAQLIMQAEAEAESVRMRGEAEAFAIGARARAEAEQMAKKAEAFQMYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILSRLPESVERLTGVS 415          
BLAST of Flotillin-1 vs. UniProt/SwissProt
Match: sp|Q9Z1E1|FLOT1_RAT (Flotillin-1 OS=Rattus norvegicus OX=10116 GN=Flot1 PE=2 SV=2)

HSP 1 Score: 482.641 bits (1241), Expect = 2.739e-168
Identity = 239/414 (57.73%), Postives = 334/414 (80.68%), Query Frame = 3
Query:   33 FIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            F  CGPNEAMVVSG     PVM++GGR FV P I ++Q+ISLNT+TL + S ++YT+ GVP++VTG+AQ+KI G +K MLA AC+ FLGKTE EI  IA ETLE HQRAIM +MTVEEIYKDR+KFS  VF+VASSD++NMGISVVSYTLKDI DD+ YL +LG+ARTAQV++DARIGEAEAK+D+GI+EA A+Q K +AQC +++E+AK+ RDYELKKA ++ EV T+RA++D +Y +Q AKT+Q I+E+ +Q++V+ER +++ V+  EI R++K LEA VRK A+AE+YRLE+L EAE  ++  +AEAEAE ++++G AEA A+  +A A+A QM  KAEA+Q YQEAA+L+M L+ LPQ+A E++ P+++ +KI+++ +GSG +GA+K+T E+L+I+ +LP  ++ +TG +
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQCLSEIEMAKAQRDYELKKATYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYRLERLAEAEKAQLIMQAEAEAESVRMRGEAEAFAVGARARAEAEQMAKKAEAFQMYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILSRLPESVERLTGVS 415          
BLAST of Flotillin-1 vs. UniProt/SwissProt
Match: sp|O75955|FLOT1_HUMAN (Flotillin-1 OS=Homo sapiens OX=9606 GN=FLOT1 PE=1 SV=3)

HSP 1 Score: 477.633 bits (1228), Expect = 2.426e-166
Identity = 237/414 (57.25%), Postives = 333/414 (80.43%), Query Frame = 3
Query:   33 FIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            F  CGPNEAMVVSG     PVM++GGR FV P I ++Q+ISLNT+TL + S ++YT+ GVP++VTG+AQ+KI G +K MLA AC+ FLGKTE EI  IA ETLE HQRAIM +MTVEEIYKDR+KFS  VF+VASSD++NMGISVVSYTLKDI DD+ YL +LG+ARTAQV++DARIGEAEAK+D+GI+EA A+Q K +AQ  +++E+AK+ RDYELKKA ++ EV T+RA++D +Y +Q AKT+Q I+E+ +Q++V+ER +++ V+  EI R++K LEA VRK A+AE+Y+LE+L EAE +++  +AEAEA  ++++G AEA AI  +A A+A QM  KAEA+Q YQEAA+L+M L+ LPQ+A E++ P+++ +KI+++ +GSG +GA+K+T E+L+I+ +LP  ++ +TG +
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVS 415          
BLAST of Flotillin-1 vs. UniProt/SwissProt
Match: sp|Q08DN8|FLOT1_BOVIN (Flotillin-1 OS=Bos taurus OX=9913 GN=FLOT1 PE=2 SV=1)

HSP 1 Score: 477.633 bits (1228), Expect = 2.591e-166
Identity = 238/414 (57.49%), Postives = 334/414 (80.68%), Query Frame = 3
Query:   33 FIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            F  CGPNEAMVVSG     PVM++GGR FV P I ++Q+ISLNT+TL + S ++YT+ GVP++VTG+AQ+KI G +K MLA AC+ FLGKTE EI  IA ETLE HQRAIM +MTVEEIYKDR+KFS  VF+VASSD++NMGISVVSYTLKDI DD+ YL +LG+ARTAQV++DARIGEAEAK+D+GI+EA A+Q K +AQ  +++E+AK+ RDYELKKA ++ EV T+RA++D +Y +Q AKT+Q I+E+ +Q++V+ER +++ V+  EI R++K LEA VRK A+AE+Y+LE+L EAE +++  +AEAEAE ++++G AEA AI  +A A+A QM  KAEA+Q YQEAA+L+M L+ LPQ+A E++ P+++ +KI+++ +GSG +GA+K+T E+L+I+ +LP  ++ +TG +
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAEAVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGAMGAAKVTGEVLDILSRLPESVERLTGVS 415          
BLAST of Flotillin-1 vs. TrEMBL
Match: A0A3Q0KCQ0 (Putative flotillin-1 OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 271/418 (64.83%), Postives = 352/418 (84.21%), Query Frame = 3
Query:   21 MVWGFIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            M WGF  CGPNEAMVVSGCF + P+++ GGR FVWP I +++++ LNTMTLII SPRIYTQLGVP+TVTGVAQ+KINGS++ MLA ACEQFLGK+E+EIR+IA+ETLE HQRAIMGNMTVEEIYKDRKKFS +VFEVASSD++NMGISVVSYTLKDI+DDEGYL++LG ARTAQVK DARIGEAEA++D+GI+EA AE+ + A +  ND+EI+KS RD+EL+ A +EKEVQ+++AES+ +Y++QAAK +Q IKEE MQI V+E+ ++I+VE LEILRQ+++L+ATVRK A+AE++RLE+L EA+  R+  EAEAEAE I+L+G AEA A+   A A+A QM  KAEAW+ YQ  A+L+M L  LP++AAE+++P++ CDK++MICTG G+IG +KLT E+  IM  LP +I ++TG +
Sbjct:    1 MGWGFNTCGPNEAMVVSGCFHKSPLLVPGGRVFVWPGIQRVERMPLNTMTLIIESPRIYTQLGVPITVTGVAQVKINGSNQEMLAAACEQFLGKSENEIREIAQETLEGHQRAIMGNMTVEEIYKDRKKFSKAVFEVASSDLVNMGISVVSYTLKDIKDDEGYLRSLGLARTAQVKCDARIGEAEARRDAGIREAEAEKQRVAGKLLNDIEISKSKRDFELQNAAYEKEVQSRKAESELAYELQAAKVKQQIKEEEMQITVLEKTQQIQVEELEILRQERHLDATVRKPAEAERFRLERLAEADRLRLTAEAEAEAEAIRLRGLAEAEALKAIAHAEAEQMAKKAEAWKNYQNVAKLDMVLQSLPKIAAEISSPLTKCDKVTMICTGEGDIGVAKLTGELFTIMNSLPHLIHTMTGLD 418          
BLAST of Flotillin-1 vs. TrEMBL
Match: C1LLP3 (Flotillin 1 OS=Schistosoma japonicum OX=6182 GN=Flot1 PE=2 SV=1)

HSP 1 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 269/418 (64.35%), Postives = 351/418 (83.97%), Query Frame = 3
Query:   21 MVWGFIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            M WGF  CGPNEAMVVSGCF + P+++ GGR FVWP I +++++ LNTMTLII SPRIYTQLGVP+TVTGVAQ+KINGS++ MLA ACEQFLGK+E+EIR+IA+ETLE HQRAIMGNMTVEEIYKDRKKFS +VFEVASSD++NMGISVVSYTLKDI+DDEGYL++LG ARTAQVK DARIGEAEA++D+GI+EA AE+ + A +  ND+EI+KS RD+EL+ A +EKEVQ ++AES+ +Y++QAAK +Q IKEE MQI V+E+ ++I+VE LEI+RQ+++L+AT+RK A+AE++RLE+L EA+  R+  EAEAEAE I+L+G AEA A+   A A+A QM  KAEAW+ YQ  A+L+M L  LP++AAE+++P++ CDK++M+CTG G+IG +KLT E+  IM  LP +I S+TG +
Sbjct:    1 MGWGFNTCGPNEAMVVSGCFHKTPLLVPGGRVFVWPGIQRIERMPLNTMTLIIESPRIYTQLGVPITVTGVAQVKINGSNQEMLAAACEQFLGKSENEIREIAQETLEGHQRAIMGNMTVEEIYKDRKKFSKAVFEVASSDLVNMGISVVSYTLKDIKDDEGYLRSLGLARTAQVKCDARIGEAEARRDAGIREAEAEKQRVAGKLLNDIEISKSKRDFELQNAAYEKEVQARKAESELAYELQAAKVKQQIKEEEMQITVLEKTQQIQVEELEIVRQERHLDATIRKPAEAERFRLERLAEADRLRLIAEAEAEAESIRLRGLAEAEALKAIAHAEAEQMTKKAEAWKTYQNVAKLDMVLQTLPKIAAEISSPLTKCDKVTMVCTGDGDIGVAKLTGELFTIMNSLPQLIHSMTGLD 418          
BLAST of Flotillin-1 vs. TrEMBL
Match: A0A267H6Y3 (PHB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005361g1 PE=3 SV=1)

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 275/418 (65.79%), Postives = 355/418 (84.93%), Query Frame = 3
Query:   21 MVWGFIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTG--SGEIGASKLTSEILEIMEKLPGVIQSITG 1268
            MV+GF  CGPNEA+V+SGCF   P  I GGRKFV+PVI ++Q+I LNTMT+ I SPRIYTQLGVP+TVTGVAQ++I G ++ MLA ACEQFL K+E +I++IAKETLEAHQRAIMGNMTVEEIYKDRKKFS +VFEVASSD++NMGISVVSYTLKDI DDEGYLKALG ARTAQVKRDARIGEAEA+K+SGIKEA+A Q + A++  N+V+IAK+ RD+ELKKA F+KEVQ K+AESD +Y++QAAKT+Q IKEE MQIKV+ER ++I V+ LEI+R+++ L+A+VRK A+AE+YRLE++ EAE ++I  EA+A+AE ++LKG AEA AI  +A+A A QM  KA+AW+EY EAARL++ L  LP+LAAEVA P+++  KI+M+ +G  + E+GA+K+T E+++IME+LP ++QS+TG
Sbjct:    1 MVFGFHTCGPNEALVISGCFHTTPTFIPGGRKFVFPVIQQVQRIMLNTMTITIESPRIYTQLGVPITVTGVAQLRIKGQNRDMLAAACEQFLSKSEQQIQEIAKETLEAHQRAIMGNMTVEEIYKDRKKFSKAVFEVASSDLVNMGISVVSYTLKDINDDEGYLKALGLARTAQVKRDARIGEAEAQKESGIKEAIAVQTRMASRYENEVQIAKAQRDFELKKAAFDKEVQAKKAESDLAYELQAAKTRQLIKEEEMQIKVVERTQQISVQELEIVRRERQLDASVRKPAEAERYRLERIAEAENSKIILEAQADAETVQLKGEAEAFAIEARAKATAEQMAKKADAWKEYGEAARLDLVLKALPKLAAEVAQPLASATKITMVSSGGRNAELGAAKITGEVMDIMERLPAMLQSMTG 418          
BLAST of Flotillin-1 vs. TrEMBL
Match: A0A4S2LBB7 (PHB domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008415 PE=3 SV=1)

HSP 1 Score: 550.436 bits (1417), Expect = 0.000e+0
Identity = 279/418 (66.75%), Postives = 354/418 (84.69%), Query Frame = 3
Query:   21 MVWGFIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            M WGF  CGPNEAMVVSGC  RKPV + GGRKF+WP + +++++ LNTMTLII SPRIYT+LGVP+TVTGVAQ+K+NG+++ MLA ACEQFLGKT  EIRDIAKETLE HQRAIMGNMTVEEIY+DRKKFS +VFEVASSD++NMGISVVSYTLKDI+DDEGYL++LG ARTAQVKRDARIGEAEA++D+GI+EA AEQ + A +  NDVEIAK+ RD+EL+ A +EKEVQ ++AES+ +Y++QAAKT+Q IKEE MQI V+ER ++I+VE LE +RQ+++L+ATVRK A+AE++RLE+L EAE  R+  EAEAEAE I+LKG AEA A+   A+A+A QM  KAEAWQ Y+ AA+L+M L+ LP++AAEV+AP+S C +++M+ TG GEIG SKLT E+L +M +LP V+QS+TG +
Sbjct:    1 MGWGFNTCGPNEAMVVSGCGLRKPVHVIGGRKFIWPCLQRVERMPLNTMTLIIESPRIYTKLGVPITVTGVAQVKVNGANQEMLAAACEQFLGKTVAEIRDIAKETLEGHQRAIMGNMTVEEIYQDRKKFSKAVFEVASSDLVNMGISVVSYTLKDIKDDEGYLESLGLARTAQVKRDARIGEAEARRDAGIREAEAEQKRVAGRLLNDVEIAKAKRDFELQNAGYEKEVQARKAESEMAYELQAAKTRQKIKEEEMQIAVLERTQQIQVEELENVRQERHLDATVRKPAEAERFRLERLAEAERMRLTAEAEAEAESIRLKGLAEAEALEAVAKAEAEQMMKKAEAWQAYKGAAKLDMVLEALPKIAAEVSAPLSECGRVTMVSTGDGEIGISKLTGEVLTLMARLPQVVQSMTGID 418          
BLAST of Flotillin-1 vs. TrEMBL
Match: A0A4S2LDF3 (PHB domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008415 PE=3 SV=1)

HSP 1 Score: 550.436 bits (1417), Expect = 0.000e+0
Identity = 278/418 (66.51%), Postives = 354/418 (84.69%), Query Frame = 3
Query:   21 MVWGFIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            M WGF  CGPNEAMVVSGC+ R+P+++ GGR FVWP I ++ ++ LNTMTLII SPRIYT+LGVP+TVTGVAQ+K+NG+++ MLA ACEQFLGKT  EIRDIAKETLE HQRAIMGNMTVEEIY+DRKKFS +VFEVASSD++NMGISVVSYTLKDI+DDEGYL++LG ARTAQVKRDARIGEAEA++D+GI+EA AEQ + A +  NDVEIAK+ RD+EL+ A +EKEVQ ++AES+ +Y++QAAKT+Q IKEE MQI V+ER ++I+VE LE +RQ+++L+ATVRK A+AE++RLE+L EAE  R+  EAEAEAE I+LKG AEA A+   A+A+A QM  KAEAWQ Y+ AA+L+M L+ LP++AAEV+AP+S C +++M+ TG GEIG SKLT E+L +M +LP V+QS+TG +
Sbjct:    1 MGWGFNTCGPNEAMVVSGCYHRRPLLVPGGRVFVWPGIQRIDRMPLNTMTLIIESPRIYTKLGVPITVTGVAQVKVNGANQEMLAAACEQFLGKTVAEIRDIAKETLEGHQRAIMGNMTVEEIYQDRKKFSKAVFEVASSDLVNMGISVVSYTLKDIKDDEGYLESLGLARTAQVKRDARIGEAEARRDAGIREAEAEQKRVAGRLLNDVEIAKAKRDFELQNAGYEKEVQARKAESEMAYELQAAKTRQKIKEEEMQIAVLERTQQIQVEELENVRQERHLDATVRKPAEAERFRLERLAEAERMRLTAEAEAEAESIRLKGLAEAEALEAVAKAEAEQMMKKAEAWQAYKGAAKLDMVLEALPKIAAEVSAPLSECGRVTMVSTGDGEIGISKLTGEVLTLMARLPQVVQSMTGID 418          
BLAST of Flotillin-1 vs. Ensembl Cavefish
Match: flot1b (flotillin-1-like [Source:NCBI gene;Acc:103034507])

HSP 1 Score: 473.011 bits (1216), Expect = 1.773e-165
Identity = 242/414 (58.45%), Postives = 325/414 (78.50%), Query Frame = 3
Query:   33 FIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            F  CGPNEAMVVSGC    P+MISGGR FV P I ++Q+ISLNT+TL + S ++YT+ GVP++VTG+AQ+KI G +K MLATAC+ FLGKTE EI  IA ETLE HQRAI+ ++TVEEIY+DRKKFS  VF+VASSD++NMGI VVSYTLKD+ DD+ YL++LG+ARTAQV+RDARIGEA+ K+DS I+EA A Q K +AQ  N++E+AK+ RDYELKKA ++ E+ TK+AES+ +Y +Q AKT+Q I+EE MQ+ V+ER ++I ++  EI R++K LEA V+K A+AEKYRLEKL EAE  ++  EAEAEAE I++KG AEA A+  K  A+A QM  KAEA+++Y+E A ++M L+ LP +A E++ P+S   K++M+ +G  E+GA+KLT E+L+IM +LP  I+ +TG N
Sbjct:    2 FYTCGPNEAMVVSGCGRSPPIMISGGRVFVLPCIQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQVKIQGQNKEMLATACQMFLGKTETEISQIALETLEGHQRAIIAHLTVEEIYQDRKKFSEQVFKVASSDLVNMGIGVVSYTLKDVHDDQDYLQSLGKARTAQVQRDARIGEAQYKRDSVIREAHAMQEKVSAQYVNEIEMAKAQRDYELKKAAYDIEINTKKAESEMAYQLQVAKTKQRIEEEKMQVMVVERTQQITLQEQEISRKEKELEAKVKKPAEAEKYRLEKLAEAERLQLIMEAEAEAESIRMKGEAEAFALEAKGRAEAEQMAKKAEAFKQYKEGAMVDMLLEKLPLMAEEISKPLSAAQKVTMVSSGGSEVGAAKLTGEVLDIMTRLPATIEKLTGIN 415          
BLAST of Flotillin-1 vs. Ensembl Cavefish
Match: flot1a (flotillin-1 [Source:NCBI gene;Acc:103027319])

HSP 1 Score: 457.988 bits (1177), Expect = 1.463e-159
Identity = 235/414 (56.76%), Postives = 324/414 (78.26%), Query Frame = 3
Query:   33 FIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            F  CGPNEAMVVSG     PVMISGGR FV P + ++Q+ISLNT+TL + S ++YT+ GVP++VTG+AQ+KI G +K MLA AC+ F+GK+E EI  IA ETLE HQRAI+ ++TVEEIYKDRKKFS  VF+VASSD++NMGISVVSYTLKD+ DD+ YL +LG+ARTAQV++DARIGEA  K+D+ I+EA A Q K +AQ  N++++AK+ RD+ELKKA ++ EV TK+AES+ +Y +Q AKT+Q I+EE MQ+KV+ER ++I ++  EI R++K LEA V+K A+AE+YRLEKL EAE  ++  EAEAEAE I+++G AEA A+  K  A+A QM  KAEA+Q+Y+E A ++M L+ LP +A E++ P+S  +K++M+ +G  E+GA+KLT E+++IM +LP  I+ +TG +
Sbjct:    2 FYTCGPNEAMVVSGFCRSPPVMISGGRVFVIPCVQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQMKIQGQNKQMLAAACQMFMGKSEAEIAQIALETLEGHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLVNMGISVVSYTLKDVHDDQDYLHSLGKARTAQVQKDARIGEALNKRDAVIREAHALQEKVSAQYMNEIQMAKAQRDFELKKAAYDIEVNTKKAESEMAYQLQVAKTKQRIEEEKMQVKVVERAQQITLQEQEITRKEKELEAKVKKPAEAERYRLEKLAEAERLQLIMEAEAEAESIRVRGEAEAFAVEAKGRAEAEQMAKKAEAFQQYKEGAMVDMLLEKLPLVAEEISKPLSAANKVTMVSSGGSEVGAAKLTGEVMDIMTRLPETIEKLTGVS 415          
BLAST of Flotillin-1 vs. Ensembl Cavefish
Match: flot1a (flotillin-1 [Source:NCBI gene;Acc:103027319])

HSP 1 Score: 428.713 bits (1101), Expect = 1.722e-148
Identity = 221/393 (56.23%), Postives = 310/393 (78.88%), Query Frame = 3
Query:   96 MISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            MISGGR FV P + ++Q+ISLNT+TL + S ++YT+ GVP++VTG+AQ+KI G +K MLA AC+ F+GK+E EI  IA ETLE HQRAI+ ++TVEEIYKDRKKFS  VF+VASSD++NMGISVVSYTLKD+ DD+ YL +LG+ARTAQV++DARIGEA  K+D+ I+EA A Q K +AQ  N++++AK+ RD+ELKKA ++ EV TK+AES+ +Y +Q AKT+Q I+EE MQ+KV+ER ++I ++  EI R++K LEA V+K A+AE+YRLEKL EAE  ++  EAEAEAE I+++G AEA A+  K  A+A QM  KAEA+Q+Y+E A ++M L+ LP +A E++ P+S  +K++M+ +G  E+GA+KLT E+++IM +LP  I+ +TG +
Sbjct:    1 MISGGRVFVIPCVQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQMKIQGQNKQMLAAACQMFMGKSEAEIAQIALETLEGHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLVNMGISVVSYTLKDVHDDQDYLHSLGKARTAQVQKDARIGEALNKRDAVIREAHALQEKVSAQYMNEIQMAKAQRDFELKKAAYDIEVNTKKAESEMAYQLQVAKTKQRIEEEKMQVKVVERAQQITLQEQEITRKEKELEAKVKKPAEAERYRLEKLAEAERLQLIMEAEAEAESIRVRGEAEAFAVEAKGRAEAEQMAKKAEAFQQYKEGAMVDMLLEKLPLVAEEISKPLSAANKVTMVSSGGSEVGAAKLTGEVMDIMTRLPETIEKLTGVS 393          
BLAST of Flotillin-1 vs. Ensembl Cavefish
Match: flot2a (flotillin 2 [Source:NCBI gene;Acc:103045282])

HSP 1 Score: 306.605 bits (784), Expect = 3.243e-100
Identity = 178/412 (43.20%), Postives = 283/412 (68.69%), Query Frame = 3
Query:   45 GPNEAMVVSG--CFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            GPNEA+VVSG  C   +     GG  + W ++  +QK+SL  MT++     I T  GVP+ VTGVAQ+K+  +DK +L+ ACEQFLGK+  EI+ +  +TLE H R+I+G +TVE+IY+DR +F+S V EVA+ D+  MGI ++S+T+KD+ D   YL +LG+ +TA V+RDA IG AEA++D+GI+EA  ++     +   D ++A S R+ E++KA+F +EV  K+AE+  +Y++QAAK QQ I+ E ++I+V++R ++I +E  EI+R DK L ATV++ A+AE Y++++L E +  +    A+AEAEKIK  G AEA +I    +A+A +M +KAEA+ +Y EAA+  + L+ LP++A +VAAP++  ++I +I +G G    S++T E+  ++ +LP  + ++TG +
Sbjct:    8 GPNEALVVSGGCCGSDQKTYTVGGWAWAWCLLTDIQKLSLEVMTILCRCENIETSEGVPLDVTGVAQVKVM-TDKELLSLACEQFLGKSVIEIKGVVLQTLEGHLRSILGTLTVEQIYQDRDQFASLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAAVQRDADIGVAEAERDAGIREAECKKEMMDVKFLADTKMADSKRELEMQKASFNQEVNAKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQITIEEKEIVRTDKELIATVKRPAEAEAYKMQQLAEGQKVKKVLTAQAEAEKIKRIGEAEAASIEAVGKAEAEKMRMKAEAYMQYGEAAKTALVLEALPKIAGKVAAPLARTNEI-VILSGEG----SRVTGEVNRLLAELPVSVNALTGVD 413          
BLAST of Flotillin-1 vs. Ensembl Cavefish
Match: flot2a (flotillin 2 [Source:NCBI gene;Acc:103045282])

HSP 1 Score: 302.753 bits (774), Expect = 1.084e-98
Identity = 178/412 (43.20%), Postives = 282/412 (68.45%), Query Frame = 3
Query:   45 GPNEAMVVSG--CFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            GPNEA+VVSG  C   +     GG  + W ++  +QKI+L  MTL      + T  GV +TVTGVAQ+K+  +DK +L+ ACEQFLGK+  EI+ +  +TLE H R+I+G +TVE+IY+DR +F+S V EVA+ D+  MGI ++S+T+KD+ D   YL +LG+ +TA V+RDA IG AEA++D+GI+EA  ++     +   D ++A S R+ E++KA+F +EV  K+AE+  +Y++QAAK QQ I+ E ++I+V++R ++I +E  EI+R DK L ATV++ A+AE Y++++L E +  +    A+AEAEKIK  G AEA +I    +A+A +M +KAEA+ +Y EAA+  + L+ LP++A +VAAP++  ++I +I +G G    S++T E+  ++ +LP  + ++TG +
Sbjct:    8 GPNEALVVSGGCCGSDQKTYTVGGWAWAWCLLTDIQKITLEIMTLQPKCEDVETAEGVALTVTGVAQVKVM-TDKELLSLACEQFLGKSVIEIKGVVLQTLEGHLRSILGTLTVEQIYQDRDQFASLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAAVQRDADIGVAEAERDAGIREAECKKEMMDVKFLADTKMADSKRELEMQKASFNQEVNAKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQITIEEKEIVRTDKELIATVKRPAEAEAYKMQQLAEGQKVKKVLTAQAEAEKIKRIGEAEAASIEAVGKAEAEKMRMKAEAYMQYGEAAKTALVLEALPKIAGKVAAPLARTNEI-VILSGEG----SRVTGEVNRLLAELPVSVNALTGVD 413          
BLAST of Flotillin-1 vs. Ensembl Sea Lamprey
Match: flot1b (flotillin 1b [Source:ZFIN;Acc:ZDB-GENE-020430-2])

HSP 1 Score: 457.218 bits (1175), Expect = 4.000e-160
Identity = 231/415 (55.66%), Postives = 314/415 (75.66%), Query Frame = 3
Query:   57 AMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADA-----------MQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITG 1268
            A++  GC    P+ I+GGR FVWP+I +LQ+ISLNTMTL + S ++YT+ GVP++VTG+AQ+KI G +K MLA AC+ FLGK ++EI  IA ETLE HQRAIMGNMTVEEIYKDRKKFS  VF VASSD++NMGISVVSYTLKD++DDE YLK+LG+ARTAQV+RDARIGEAE K+D+GIKEA+A + K AAQ  N++EIAK+  ++ELK A ++ EV T++A++D +Y +Q AKT+Q I+EE MQI V+ER ++I V+  EILR++K L+A ++K A+AEKYRLEKL EA   R+            ++  AEA +I +K EA+A            QM  KA+A+++Y+EAA +++ L+ LP++A EV+ P+S   K++MI +G GE+GASKLTSE+L+IM KLP  ++ +TG
Sbjct:    1 AVLSPGCGRSPPITITGGRVFVWPIIQQLQRISLNTMTLNVRSEKVYTRQGVPISVTGIAQVKIQGQNKDMLAAACQMFLGKGDEEISQIALETLEGHQRAIMGNMTVEEIYKDRKKFSQEVFRVASSDLLNMGISVVSYTLKDVRDDEDYLKSLGKARTAQVQRDARIGEAEMKRDAGIKEAMAVEQKVAAQYLNEIEIAKAQLEFELKTAAYDMEVNTQKAQADLAYQLQVAKTKQKIEEEKMQILVVERTQQILVQEQEILRREKELDAKIKKPAEAEKYRLEKLAEAGRARVI-----------MEAEAEAESIKIKGEAEAYAIEAKAKAEAEQMLQKAQAFKDYEEAAMVDLLLETLPKIATEVSQPLSKARKVTMISSGGGEVGASKLTSEVLDIMSKLPESVERLTG 404          
BLAST of Flotillin-1 vs. Ensembl Sea Lamprey
Match: flot2a (flotillin 2a [Source:NCBI gene;Acc:245698])

HSP 1 Score: 320.087 bits (819), Expect = 3.924e-106
Identity = 186/412 (45.15%), Postives = 285/412 (69.17%), Query Frame = 3
Query:   45 GPNEAMVVSG--CFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            GPNEA+VVSG  C   +   ++GG  +VW ++ + Q+ISL  MTL      + T  GV +TVTGVAQ+K+  +DK +LA ACEQFLG+T DEI+ +  +TLE H R+I+G +TVE +Y+DR +F+  V EVAS D+  MGI ++S+T+KD+ D   YL +LG+ + A VKRDA IG A+A++D+GI+EA  ++     + + D +IA S R+YE++KA F +E QTK+AE+  +Y++QAAK QQ I++E  QI+V++R ++I+VE  EI R ++ L ATVR  A AE +R++++ E +  +    A+A+AE+IK  G AEA AI     A+A +M LKAEA+++Y +AA ++M LD LP++AAEVAAP+   D+I +I +G G    ++ T+E+  ++ +LP  +Q++TG +
Sbjct:    8 GPNEALVVSGGWCGADEKKYVTGGWSWVWCLVSQAQRISLEIMTLNPRCEDVETSEGVALTVTGVAQVKVM-TDKDLLAVACEQFLGRTVDEIKSVVLQTLEGHLRSILGTLTVEAVYQDRDQFAQLVREVASPDVGRMGIEILSFTIKDVYDKVEYLASLGKTQAALVKRDAEIGVAQAERDAGIREAECKKNMMDVKFNADTKIANSKREYEMQKAFFNQESQTKKAEAQLAYELQAAKEQQKIRQEECQIEVVQRRKQIDVEEREIQRTERELIATVRCPAQAEAFRVQQIAEGDKIKRVLAAQADAERIKKIGDAEAAAIEAIGRAEAEEMRLKAEAYKQYGKAAIISMVLDALPKIAAEVAAPLQKIDEI-VILSGEG----NRTTTEVTRLLAELPTTVQALTGVD 413          
BLAST of Flotillin-1 vs. Ensembl Nematostella
Match: EDO47182 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMZ4])

HSP 1 Score: 517.694 bits (1332), Expect = 0.000e+0
Identity = 254/429 (59.21%), Postives = 334/429 (77.86%), Query Frame = 3
Query:   21 MVWGFIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAM-----------QMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            MV+ F  CGPNEAMVVSGCF  +P ++SGGR FVWPV  KLQ+ISLNTMTL + SPR+YT+ GVP++VTG+AQ+KI G ++ ML  AC+QFLGK+ ++ R IA ETLE HQRAIMG MTVEEIY+DRKKFS SVFEVASSD++NMGIS+VSYT+KDI+D+EGYL ALG +RTAQVKRDARIGEAEAK+DSGIKEA+AE+ +  A+  ND +IAK+ RD+ELKKA ++ EVQTK A S  +Y++QAA T+Q IKEE MQIKV+ER ++I+V+  EI R+++ LEATVR+ A+AEKYRLEKL EA  NR+            L+  A++ AI +K +A+A            QM  KA+AW+EY+EAA ++M L+ +P++AAE+AAP+S  +KI+M+  G GE+GASK+T EIL+I+ KLP  ++++TG +
Sbjct:    1 MVF-FNTCGPNEAMVVSGCFHARPALVSGGRIFVWPVFQKLQRISLNTMTLNVESPRVYTRHGVPISVTGIAQVKIQGQNQEMLHAACQQFLGKSAEQTRHIALETLEGHQRAIMGTMTVEEIYRDRKKFSKSVFEVASSDLVNMGISIVSYTIKDIRDEEGYLHALGMSRTAQVKRDARIGEAEAKRDSGIKEAIAEEARLKAKYENDTQIAKAKRDFELKKAGYDIEVQTKNATSQMAYNLQAAVTKQKIKEEEMQIKVVERGQQIKVQEQEIARRERELEATVRQPAEAEKYRLEKLAEANRNRVI-----------LEAEAQSEAIKVKGDAEAFAIEAKAKAEAEQMAKKADAWKEYREAAIVDMVLETMPKIAAEIAAPLSQVNKITMVSNGKGEVGASKVTGEILDIVAKLPKAVEALTGID 417          
BLAST of Flotillin-1 vs. Ensembl Nematostella
Match: EDO37688 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF43])

HSP 1 Score: 309.301 bits (791), Expect = 1.114e-101
Identity = 185/412 (44.90%), Postives = 278/412 (67.48%), Query Frame = 3
Query:   45 GPNEAMVVSG--CFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            GPNEA+VVSG  C       + GG  F W  +  +Q ISL  MTL  T   + T  GV VTVTGVAQ+K+  ++  +L TACEQFLGKT  +I  +  +TLE H RAI+G ++VEEIYKDR+ F++ V EVAS D+  MGI ++S+T+KDI+D   YL +LG+ +TA+VKRDA IG AEAK+D+GI+EA  E+ K          IA SSR+Y+++KA +++EV T++AE++ SY++Q  K +Q I+ E +QI+V+ER ++IEV+  EI R++K L A V++ A+AE Y++E L + +  +    A+A+AE+IKL G +EA AI    +A+A +M  KA A++ Y +AA   + L+ LP++AAEVAAP++   +I +I     + G S ++ E+ +++ +LP  IQ++TG +
Sbjct:    8 GPNEALVVSGGCCGSAAKKTVIGGWAFAWACVTDVQSISLEVMTLNPTCEAVETAQGVAVTVTGVAQVKVM-TEPRLLKTACEQFLGKTTRQIESVVLQTLEGHLRAILGTLSVEEIYKDREAFAALVREVASPDVGRMGIEILSFTIKDIEDHVDYLNSLGKTQTAKVKRDADIGVAEAKRDAGIREAECEKQKMDVVYETQTNIADSSREYQMQKAAYDQEVNTRKAEAELSYELQGNKEKQKIRSEEIQIEVVERRKQIEVQEKEIQRKEKELIAEVKRPAEAESYKVETLAQGKRTQTVFLAQADAERIKLIGSSEASAIEAIGKAEAERMRQKAAAYKMYGDAAMTALILEALPKVAAEVAAPLAKTGEIVII----NDDGNS-VSGELSKLLGQLPPAIQALTGTD 413          
BLAST of Flotillin-1 vs. Ensembl Nematostella
Match: EDO25979 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TD74])

HSP 1 Score: 78.1814 bits (191), Expect = 3.066e-18
Identity = 38/68 (55.88%), Postives = 54/68 (79.41%), Query Frame = 3
Query:  396 DRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIK 599
            DR+ F++ V EVAS D+  MGI ++S+T+KDI+D   YL +LG+ +TA+VKRDA IG AEAK+D+GI+
Sbjct:    1 DREAFAALVREVASPDVGRMGIEILSFTIKDIEDHVDYLNSLGKTQTAKVKRDADIGVAEAKRDAGIR 68          
BLAST of Flotillin-1 vs. Ensembl Medaka
Match: flot1b (flotillin-1 [Source:NCBI gene;Acc:101157726])

HSP 1 Score: 461.84 bits (1187), Expect = 1.406e-160
Identity = 236/414 (57.00%), Postives = 325/414 (78.50%), Query Frame = 3
Query:   33 FIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            F  CGPNEAMVVSGC    P+MI+GGR FV+P I K+Q+ISLNT+TL + S ++YT+ GVP++VTG+AQ+KI G +K MLATAC+ F+GK+E EI +IA ETLE HQRAI+ ++TVEEIY+DRKKFS  VF+VASSD++NMGI VVSYTLKD+ DD+ YL +LG+ARTAQV++DARIGEA+ K+DS IKEA A Q K +AQ  N++E+AK+ RDYELKKA ++KEV  K+AES+ +Y +Q AKT+Q I+EE MQ+ V+ER ++I ++  EI+R++K LEA V K ADAE+YRLEKL EA+  ++  EAEAEAE IK+KG AEA A+  K  A+A QM  KAEA+++Y+E A +++ L+ LP +A  ++ P+S+  KI+M+ +G  E+GA+KL  E+L+IM ++P  ++ +TG +
Sbjct:   40 FYTCGPNEAMVVSGCGRAPPLMIAGGRVFVFPCIQKIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQVKIQGQNKEMLATACQMFMGKSEREISEIALETLEGHQRAIIAHLTVEEIYQDRKKFSEQVFKVASSDLVNMGIGVVSYTLKDVHDDQDYLNSLGKARTAQVQKDARIGEAQYKRDSVIKEARAMQEKVSAQYKNEIEMAKAQRDYELKKAAYDKEVNAKKAESEMAYQLQVAKTKQCIEEEKMQVLVVERTQQIMLQEQEIIRKEKELEAKVMKPADAERYRLEKLAEAQRAQLIMEAEAEAESIKMKGEAEAFAMEAKGRAEAEQMAKKAEAFKQYKEGAMVDLLLEKLPLMAEAISEPLSHAQKITMVSSGGSEVGAAKLAGEVLDIMTRVPSALEKLTGID 453          
BLAST of Flotillin-1 vs. Ensembl Medaka
Match: flot1a (flotillin-1 [Source:NCBI gene;Acc:101155616])

HSP 1 Score: 457.988 bits (1177), Expect = 1.395e-159
Identity = 236/414 (57.00%), Postives = 324/414 (78.26%), Query Frame = 3
Query:   33 FIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            F  CGPNEAMVVSG     P+MI+GGR FV+P I ++Q+ISLNT+TL + S ++YT+ GVP++VTG+AQ+KI G +K MLA AC+ F+GK+E EI  IA ETLE HQRAI+ ++TVEEIYKDRKKFS  VF+VASSD++NMGISVVSYTLKD+ DD+ YL +LG+ARTAQV++DARIGEA  K+D+ I+EA A Q K +AQ  ND+E+AK+ RDYELKKA ++ EV TK+AES+ +Y +Q AKT+Q I+EE MQ++V+ER ++I ++  EI R++K LEA V+K A+AE+YR EKL EA+  ++  EAEAEAE I++KG AEA AI     A+A QM  KAEA+Q+Y++ A ++M ++ LP +A E++ P+S   KI+M+ +G+GEIGA+KL+ E+L+IM +LP  ++ +TG N
Sbjct:    2 FYTCGPNEAMVVSGFCRSPPLMIAGGRVFVFPCIQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQMKIQGQNKQMLAAACQMFMGKSEHEIAQIALETLEGHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLVNMGISVVSYTLKDVHDDQDYLHSLGKARTAQVQKDARIGEALNKRDAVIREAHAMQEKISAQYKNDIEMAKAQRDYELKKAAYDIEVNTKKAESEMAYQLQVAKTKQRIEEERMQVQVVERSQQIFLQDQEITRKEKELEAKVKKPAEAERYRQEKLAEAQRLKMIMEAEAEAESIRIKGEAEAYAIEAMGRAEAEQMAKKAEAFQQYKDGAMVDMLMEKLPLMAEEISKPLSQAHKITMVSSGAGEIGAAKLSGEVLDIMTRLPEAVEKLTGVN 415          
BLAST of Flotillin-1 vs. Ensembl Medaka
Match: flot1a (flotillin-1 [Source:NCBI gene;Acc:101155616])

HSP 1 Score: 429.869 bits (1104), Expect = 7.733e-149
Identity = 223/393 (56.74%), Postives = 310/393 (78.88%), Query Frame = 3
Query:   96 MISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            MI+GGR FV+P I ++Q+ISLNT+TL + S ++YT+ GVP++VTG+AQ+KI G +K MLA AC+ F+GK+E EI  IA ETLE HQRAI+ ++TVEEIYKDRKKFS  VF+VASSD++NMGISVVSYTLKD+ DD+ YL +LG+ARTAQV++DARIGEA  K+D+ I+EA A Q K +AQ  ND+E+AK+ RDYELKKA ++ EV TK+AES+ +Y +Q AKT+Q I+EE MQ++V+ER ++I ++  EI R++K LEA V+K A+AE+YR EKL EA+  ++  EAEAEAE I++KG AEA AI     A+A QM  KAEA+Q+Y++ A ++M ++ LP +A E++ P+S   KI+M+ +G+GEIGA+KL+ E+L+IM +LP  ++ +TG N
Sbjct:    1 MIAGGRVFVFPCIQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQMKIQGQNKQMLAAACQMFMGKSEHEIAQIALETLEGHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLVNMGISVVSYTLKDVHDDQDYLHSLGKARTAQVQKDARIGEALNKRDAVIREAHAMQEKISAQYKNDIEMAKAQRDYELKKAAYDIEVNTKKAESEMAYQLQVAKTKQRIEEERMQVQVVERSQQIFLQDQEITRKEKELEAKVKKPAEAERYRQEKLAEAQRLKMIMEAEAEAESIRIKGEAEAYAIEAMGRAEAEQMAKKAEAFQQYKDGAMVDMLMEKLPLMAEEISKPLSQAHKITMVSSGAGEIGAAKLSGEVLDIMTRLPEAVEKLTGVN 393          
BLAST of Flotillin-1 vs. Ensembl Medaka
Match: flot2a (flotillin 2 [Source:NCBI gene;Acc:101169802])

HSP 1 Score: 310.071 bits (793), Expect = 1.505e-101
Identity = 180/412 (43.69%), Postives = 284/412 (68.93%), Query Frame = 3
Query:   45 GPNEAMVVSG--CFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            GPNEA+VVSG  C   +   + GG  + W +I  +Q++SL  MT++     I T  GVP+ VTGVAQ+K+  +++ +L  ACEQFLGK+  EI+ +  +TLE H RAI+G +TVE+IY+DR KF+S V EVA+ D+  MGI ++S+T+KD+ D   YL +LG+ +TA V+RDA IG AEA++D+GI+EA  ++     +   D ++A S R+ E++KA+F +EV TK+AE+  +Y++QAAK QQ I+ E ++I+V++R ++I +E  EI R +K L ATV++ A+AE Y++++L E +  +    A+AEAEKI+  G AEA +I    +A+A +M LKAEA+Q+Y EAA+  + L+ LP++A +VAAP+S  ++I +I +G G    S++T E+  ++ +LP  + ++TG +
Sbjct:    8 GPNEALVVSGGCCGSDEKTYVVGGWAWAWWLISDIQRMSLEVMTILCRCENIETSEGVPLAVTGVAQVKVM-TERELLGYACEQFLGKSVVEIKSVILQTLEGHLRAILGTLTVEQIYQDRDKFASLVREVAAPDVGRMGIEILSFTIKDVYDKVEYLSSLGKTQTAAVQRDADIGVAEAERDAGIREAECKKEMMDVKFVADTKMADSKRELEMQKASFNQEVNTKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQITIEEKEIDRTEKELIATVKRPAEAEAYKMQQLAEGQKMKKVLTAQAEAEKIRCIGEAEATSIEAVGKAEAEKMRLKAEAYQQYGEAAKTALVLEALPKIAGKVAAPLSKTNEI-VILSGDG----SRVTGEVNRLLAELPVSVNALTGVD 413          
BLAST of Flotillin-1 vs. Ensembl Medaka
Match: flot2a (flotillin 2 [Source:NCBI gene;Acc:101169802])

HSP 1 Score: 306.22 bits (783), Expect = 4.469e-100
Identity = 180/412 (43.69%), Postives = 283/412 (68.69%), Query Frame = 3
Query:   45 GPNEAMVVSG--CFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            GPNEA+VVSG  C   +   + GG  + W +I  +Q+I+L  MTL      + T  GV +TVTGVAQ+K+  +++ +L  ACEQFLGK+  EI+ +  +TLE H RAI+G +TVE+IY+DR KF+S V EVA+ D+  MGI ++S+T+KD+ D   YL +LG+ +TA V+RDA IG AEA++D+GI+EA  ++     +   D ++A S R+ E++KA+F +EV TK+AE+  +Y++QAAK QQ I+ E ++I+V++R ++I +E  EI R +K L ATV++ A+AE Y++++L E +  +    A+AEAEKI+  G AEA +I    +A+A +M LKAEA+Q+Y EAA+  + L+ LP++A +VAAP+S  ++I +I +G G    S++T E+  ++ +LP  + ++TG +
Sbjct:    8 GPNEALVVSGGCCGSDEKTYVVGGWAWAWWLISDIQRITLEIMTLQPKCEDVETAEGVAITVTGVAQVKVM-TERELLGYACEQFLGKSVVEIKSVILQTLEGHLRAILGTLTVEQIYQDRDKFASLVREVAAPDVGRMGIEILSFTIKDVYDKVEYLSSLGKTQTAAVQRDADIGVAEAERDAGIREAECKKEMMDVKFVADTKMADSKRELEMQKASFNQEVNTKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQITIEEKEIDRTEKELIATVKRPAEAEAYKMQQLAEGQKMKKVLTAQAEAEKIRCIGEAEATSIEAVGKAEAEKMRLKAEAYQQYGEAAKTALVLEALPKIAGKVAAPLSKTNEI-VILSGDG----SRVTGEVNRLLAELPVSVNALTGVD 413          
BLAST of Flotillin-1 vs. Planmine SMEST
Match: SMESG000062944.1 (SMESG000062944.1)

HSP 1 Score: 814.683 bits (2103), Expect = 0.000e+0
Identity = 416/418 (99.52%), Postives = 418/418 (100.00%), Query Frame = 3
Query:   21 MVWGFIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            MVWGFIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICREAEAEAEKIKLKGGAEARAILL+AEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLT+EILEIMEKLPGVIQSITGFN
Sbjct:    1 MVWGFIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICREAEAEAEKIKLKGGAEARAILLRAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTTEILEIMEKLPGVIQSITGFN 418          
BLAST of Flotillin-1 vs. Planmine SMEST
Match: SMESG000004975.1 (SMESG000004975.1)

HSP 1 Score: 538.11 bits (1385), Expect = 0.000e+0
Identity = 264/418 (63.16%), Postives = 346/418 (82.78%), Query Frame = 3
Query:   21 MVWGFIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            M WGF  CGPNEAMV+SG F+ KP +ISGGR FV P+I ++ +ISLN MTL I SPRIYTQLGVP+TVTGVAQ+KI  S+K MLATACEQFLG++  +I D+AKETLE HQRAIMGNMTVEEIY DRKKFS  VFEVASSD++NMGISVVSYTLKDI DDEGYLK+LG ARTAQVKRD RIGEAEA++D+GIK+A AE+ + A++ +N+ +IA++ RD++LKKA ++KE++TK+A+S  SY++Q A T+Q IKEE MQIKV+ER+++++++ LEI R+DK LEA VRK A+AE YRL+K+ EAE  RI +EAE E+E I+L G A A AI   A+A+A Q+  KAEAW++Y  AA+L MFL+ LP+LAAEVA+P+S+C KI+M+ +G+G++GA+K+T E++ IME LP +++ +TGF+
Sbjct:    1 MTWGFKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQVKIQSSNKEMLATACEQFLGRSVHQIMDVAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGEARAFAIEALAKAEAEQLEKKAEAWKDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFD 418          
BLAST of Flotillin-1 vs. Planmine SMEST
Match: SMESG000064151.1 (SMESG000064151.1)

HSP 1 Score: 446.432 bits (1147), Expect = 3.149e-155
Identity = 225/414 (54.35%), Postives = 321/414 (77.54%), Query Frame = 3
Query:   33 FIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            F  CGPNE +VVSG  + +P+M+ GGRKFV+P   K+Q++SLN MT+++ SP IYT+LG+P+T TGVAQ+KI  + +  L TAC  +L    ++I DIAKETLE HQRAIMG MTVEEIY+DRKKF+++VFEVAS D+  MG+ VVSYT+K++ D+EGYL +LG +RT+QVKRDARIGEAEA++D+ +K+A AE+L+  +Q  N  +IA++ RD+ +KKA +EKE++T++AE++ +Y +QAAKT+Q I  E MQIKV+ER + I V+ LEI R+++ L++TVRK  +AEKY++EK+  AE  R  REAEA AE  KL+G AEA AIL KA+A+A QM  KAE+W+EY EAA+L +FL  LP++AAEVA P+++  KI+M+   +  IG +K++ EIL +M+++P ++Q++TG +
Sbjct:    3 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGLMTVEEIYQDRKKFANAVFEVASRDLFQMGLQVVSYTIKELSDEEGYLNSLGMSRTSQVKRDARIGEAEARRDASVKQAAAEKLETISQLENKTKIAQAERDFSIKKAEYEKEIKTRQAETELAYRLQAAKTRQQIMLEEMQIKVVEREQMITVQDLEIQRRERELDSTVRKQVEAEKYKMEKIAYAEKIRAVREAEASAETTKLRGEAEAFAILEKAKAEAEQMAKKAESWKEYTEAAKLELFLSTLPKIAAEVANPLTSVSKITMVSNDNSPIGITKISDEILSVMDRIPKLVQNMTGLD 416          
BLAST of Flotillin-1 vs. Planmine SMEST
Match: SMESG000063612.1 (SMESG000063612.1)

HSP 1 Score: 443.736 bits (1140), Expect = 4.013e-154
Identity = 234/411 (56.93%), Postives = 312/411 (75.91%), Query Frame = 3
Query:   33 FIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSIT 1265
            F+  GPNE +VVSGC   KP+MI GG+KFVW  +   QK+SLN  T+II SP+IYT+LGV +TVTGVAQIKI G ++ ML  ACEQFLGK +D+I DI + TLEAHQRAIMG MTVEEIY+DRKKFS  VF V+S+D++ MGISVVSYT+KDI D++GYLKALG+ RTAQV RDARIGEAEA +D+ IK+A A+Q +  A+ +N+  IAK+ RD++L+KA F+KEV T  A ++ +Y +Q AKT Q I EE   I VIER  +I+V+ LE+ R ++ L+A+++  A AEKY+++KL EA   ++  EAEAE+E IKLKG AEA AI +  +ADA QM +KAEAW+EY++AA++ M L MLP LAAEVA P++NC KI+M+  G G+IG SKLT E+++++  L   +  ++
Sbjct:    3 FVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWSGVQTYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDAEIKKAQAQQAQMHAKLANNTAIAKADRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMKAEAWKEYEKAAKIEMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 413          
BLAST of Flotillin-1 vs. Planmine SMEST
Match: SMESG000024114.1 (SMESG000024114.1)

HSP 1 Score: 323.939 bits (829), Expect = 4.113e-107
Identity = 187/412 (45.39%), Postives = 280/412 (67.96%), Query Frame = 3
Query:   45 GPNEAMVVSG--CFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICRXXXXXXXXXXXXXXXXXRAILLKAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEILEIMEKLPGVIQSITGFN 1274
            GPNEA+ +SG  C       I GG  + W ++ ++QKISL  MTL  T   + T+ GVP+TVTGVAQ+K+  ++  +LATACEQFLG+   EI +   +TL+ H RAI+G +TVE IY+DR +F+  V EVA+ D+  MGI ++S+T+KD+ D   YL +LG A+TA VKRDA IG AEA++D+GI+EA  E+ +   +   D EIA ++R Y+L+KA+F+ EV   RAE++ ++++QAAK +Q I+ E +QI+V+ER + IE+E  EILR +K LE TV+K A+AE ++ E L +A   +    A+ EAE I+LKG AEA ++    +A+A +M LKA A+ +Y +AA L++ LD LP++AAE+ AP++  ++I ++  GSG    S LT EI  ++  LP  +Q++TG +
Sbjct:    8 GPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVM-TEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRAEAELAFELQAAKEKQKIRSEEIQIEVVERKKLIEIEEKEILRNEKELEGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVIL--GSGSDSKSDLTGEITRLLGNLPPAVQAMTGVD 416          
The following BLAST results are available for this feature:
BLAST of Flotillin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FLOT15.053e-16757.25flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757][more]
FLOT15.053e-16757.25flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757][more]
FLOT15.053e-16757.25flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757][more]
FLOT15.053e-16757.25flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757][more]
FLOT15.053e-16757.25flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757][more]
back to top
BLAST of Flotillin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Flotillin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Flo17.247e-17961.48gene:FBgn0024754 transcript:FBtr0087351[more]
Flo11.630e-17660.90gene:FBgn0024754 transcript:FBtr0087352[more]
Flo28.883e-10844.90gene:FBgn0264078 transcript:FBtr0073952[more]
Flo28.883e-10844.90gene:FBgn0264078 transcript:FBtr0073950[more]
Flo21.612e-10744.90gene:FBgn0264078 transcript:FBtr0330217[more]
back to top
BLAST of Flotillin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flot1a6.409e-16257.97flotillin 1a [Source:ZFIN;Acc:ZDB-GENE-020430-1][more]
flot1a2.435e-16157.97flotillin 1a [Source:ZFIN;Acc:ZDB-GENE-020430-1][more]
flot1b8.253e-16056.28flotillin 1b [Source:ZFIN;Acc:ZDB-GENE-020430-2][more]
flot2a2.431e-10044.42flotillin 2a [Source:NCBI gene;Acc:245698][more]
flot2b5.356e-9543.86flotillin 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1368... [more]
back to top
BLAST of Flotillin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flot11.986e-15958.02flotillin 1 [Source:NCBI gene;Acc:733927][more]
flot11.869e-15857.92flotillin 1 [Source:NCBI gene;Acc:733927][more]
flot12.030e-15757.71flotillin 1 [Source:NCBI gene;Acc:733927][more]
flot12.777e-15757.71flotillin 1 [Source:NCBI gene;Acc:733927][more]
flot12.881e-15657.71flotillin 1 [Source:NCBI gene;Acc:733927][more]
back to top
BLAST of Flotillin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Flot12.503e-16957.97flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500][more]
Flot12.053e-13550.00flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500][more]
Flot27.921e-10243.93flotillin 2 [Source:MGI Symbol;Acc:MGI:103309][more]
Flot21.722e-10044.17flotillin 2 [Source:MGI Symbol;Acc:MGI:103309][more]
Flot13.374e-9568.21flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500][more]
back to top
BLAST of Flotillin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O61491|FLOT1_DROME7.264e-17861.48Flotillin-1 OS=Drosophila melanogaster OX=7227 GN=... [more]
sp|O08917|FLOT1_MOUSE1.751e-16857.97Flotillin-1 OS=Mus musculus OX=10090 GN=Flot1 PE=1... [more]
sp|Q9Z1E1|FLOT1_RAT2.739e-16857.73Flotillin-1 OS=Rattus norvegicus OX=10116 GN=Flot1... [more]
sp|O75955|FLOT1_HUMAN2.426e-16657.25Flotillin-1 OS=Homo sapiens OX=9606 GN=FLOT1 PE=1 ... [more]
sp|Q08DN8|FLOT1_BOVIN2.591e-16657.49Flotillin-1 OS=Bos taurus OX=9913 GN=FLOT1 PE=2 SV... [more]
back to top
BLAST of Flotillin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KCQ00.000e+064.83Putative flotillin-1 OS=Schistosoma mansoni OX=618... [more]
C1LLP30.000e+064.35Flotillin 1 OS=Schistosoma japonicum OX=6182 GN=Fl... [more]
A0A267H6Y30.000e+065.79PHB domain-containing protein OS=Macrostomum ligna... [more]
A0A4S2LBB70.000e+066.75PHB domain-containing protein OS=Opisthorchis feli... [more]
A0A4S2LDF30.000e+066.51PHB domain-containing protein OS=Opisthorchis feli... [more]
back to top
BLAST of Flotillin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flot1b1.773e-16558.45flotillin-1-like [Source:NCBI gene;Acc:103034507][more]
flot1a1.463e-15956.76flotillin-1 [Source:NCBI gene;Acc:103027319][more]
flot1a1.722e-14856.23flotillin-1 [Source:NCBI gene;Acc:103027319][more]
flot2a3.243e-10043.20flotillin 2 [Source:NCBI gene;Acc:103045282][more]
flot2a1.084e-9843.20flotillin 2 [Source:NCBI gene;Acc:103045282][more]
back to top
BLAST of Flotillin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
flot1b4.000e-16055.66flotillin 1b [Source:ZFIN;Acc:ZDB-GENE-020430-2][more]
flot2a3.924e-10645.15flotillin 2a [Source:NCBI gene;Acc:245698][more]
back to top
BLAST of Flotillin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Flotillin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO471820.000e+059.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376881.114e-10144.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO259793.066e-1855.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Flotillin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flot1b1.406e-16057.00flotillin-1 [Source:NCBI gene;Acc:101157726][more]
flot1a1.395e-15957.00flotillin-1 [Source:NCBI gene;Acc:101155616][more]
flot1a7.733e-14956.74flotillin-1 [Source:NCBI gene;Acc:101155616][more]
flot2a1.505e-10143.69flotillin 2 [Source:NCBI gene;Acc:101169802][more]
flot2a4.469e-10043.69flotillin 2 [Source:NCBI gene;Acc:101169802][more]
back to top
BLAST of Flotillin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062944.10.000e+099.52SMESG000062944.1[more]
SMESG000004975.10.000e+063.16SMESG000004975.1[more]
SMESG000064151.13.149e-15554.35SMESG000064151.1[more]
SMESG000063612.14.013e-15456.93SMESG000063612.1[more]
SMESG000024114.14.113e-10745.39SMESG000024114.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001755 ID=SMED30001755|Name=Flotillin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1323bp
AATTTATACAAATCTAAACAATGGTTTGGGGATTTATCGTTTGTGGTCCA
AACGAAGCTATGGTTGTTTCGGGTTGTTTTTTTCGAAAACCAGTAATGAT
ATCTGGTGGTAGAAAATTTGTTTGGCCAGTAATTCATAAATTACAAAAAA
TATCTCTAAATACAATGACATTAATTATAACAAGTCCAAGAATCTACACT
CAACTAGGAGTACCAGTTACAGTTACAGGAGTTGCACAGATAAAAATCAA
CGGGTCGGACAAAGGGATGCTGGCAACGGCGTGTGAACAGTTTCTAGGGA
AAACTGAGGATGAAATAAGAGATATTGCTAAAGAAACCCTTGAAGCACAT
CAAAGAGCGATTATGGGCAACATGACTGTTGAAGAAATTTACAAAGATAG
GAAAAAGTTTTCAAGTTCTGTATTTGAAGTAGCTTCATCAGATATGATCA
ACATGGGAATAAGTGTCGTCAGTTATACATTGAAAGATATCCAAGACGAT
GAGGGCTATTTGAAAGCACTCGGGGAAGCTAGAACTGCTCAGGTTAAAAG
AGATGCCAGAATCGGTGAAGCAGAGGCAAAAAAAGATTCGGGAATTAAAG
AAGCTCTAGCCGAACAGCTTAAAAGAGCAGCTCAATGTAGTAATGACGTA
GAAATAGCAAAATCTTCTCGTGATTATGAGTTGAAAAAGGCAAATTTTGA
AAAAGAAGTTCAAACTAAAAGAGCAGAATCGGATTTTTCTTATGATATTC
AAGCAGCGAAAACTCAACAAGCGATTAAAGAGGAAGCAATGCAGATAAAA
GTCATTGAAAGAATGAGAAAAATTGAAGTTGAGCGTTTAGAAATTTTAAG
ACAAGATAAATATTTGGAAGCCACAGTACGAAAAACTGCAGATGCTGAAA
AATATCGATTAGAAAAGTTAGGAGAAGCCGAAATGAATCGCATATGTAGA
GAAGCAGAAGCAGAAGCCGAAAAAATTAAATTAAAAGGTGGAGCAGAAGC
GAGAGCTATTTTACTCAAAGCTGAGGCAGATGCGATGCAAATGAATCTGA
AAGCAGAGGCTTGGCAGGAGTATCAGGAAGCGGCCAGATTGAATATGTTT
CTAGACATGTTGCCACAACTTGCAGCAGAAGTGGCCGCTCCAATGTCAAA
TTGTGACAAAATTTCTATGATTTGTACAGGATCCGGTGAAATTGGGGCTT
CAAAGTTAACTTCGGAGATTTTGGAAATAATGGAAAAGCTTCCAGGAGTC
ATTCAATCTATTACAGGATTCAATATAAAAGAATCGATGAAAATTTAATC
AAAGAAATAAATGTGAGATCGGA
back to top

protein sequence of SMED30001755-orf-1

>SMED30001755-orf-1 ID=SMED30001755-orf-1|Name=SMED30001755-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=426bp
MVWGFIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMT
LIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIR
DIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVV
SYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQL
KRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQ
AIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKL
GEAEMNRICREAEAEAEKIKLKGGAEARAILLKAEADAMQMNLKAEAWQE
YQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTSEI
LEIMEKLPGVIQSITGFNIKESMKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005768endosome
GO:0042470melanosome
GO:0045121membrane raft
GO:0005856cytoskeleton
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0005901caveola
GO:0016020membrane
GO:0016600flotillin complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027705Flotillin_fam
IPR036013Band_7/SPFH_dom_sf
IPR001107Band_7
IPR031905Flotillin_C
IPR000299FERM_domain
IPR001633EAL_dom
Vocabulary: molecular function
TermDefinition
GO:0005198structural molecule activity
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 216..236
NoneNo IPR availableCOILSCoilCoilcoord: 302..322
NoneNo IPR availableGENE3DG3DSA:3.30.479.30coord: 44..160
e-value: 1.7E-39
score: 136.6
NoneNo IPR availablePANTHERPTHR13806:SF16FLOTILLIN-1coord: 1..422
NoneNo IPR availableCDDcd03399SPFH_flotillincoord: 33..178
e-value: 2.45243E-65
score: 203.89
IPR001107Band 7 domainSMARTSM00244PHB_4coord: 3..171
e-value: 5.7E-6
score: 35.8
IPR001107Band 7 domainPFAMPF01145Band_7coord: 8..187
e-value: 6.5E-22
score: 78.4
IPR031905Flotillin, C-terminal domainPFAMPF15975Flotcoord: 311..386
e-value: 3.3E-8
score: 33.7
IPR027705Flotillin familyPANTHERPTHR13806FLOTILLIN-RELATEDcoord: 1..422
IPR036013Band 7/SPFH domain superfamilySUPERFAMILYSSF117892Band 7/SPFH domaincoord: 35..178