Ig-like domain-containing protein

Overview
NameIg-like domain-containing protein
Smed IDSMED30001742
Length (bp)1794
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ig-like domain-containing protein (SMED30001742) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30001742) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001742

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30001742h1SMcG0018809 SmedASXL_002017SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30001742h1SMcG0018809 SmedASXL_054400SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30001742h1SMcG0018809 SmedASXL_002049SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30001742h1SMcG0018809 dd_Smed_v4_30279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001742h1SMcG0018809 dd_Smed_v4_30279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30001742h1SMcG0018809 dd_Smed_v4_30279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30001742h1SMcG0018809 dd_Smed_v6_30279_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: LRRC4C (leucine rich repeat containing 4C [Source:HGNC Symbol;Acc:HGNC:29317])

HSP 1 Score: 86.2705 bits (212), Expect = 5.425e-17
Identity = 103/409 (25.18%), Postives = 161/409 (39.36%), Query Frame = 1
Query:  139 ICIRKHLIDVPDDIHSQTKLLDLTGNQI------------------------TTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRI-------------------------------------------LAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFT-PQNNITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVPSTRTHSQXXXXXXXXXXXXXXXXXYQDSGVYHCQIQAGKEFIKTTIYLNVVKSS 1161
            IC+RK+L +VPD I + T+LL+L  NQI                         T+    F  L  L  L L +NR+  I    F+ L+ L EL L+NN +  SI +   NRI                                           L PL+ L  LDLS N L  I    F+    +  L +  +   + +  N+F  L  L  ++L +N LT+LP  +F    +L+   I L +NPWNCNC + WL   +      K + P + +           C  P   KG  + ++  N F C   V   P  ++    G+   L C    A  + +S++W   N  ++  T    +   +       N ++V+ QD+G+Y C +         +  LNV  ++
Sbjct:   61 ICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIE-SIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQV-IERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLE--RIHLHHNPWNCNCDILWLSWWI------KDMAPSNTACCA-------RCNTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKC---RASTSLTSVSWITPNGTVM--THGAYKVRIAVLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASATLNVTAAT 447          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: LRRC4C (leucine rich repeat containing 4C [Source:HGNC Symbol;Acc:HGNC:29317])

HSP 1 Score: 86.2705 bits (212), Expect = 5.425e-17
Identity = 103/409 (25.18%), Postives = 161/409 (39.36%), Query Frame = 1
Query:  139 ICIRKHLIDVPDDIHSQTKLLDLTGNQI------------------------TTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRI-------------------------------------------LAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFT-PQNNITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVPSTRTHSQXXXXXXXXXXXXXXXXXYQDSGVYHCQIQAGKEFIKTTIYLNVVKSS 1161
            IC+RK+L +VPD I + T+LL+L  NQI                         T+    F  L  L  L L +NR+  I    F+ L+ L EL L+NN +  SI +   NRI                                           L PL+ L  LDLS N L  I    F+    +  L +  +   + +  N+F  L  L  ++L +N LT+LP  +F    +L+   I L +NPWNCNC + WL   +      K + P + +           C  P   KG  + ++  N F C   V   P  ++    G+   L C    A  + +S++W   N  ++  T    +   +       N ++V+ QD+G+Y C +         +  LNV  ++
Sbjct:   61 ICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIE-SIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQV-IERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLE--RIHLHHNPWNCNCDILWLSWWI------KDMAPSNTACCA-------RCNTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKC---RASTSLTSVSWITPNGTVM--THGAYKVRIAVLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASATLNVTAAT 447          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: LRRC4C (leucine rich repeat containing 4C [Source:HGNC Symbol;Acc:HGNC:29317])

HSP 1 Score: 86.2705 bits (212), Expect = 5.425e-17
Identity = 103/409 (25.18%), Postives = 161/409 (39.36%), Query Frame = 1
Query:  139 ICIRKHLIDVPDDIHSQTKLLDLTGNQI------------------------TTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRI-------------------------------------------LAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFT-PQNNITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVPSTRTHSQXXXXXXXXXXXXXXXXXYQDSGVYHCQIQAGKEFIKTTIYLNVVKSS 1161
            IC+RK+L +VPD I + T+LL+L  NQI                         T+    F  L  L  L L +NR+  I    F+ L+ L EL L+NN +  SI +   NRI                                           L PL+ L  LDLS N L  I    F+    +  L +  +   + +  N+F  L  L  ++L +N LT+LP  +F    +L+   I L +NPWNCNC + WL   +      K + P + +           C  P   KG  + ++  N F C   V   P  ++    G+   L C    A  + +S++W   N  ++  T    +   +       N ++V+ QD+G+Y C +         +  LNV  ++
Sbjct:   61 ICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIE-SIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQV-IERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLE--RIHLHHNPWNCNCDILWLSWWI------KDMAPSNTACCA-------RCNTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKC---RASTSLTSVSWITPNGTVM--THGAYKVRIAVLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASATLNVTAAT 447          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: LRRC4C (leucine rich repeat containing 4C [Source:HGNC Symbol;Acc:HGNC:29317])

HSP 1 Score: 86.2705 bits (212), Expect = 5.425e-17
Identity = 103/409 (25.18%), Postives = 161/409 (39.36%), Query Frame = 1
Query:  139 ICIRKHLIDVPDDIHSQTKLLDLTGNQI------------------------TTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRI-------------------------------------------LAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFT-PQNNITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVPSTRTHSQXXXXXXXXXXXXXXXXXYQDSGVYHCQIQAGKEFIKTTIYLNVVKSS 1161
            IC+RK+L +VPD I + T+LL+L  NQI                         T+    F  L  L  L L +NR+  I    F+ L+ L EL L+NN +  SI +   NRI                                           L PL+ L  LDLS N L  I    F+    +  L +  +   + +  N+F  L  L  ++L +N LT+LP  +F    +L+   I L +NPWNCNC + WL   +      K + P + +           C  P   KG  + ++  N F C   V   P  ++    G+   L C    A  + +S++W   N  ++  T    +   +       N ++V+ QD+G+Y C +         +  LNV  ++
Sbjct:   61 ICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIE-SIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQV-IERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLE--RIHLHHNPWNCNCDILWLSWWI------KDMAPSNTACCA-------RCNTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKC---RASTSLTSVSWITPNGTVM--THGAYKVRIAVLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASATLNVTAAT 447          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: LRRC4C (leucine rich repeat containing 4C [Source:HGNC Symbol;Acc:HGNC:29317])

HSP 1 Score: 86.2705 bits (212), Expect = 5.425e-17
Identity = 103/409 (25.18%), Postives = 161/409 (39.36%), Query Frame = 1
Query:  139 ICIRKHLIDVPDDIHSQTKLLDLTGNQI------------------------TTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRI-------------------------------------------LAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFT-PQNNITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVPSTRTHSQXXXXXXXXXXXXXXXXXYQDSGVYHCQIQAGKEFIKTTIYLNVVKSS 1161
            IC+RK+L +VPD I + T+LL+L  NQI                         T+    F  L  L  L L +NR+  I    F+ L+ L EL L+NN +  SI +   NRI                                           L PL+ L  LDLS N L  I    F+    +  L +  +   + +  N+F  L  L  ++L +N LT+LP  +F    +L+   I L +NPWNCNC + WL   +      K + P + +           C  P   KG  + ++  N F C   V   P  ++    G+   L C    A  + +S++W   N  ++  T    +   +       N ++V+ QD+G+Y C +         +  LNV  ++
Sbjct:   61 ICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIE-SIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQV-IERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLE--RIHLHHNPWNCNCDILWLSWWI------KDMAPSNTACCA-------RCNTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKC---RASTSLTSVSWITPNGTVM--THGAYKVRIAVLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASATLNVTAAT 447          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: slt-1 (Slit homolog 1 protein [Source:UniProtKB/Swiss-Prot;Acc:G5EFX6])

HSP 1 Score: 83.9593 bits (206), Expect = 1.862e-16
Identity = 62/193 (32.12%), Postives = 92/193 (47.67%), Query Frame = 1
Query:  142 CIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLE 720
            C+ + L +VP +I + T  LDL  N+IT +  ++F +L  L  L L +N+I  I   +F  L  L +L L  N      +  + + +    L L  LDLS N + V++D   +    +  L LD       L  N       LE+L+L  N LT      F   +N     + L NNPWNC+C L+W+R  LE
Sbjct:   30 CVGQQLTEVPQNIPNDTIRLDLQDNEITKIGPNDFSSLMNLKALQLMDNQIVTIHNQSFSSLVFLQKLRLSRNR-----IRHLPDNVFQNNLKLTHLDLSENDITVVSDAQLQGPEFLEVLNLDK-NHIFCLENNVISSWVSLEVLTLNGNRLTT-----FEEPSNARFRQLDLFNNPWNCDCRLRWMRKWLE 211          

HSP 2 Score: 55.8398 bits (133), Expect = 9.346e-8
Identity = 74/287 (25.78%), Postives = 122/287 (42.51%), Query Frame = 1
Query:   10 SMIEILIFVLILSAFTRGQSVKSRPRNSIFNRKCP-PQLDMGIYI-CIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQ 864
            S IEIL    +  +  R +  K     +     CP P    G  + C    L  VP ++   T  + L  NQI+++   +F NL+ L RL L +N I +I    FL L +L  L L  N+++                     DL          D F+   ++  L+L++      +   +F ++PKL MLSL +N++  + E  F++ T+L  + + LA NP  C+C+L+W    L  I L K +           +     C  P + +      +P N F+C+
Sbjct:  230 SSIEILQDKFMTCSGNRKRRYKKTCETAEI---CPLPCTCTGTTVDCRDSGLTYVPTNLPPSTTEIRLEQNQISSIPSHSFKNLKNLTRLDLSKNIITEIQPKAFLGLHNLHTLVLYGNNIT---------------------DLK--------SDTFEGLGSLQLLLLNANQLTC-IRRGTFDHVPKLSMLSLYDNDIKSISEVTFQNLTSL--STLHLAKNPLICDCNLQW----LAQINLQKNI-----------ETSGARCEQPKRLRKKKFATLPPNKFKCK 466          

HSP 3 Score: 53.1434 bits (126), Expect = 5.528e-7
Identity = 41/129 (31.78%), Postives = 71/129 (55.04%), Query Frame = 1
Query:  337 TELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLES 723
            TEL L  N++     N I    L  L SL +LDLS+N+L  + ++ F N + +++L++ S  K   L   +F  L  L +LSL  N+++ LP+  F + T+  I +I + +N   C+C++ W    ++S
Sbjct:  707 TELYLDANYI-----NEIPAHDLNRLYSLTKLDLSHNRLISLENNTFSNLTRLSTLII-SYNKLRCLQPLAFNGLNALRILSLHGNDISFLPQSAFSNLTS--ITHIAVGSNSLYCDCNMAWFSKWIKS 827          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: lron-7 (ELRR (Extracellular Leucine-Rich Repeat) ONly [Source:UniProtKB/TrEMBL;Acc:Q21164])

HSP 1 Score: 62.3882 bits (150), Expect = 6.315e-10
Identity = 68/235 (28.94%), Postives = 98/235 (41.70%), Query Frame = 1
Query:  175 DIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENN----ELTMLPEGIFRSQ--------TNLDINN------------------IRLANNPWNCNCSLKWLRMTLESIILSKQ--LNPDSDSPSVLHKK 783
            D  S+ K+L L GN I    +  F  L  L  L LD   I  +  + F  L  L +LSL+ N L           ++A L SLK +DLS   L  I D  F   S +  ++L+       +    F  LP+L+ L L +N    EL     G  +SQ        T+L I+N                   ++  NPWNCNC  +++   LE     KQ  + P   SP+ L+ +
Sbjct:  274 DTLSKLKVLSLDGNPIKAWRKEMFKGLDSLEELSLDNCNIENLPADIFEYLPKLVKLSLRENPLEE------IPAVVAHLKSLKDIDLSVTNLTEIRDHAFAGDSDLEEIILEKMPFLTVVRDCGFCGLPQLKTLILNDNKYLQELHPNAFGYIKSQPGHKSAAITSLQIHNSNISTISEHMVDYDNLKTFQVGGNPWNCNCDTQFM---LEEKFAFKQDSVAPKCTSPAGLNGR 499          

HSP 2 Score: 50.447 bits (119), Expect = 2.733e-6
Identity = 45/145 (31.03%), Postives = 72/145 (49.66%), Query Frame = 1
Query:  205 LTGNQITTLHESNFV-NLQKLLRLV-LDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRIL-APLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQL-TINSFYYLPKLEMLSLENNELTMLPEGIFR 627
             T N+I+ L     +   +K + ++ +  N I  I  + F P  +LT+L L +N     +L ++   +  A   +L RLDL YN++ V++D+ F   S +  L LD  G P++      F  L  LE LSL+N  +  LP  IF 
Sbjct:  185 FTKNKISRLQNDKVLPKFEKFVSILDVSYNEIRFIDNDVFKPFTNLTKLYLSHN-----VLQTVKKDVFDAAKNTLHRLDLGYNRIKVVSDNSFDTLSKLKVLSLD--GNPIKAWRKEMFKGLDSLEELSLDNCNIENLPADIFE 322          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: lron-7 (ELRR (Extracellular Leucine-Rich Repeat) ONly [Source:UniProtKB/TrEMBL;Acc:Q21164])

HSP 1 Score: 62.003 bits (149), Expect = 6.811e-10
Identity = 68/235 (28.94%), Postives = 98/235 (41.70%), Query Frame = 1
Query:  175 DIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENN----ELTMLPEGIFRSQ--------TNLDINN------------------IRLANNPWNCNCSLKWLRMTLESIILSKQ--LNPDSDSPSVLHKK 783
            D  S+ K+L L GN I    +  F  L  L  L LD   I  +  + F  L  L +LSL+ N L           ++A L SLK +DLS   L  I D  F   S +  ++L+       +    F  LP+L+ L L +N    EL     G  +SQ        T+L I+N                   ++  NPWNCNC  +++   LE     KQ  + P   SP+ L+ +
Sbjct:  274 DTLSKLKVLSLDGNPIKAWRKEMFKGLDSLEELSLDNCNIENLPADIFEYLPKLVKLSLRENPLEE------IPAVVAHLKSLKDIDLSVTNLTEIRDHAFAGDSDLEEIILEKMPFLTVVRDCGFCGLPQLKTLILNDNKYLQELHPNAFGYIKSQPGHKSAAITSLQIHNSNISTISEHMVDYDNLKTFQVGGNPWNCNCDTQFM---LEEKFAFKQDSVAPKCTSPAGLNGR 499          

HSP 2 Score: 50.8322 bits (120), Expect = 2.682e-6
Identity = 45/145 (31.03%), Postives = 72/145 (49.66%), Query Frame = 1
Query:  205 LTGNQITTLHESNFV-NLQKLLRLV-LDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRIL-APLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQL-TINSFYYLPKLEMLSLENNELTMLPEGIFR 627
             T N+I+ L     +   +K + ++ +  N I  I  + F P  +LT+L L +N     +L ++   +  A   +L RLDL YN++ V++D+ F   S +  L LD  G P++      F  L  LE LSL+N  +  LP  IF 
Sbjct:  185 FTKNKISRLQNDKVLPKFEKFVSILDVSYNEIRFIDNDVFKPFTNLTKLYLSHN-----VLQTVKKDVFDAAKNTLHRLDLGYNRIKVVSDNSFDTLSKLKVLSLD--GNPIKAWRKEMFKGLDSLEELSLDNCNIENLPADIFE 322          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: let-4 (Leucine-rich repeat-containing protein let-4 [Source:UniProtKB/Swiss-Prot;Acc:Q93373])

HSP 1 Score: 58.151 bits (139), Expect = 1.245e-8
Identity = 58/185 (31.35%), Postives = 85/185 (45.95%), Query Frame = 1
Query:  208 TGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDS-----------AGKP-LQ-----------LTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNL---DINNIRLANNPWNC 684
             GNQI  L+   F+N+  L  L L  N+I K+T   F     L  L L NN +     NS     L+ L  L++L L++N++  I+ + F NSS +  LVL S           +G P LQ           +  N+FY    L ML L  N+LT +    F +Q NL   D++  +L   P++ 
Sbjct:  240 AGNQIHELNRQAFLNVPSLRYLYLSGNKITKLTAYQFQTFEQLEMLDLTNNEIGAIPANS-----LSGLKQLRQLYLAHNKISNISSNAFTNSSIV-VLVLSSNELKTLTAGIISGLPNLQQVSFRDNQIKTINRNAFYDAASLVMLDLAKNQLTEIAPTTFLAQLNLLLVDLSENKLPKTPYSA 418          

HSP 2 Score: 49.6766 bits (117), Expect = 5.609e-6
Identity = 47/175 (26.86%), Postives = 88/175 (50.29%), Query Frame = 1
Query:  187 QTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPL-QLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLR 708
            Q ++LDLT N+I  +  ++   L++L +L L  N+I  I+ N F      T  S+    LS + L ++T  I++ L +L+++    NQ+  I  + F +++++  ++LD A   L ++   +F     L ++ L  N+L   P   F S+    +  + L  NP  C  +L  L+
Sbjct:  281 QLEMLDLTNNEIGAIPANSLSGLKQLRQLYLAHNKISNISSNAF------TNSSIVVLVLSSNELKTLTAGIISGLPNLQQVSFRDNQIKTINRNAFYDAASL--VMLDLAKNQLTEIAPTTFLAQLNLLLVDLSENKLPKTPYSAFNSR----VGTVLLKENPLVCTENLHMLQ 443          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: lron-9 (ELRR (Extracellular Leucine-Rich Repeat) ONly [Source:UniProtKB/TrEMBL;Acc:O02329])

HSP 1 Score: 56.6102 bits (135), Expect = 3.804e-8
Identity = 67/267 (25.09%), Postives = 106/267 (39.70%), Query Frame = 1
Query:  187 QTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFK-----------NSSTINSLVLDSAGKPLQLTINSFYY----------LPKLEMLSLENNELTMLPEGIFRSQT------NLDINNIR----------------LANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQ 858
            Q ++L L+G  I TL    F  L+KL  L L  N I  IT   F  L  LT LSL  N +S      +   +   L SL+ LDL +N++  I  D+FK            ++ I+ L     G   +L++    +           PKLE L L    ++ + E  F +Q       NL  N ++                +++NP+ C+  L      +E  +   + N +S     +   +   C  P   +G  + QV +  FQ
Sbjct:  257 QIEVLKLSGCSIPTLEPGQFATLKKLKELDLRVNLIENITAYAFDGLESLTRLSLAGNFIS-----KLEPDVFFGLSSLEELDLGWNEIKTIPTDVFKPLTDKLKTISLRNNPISELPSTGLGMLEKLSLAECGFTSISADQLKDYPKLEELDLSKCNISNIVENTFENQKDSLKKLNLQKNKLKSLPNLIKNLPAIESLDVSSNPYRCDGELVNFVFGVEDRVKKAEENGNS---FFVANTNETVCDRPYTLRGEQILQVEVEKFQ 515          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330734)

HSP 1 Score: 105.531 bits (262), Expect = 4.569e-23
Identity = 80/240 (33.33%), Postives = 120/240 (50.00%), Query Frame = 1
Query:  142 CIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQC 861
            C  + L  VP  I +  + L+L GN +T ++E++F  L KL  L L +N+I  I +N+F  L  L  L L NN L     N +T+       SL RLD+S N +  +   +FK + ++ SL LD+  +   L  ++F  L +LE+L+L NN LT LP  IF     L    +RL++NP+ C+C L WL   L S   + +L P +             C  P Q KG  +  +    F+C
Sbjct:   86 CSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSA-----SLLRLDISNNVITTVGRRVFKGAQSLRSLQLDN-NQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRL--RALRLSDNPFACDCHLSWLSRFLRS---ATRLAPYT------------RCQSPSQLKGQNVADLHDQEFKC 302          

HSP 2 Score: 68.1662 bits (165), Expect = 1.695e-11
Identity = 56/182 (30.77%), Postives = 87/182 (47.80%), Query Frame = 1
Query:  328 AHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKV 873
            A  +EL L++N +       I    +  L SL RLDLS NQ+ ++++  F N + +++L++ S  K   L  ++   L  L +LSL  N ++MLPEG F    +L   +I L +NP  C+C LKW          S  +  D   P +        C  P Q K   +   P +SF C+ +V
Sbjct:  766 AETSELYLESNEIE-----QIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLII-SYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSL--THIALGSNPLYCDCGLKW---------FSDWIKLDYVEPGIAR------CAEPEQMKDKLILSTPSSSFVCRGRV 924          

HSP 3 Score: 56.6102 bits (135), Expect = 6.527e-8
Identity = 53/185 (28.65%), Postives = 88/185 (47.57%), Query Frame = 1
Query:  319 LPLAHLTELSLKNNHLS-ISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTK 870
            +PL H TEL L +N L  IS     ++ +   L  L +L+L  NQL  I  + F+ +S I  L L    K  +++   F  L +L+ L+L +N+++ +  G F    +L   ++ LA+NP+NCNC L W    L      K LN  +             C  P + +   +  +P + F+C ++
Sbjct:  568 IPL-HTTELLLNDNELGRIS-----SDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQL-GENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSL--TSLNLASNPFNCNCHLAWFAEWLR----KKSLNGGA-----------ARCGAPSKVRDVQIKDLPHSEFKCSSE 728          

HSP 4 Score: 50.8322 bits (120), Expect = 4.443e-6
Identity = 58/224 (25.89%), Postives = 95/224 (42.41%), Query Frame = 1
Query:  112 PPQLDMGIYICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKK 783
            P +   GI  C  K L  VP  +   T  L L  N IT L   +F + ++L R+ L  N I +I  +    L  LT L L  N +       + + +   L SL+ L L+ N++  I  D F++  +++                         +LSL +N +  L  G F +  +  I  + LA NP+ C+C+L+WL   L    +        +SP  +H++
Sbjct:  322 PCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKI-----KDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLS-------------------------LLSLYDNNIQSLANGTFDAMKS--IKTVHLAKNPFICDCNLRWLADYLHKNPIETS-GARCESPKRMHRR 512          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330733)

HSP 1 Score: 104.76 bits (260), Expect = 6.905e-23
Identity = 80/240 (33.33%), Postives = 120/240 (50.00%), Query Frame = 1
Query:  142 CIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQC 861
            C  + L  VP  I +  + L+L GN +T ++E++F  L KL  L L +N+I  I +N+F  L  L  L L NN L     N +T+       SL RLD+S N +  +   +FK + ++ SL LD+  +   L  ++F  L +LE+L+L NN LT LP  IF     L    +RL++NP+ C+C L WL   L S   + +L P +             C  P Q KG  +  +    F+C
Sbjct:   86 CSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSA-----SLLRLDISNNVITTVGRRVFKGAQSLRSLQLDN-NQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRA--LRLSDNPFACDCHLSWLSRFLRS---ATRLAPYT------------RCQSPSQLKGQNVADLHDQEFKC 302          

HSP 2 Score: 68.1662 bits (165), Expect = 1.988e-11
Identity = 56/182 (30.77%), Postives = 87/182 (47.80%), Query Frame = 1
Query:  328 AHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKV 873
            A  +EL L++N +       I    +  L SL RLDLS NQ+ ++++  F N + +++L++ S  K   L  ++   L  L +LSL  N ++MLPEG F    +L   +I L +NP  C+C LKW          S  +  D   P +        C  P Q K   +   P +SF C+ +V
Sbjct:  766 AETSELYLESNEIE-----QIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLII-SYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSL--THIALGSNPLYCDCGLKW---------FSDWIKLDYVEPGIAR------CAEPEQMKDKLILSTPSSSFVCRGRV 924          

HSP 3 Score: 56.225 bits (134), Expect = 9.123e-8
Identity = 53/185 (28.65%), Postives = 88/185 (47.57%), Query Frame = 1
Query:  319 LPLAHLTELSLKNNHLS-ISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTK 870
            +PL H TEL L +N L  IS     ++ +   L  L +L+L  NQL  I  + F+ +S I  L L    K  +++   F  L +L+ L+L +N+++ +  G F    +L   ++ LA+NP+NCNC L W    L      K LN  +             C  P + +   +  +P + F+C ++
Sbjct:  568 IPL-HTTELLLNDNELGRIS-----SDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQL-GENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSL--TSLNLASNPFNCNCHLAWFAEWLR----KKSLNGGA-----------ARCGAPSKVRDVQIKDLPHSEFKCSSE 728          

HSP 4 Score: 50.447 bits (119), Expect = 4.797e-6
Identity = 58/224 (25.89%), Postives = 94/224 (41.96%), Query Frame = 1
Query:  112 PPQLDMGIYICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKK 783
            P +   GI  C  K L  VP  +   T  L L  N IT L   +F + ++L R+ L  N I +I  +    L  LT L L  N +       + + +   L SL+ L L+ N++  I  D F++  ++                          +LSL +N +  L  G F +  +  I  + LA NP+ C+C+L+WL   L    +        +SP  +H++
Sbjct:  322 PCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIK-----DLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSL-------------------------SLLSLYDNNIQSLANGTFDAMKS--IKTVHLAKNPFICDCNLRWLADYLHKNPIETS-GARCESPKRMHRR 512          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330731)

HSP 1 Score: 104.76 bits (260), Expect = 6.905e-23
Identity = 80/240 (33.33%), Postives = 120/240 (50.00%), Query Frame = 1
Query:  142 CIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQC 861
            C  + L  VP  I +  + L+L GN +T ++E++F  L KL  L L +N+I  I +N+F  L  L  L L NN L     N +T+       SL RLD+S N +  +   +FK + ++ SL LD+  +   L  ++F  L +LE+L+L NN LT LP  IF     L    +RL++NP+ C+C L WL   L S   + +L P +             C  P Q KG  +  +    F+C
Sbjct:   86 CSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSA-----SLLRLDISNNVITTVGRRVFKGAQSLRSLQLDN-NQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRA--LRLSDNPFACDCHLSWLSRFLRS---ATRLAPYT------------RCQSPSQLKGQNVADLHDQEFKC 302          

HSP 2 Score: 68.1662 bits (165), Expect = 1.988e-11
Identity = 56/182 (30.77%), Postives = 87/182 (47.80%), Query Frame = 1
Query:  328 AHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKV 873
            A  +EL L++N +       I    +  L SL RLDLS NQ+ ++++  F N + +++L++ S  K   L  ++   L  L +LSL  N ++MLPEG F    +L   +I L +NP  C+C LKW          S  +  D   P +        C  P Q K   +   P +SF C+ +V
Sbjct:  766 AETSELYLESNEIE-----QIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLII-SYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSL--THIALGSNPLYCDCGLKW---------FSDWIKLDYVEPGIAR------CAEPEQMKDKLILSTPSSSFVCRGRV 924          

HSP 3 Score: 56.225 bits (134), Expect = 9.123e-8
Identity = 53/185 (28.65%), Postives = 88/185 (47.57%), Query Frame = 1
Query:  319 LPLAHLTELSLKNNHLS-ISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTK 870
            +PL H TEL L +N L  IS     ++ +   L  L +L+L  NQL  I  + F+ +S I  L L    K  +++   F  L +L+ L+L +N+++ +  G F    +L   ++ LA+NP+NCNC L W    L      K LN  +             C  P + +   +  +P + F+C ++
Sbjct:  568 IPL-HTTELLLNDNELGRIS-----SDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQL-GENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSL--TSLNLASNPFNCNCHLAWFAEWLR----KKSLNGGA-----------ARCGAPSKVRDVQIKDLPHSEFKCSSE 728          

HSP 4 Score: 50.447 bits (119), Expect = 4.797e-6
Identity = 58/224 (25.89%), Postives = 94/224 (41.96%), Query Frame = 1
Query:  112 PPQLDMGIYICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKK 783
            P +   GI  C  K L  VP  +   T  L L  N IT L   +F + ++L R+ L  N I +I  +    L  LT L L  N +       + + +   L SL+ L L+ N++  I  D F++  ++                          +LSL +N +  L  G F +  +  I  + LA NP+ C+C+L+WL   L    +        +SP  +H++
Sbjct:  322 PCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIK-----DLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSL-------------------------SLLSLYDNNIQSLANGTFDAMKS--IKTVHLAKNPFICDCNLRWLADYLHKNPIETS-GARCESPKRMHRR 512          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: kek1 (gene:FBgn0015399 transcript:FBtr0346702)

HSP 1 Score: 91.6633 bits (226), Expect = 6.473e-19
Identity = 80/292 (27.40%), Postives = 137/292 (46.92%), Query Frame = 1
Query:  142 CIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFV--NLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELT-MLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFP-------MFQVPLNSFQCQTKVFTPQNNITTFIGLETSLVCVFHFAKHANSSITWYHNNK 987
            CI +HLI +P+ I   T++LD++GN++ TL    F+  NL  L +L L   +I +I + TF  L +L EL L +N     +L ++ +  L  + SL+ L L+ N +  I    F N+ +++ L L S      ++  +F  L  L +L L  N+L+ +LP+ I   +T   ++ I L +NPW C+C L+                   D+   L K++ P    P+   G P          + ++ F C+ ++    + +   +G   S+ C       AN  I WY N +
Sbjct:  107 CIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQFIRANLLNLQKLYLRNCKIGEIERETFKGLTNLVELDLSHN-----LLVTVPSLALGHIPSLRELTLASNHIHKIESQAFGNTPSLHKLDL-SHCDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKTI---ETLSRLHGIELHDNPWLCDCRLR-------------------DTKLWLMKRNIPYPVAPV-CSGGPERIIDRSFADLHVDEFACRPEMLPISHYVEAAMGENASITCRARAVPAAN--INWYWNGR 367          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: kek1 (gene:FBgn0015399 transcript:FBtr0332210)

HSP 1 Score: 91.6633 bits (226), Expect = 6.473e-19
Identity = 80/292 (27.40%), Postives = 137/292 (46.92%), Query Frame = 1
Query:  142 CIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFV--NLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELT-MLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFP-------MFQVPLNSFQCQTKVFTPQNNITTFIGLETSLVCVFHFAKHANSSITWYHNNK 987
            CI +HLI +P+ I   T++LD++GN++ TL    F+  NL  L +L L   +I +I + TF  L +L EL L +N     +L ++ +  L  + SL+ L L+ N +  I    F N+ +++ L L S      ++  +F  L  L +L L  N+L+ +LP+ I   +T   ++ I L +NPW C+C L+                   D+   L K++ P    P+   G P          + ++ F C+ ++    + +   +G   S+ C       AN  I WY N +
Sbjct:  107 CIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQFIRANLLNLQKLYLRNCKIGEIERETFKGLTNLVELDLSHN-----LLVTVPSLALGHIPSLRELTLASNHIHKIESQAFGNTPSLHKLDL-SHCDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKTI---ETLSRLHGIELHDNPWLCDCRLR-------------------DTKLWLMKRNIPYPVAPV-CSGGPERIIDRSFADLHVDEFACRPEMLPISHYVEAAMGENASITCRARAVPAAN--INWYWNGR 367          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrrc4ca (leucine rich repeat containing 4C, genome duplicate a [Source:ZFIN;Acc:ZDB-GENE-050522-533])

HSP 1 Score: 84.7297 bits (208), Expect = 9.224e-17
Identity = 112/451 (24.83%), Postives = 171/451 (37.92%), Query Frame = 1
Query:    7 LSMIEILIFVLILSAFTRGQSVKSRPRNSIFNRKCPPQLDMGIYICIRKHLIDVPDDIHSQTK------------------------LLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRI-------------------------------------------LAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFT-PQNNITTFIGLETSLVCVFHFAKHANS--SITWYHNNKRIVPSTRTHSQXXXXXXXXXXXXXXXXXYQDSGVYHCQIQAGKEFIKTTIYLNV 1149
            L ++ + + +L+++   R Q+  S          C         IC R+ L DVPD I + T+                        +L L+ N I  +    F  L  L  L L +NR+  I    F  L+ L EL L+NN +  SI +   NR+                                           L PL+ L  L++S NQL +I    FK    +  L +  A +   +  N+F  L  L  L+L +N LT+LP  +F    +L+   + L +NPWNCNC + WL   L      K++ P + S           C  P   KG  + ++  N F C   V   P  ++    G+   L C       ANS  S++W   N  I+  T    +   S       N ++V+ QD+G Y C +         +  LNV
Sbjct:   27 LFVLSLALQLLVVAGLVRAQTCPS---------VCSCSNQFSKVICTRRGLRDVPDGISTNTRYLNLQENLIQVIKVDSFKHLRHLEILQLSKNHIRNIEIGAFNGLANLNTLELFDNRLTTIPNGAFEYLSKLKELWLRNNPIE-SIPSYAFNRVPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLGMCNLKEIPNLIPLVRLDELEMSGNQLSIIRPGSFKGLVHLQKLWMMHA-QIQTIERNAFDDLQSLVELNLAHNNLTLLPHDLFTPLHHLE--RVHLHHNPWNCNCDILWLSWWL------KEMVPANTSCCA-------RCSSPTSHKGRYIGELDQNYFHCYAPVIVEPPADLNVTEGMAAELKC------RANSLTSVSWITPNGSIM--THGAYKIRISVLNDGTLNFTNVTMQDTGTYTCMVSNSAGNTTASATLNV 443          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: flrt2 (fibronectin leucine rich transmembrane protein 2 [Source:ZFIN;Acc:ZDB-GENE-070705-267])

HSP 1 Score: 83.1889 bits (204), Expect = 3.625e-16
Identity = 72/249 (28.92%), Postives = 110/249 (44.18%), Query Frame = 1
Query:  121 LDMGIYICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIW--KITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQC 861
            L + +    + HL  +P  + +  K L L  N+I  + E  F N+  L RL+LD N +    I   TF  L +L ELSL  N L+           L P +SL +L+L  NQ+  I                          + +F  L KLE L + NN L +LP G+F    +L I N R  NN W C+CS+KW+   L S+            PS ++ +   +C  P + +G  + ++ L++  C
Sbjct:  159 LSLKLLFLTKNHLSSIPIGLPADLKELRLDENRIADIDEDAFQNVTTLQRLLLDGNLLEDEAIAPGTFQDLVNLKELSLARNSLTAP-------PPLLPSVSLTKLNLQENQIDTIE-------------------------VTAFAGLSKLEKLDISNNLLQILPPGVFDGLRSLRILNAR--NNLWRCDCSIKWVIAWLRSL------------PSAINVR-GFTCQSPERVRGMVIRELTLDAIDC 360          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrfn4a (leucine rich repeat and fibronectin type III domain containing 4a [Source:ZFIN;Acc:ZDB-GENE-091113-56])

HSP 1 Score: 80.4925 bits (197), Expect = 3.054e-15
Identity = 84/324 (25.93%), Postives = 131/324 (40.43%), Query Frame = 1
Query:  139 ICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAP--------------------LLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNEL-TMLPEGIF-RSQTNL-------DINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFTPQ-NNITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVP-STRTHS 1017
            +C+ K L+ VP +I  +T  L L  N I  +  ++F N+  L+ L L  N I  +    F  L  L  L L  N L++     +T  +                       LL+L+ LDLSYN L  +  +  +N +++++L LD      Q+   SF  L KL  L + +N L T+ P+ +F RSQ  +        I ++    NP +CNC L WLR                    ++ +    +C  P    G   + +P   F C+  + T   N +    G   +L C           I W   + RIV  S+R  S
Sbjct:   97 LCVNKGLLFVPPNIDRRTVELRLADNYILEVGGADFANMTGLVDLTLSRNTIHALKPLAFADLESLRSLHLDTNRLTVVGPQDLTGLVNLQHLIINNNQLTDVSADAFDDFLLTLEDLDLSYNNLRRVPWESIQNMASLHTLNLDH-NLIDQIAEGSFGELYKLSRLDMTSNRLQTLPPDPLFSRSQIGVVSPTPYNSITSLNFGGNPLHCNCELLWLR-------------------RLIREDDMETCATPAHLAGRYFWSIPEEEFTCEPPLITRNTNKLWVLEGQRATLKC--RAIGDPEPVIHWVSPDDRIVANSSRIRS 398          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrfn4b (leucine rich repeat and fibronectin type III domain containing 4b [Source:ZFIN;Acc:ZDB-GENE-070705-473])

HSP 1 Score: 80.1073 bits (196), Expect = 3.744e-15
Identity = 88/324 (27.16%), Postives = 135/324 (41.67%), Query Frame = 1
Query:  139 ICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLS-------ISILN------------SITNRILAPLL-SLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNEL-TMLPEGIF-RSQTNL-------DINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFTPQ-NNITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVP-STRTHS 1017
            +C  K L+ VP +I  +T  L L  N I  +   +F N+  L+ L L  N I  I    F  L  L  L L  N LS       + +LN            +I++      L +L+ LDLSYN L  +  D  ++  ++++L LD      Q++  +F  L KL  L + +N L T+ P+ +F RSQT +        + N+    NP +CNC L WLR  + S  +                    +C  PL   G   + +P   F C+  + T   + +    G   +L C           I W   + RI+  S+RT S
Sbjct:  131 LCADKGLLFVPPNIDRRTVELRLADNFIREVGGVDFANMSGLVDLTLSRNTISHIRPLAFSDLESLRSLHLDGNRLSELGPRDLVGMLNLQHLILNNNQLTNISSEAFDDFLFTLEDLDLSYNNLRKVPWDAIQSMVSLHTLNLDH-NLIDQISEGTFSELYKLARLDMTSNRLQTLPPDPLFARSQTGVISPTPYNAVINLNFGGNPLHCNCELLWLRRLIRSDDME-------------------TCATPLHLAGRYFWSIPEEEFACEPPLITRHTHKLWVLEGQRATLKC--RAIGDPEPVIHWVSPDDRIIGNSSRTTS 432          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrrc4cb (leucine rich repeat containing 4C, genome duplicate b [Source:ZFIN;Acc:ZDB-GENE-080327-5])

HSP 1 Score: 77.7962 bits (190), Expect = 1.621e-14
Identity = 101/404 (25.00%), Postives = 156/404 (38.61%), Query Frame = 1
Query:  139 ICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLD------------------------ENRIWKITQNTFLPLAHLTELSLKNN----------------------------HLSISILNSITN-RIL-------------APLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKV-FTPQNNITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVPSTRTHSQXXXXXXXXXXXXXXXXXYQDSGVYHCQIQAGKEFIKTTIYLNV 1149
            IC R+ L DVPD + + T+ L+L  NQI  +   +F +L+ L  L L                         +NR+  I    F  L+ L EL L+NN                            ++S      ++N R L              PL+ L  L++S NQL VI    FK    +  L +  A +   +  NSF  L  L  L+L +N LT LP  ++    +L    + L +NPWNCNC + WL   L   +      P + S           C  P   KG  + ++  + FQC   V   P  ++    G+   L C      ++ +S++W   N  I+  T    +   +       N ++V+ QD+G Y C +         +  LNV
Sbjct:   62 ICTRRGLKDVPDGVSTNTRYLNLQDNQIQVIKVDSFKHLRHLEILQLSRNHIRNIEIGAFNGLTSLNTLELFDNRLTTIPNGAFEYLSKLKELWLRNNPIESIPSDAFSRLPSLRRLDLGELKRLSYISSGAFQGLSNLRYLNLGMCNLKEVPNIQPLIRLDELEMSGNQLTVIQPSSFKGLVHLQKLWMMHA-QVQTIERNSFDDLHSLRELNLAHNNLTFLPHDLYTPLHHLQ--RVHLHHNPWNCNCDILWLSWWLRETV------PTNTSCCA-------RCNSPPSLKGRYIGELDQSYFQCYAPVIIEPPVDLNLTEGMAAELKC----RTNSVTSVSWLTPNGSII--THGTLKMRINVQNDGTLNFTNVTLQDTGTYTCYVSNMLGNTSASAILNV 443          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: LRRC4C (leucine rich repeat containing 4C [Source:NCBI gene;Acc:100188921])

HSP 1 Score: 82.4185 bits (202), Expect = 7.783e-16
Identity = 104/409 (25.43%), Postives = 161/409 (39.36%), Query Frame = 1
Query:  139 ICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLD------------------------ENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRI-------------------------------------------LAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSL-VLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFT-PQNNITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVPSTRTHSQXXXXXXXXXXXXXXXXXYQDSGVYHCQIQAGKEFIKTTIYLNVVKS 1158
            IC R++L +VPD I + T+ L+L  NQI  +   +F +L+ L  L L                         +NR+  I    F  L+ L EL L+NN +  SI +   NRI                                           L PL+ L  LDLS N L V+    F+  + +  L ++ S  + ++   N+F  L  L  L+L +N LT+LP  +F    NL    I+L +NPWNCNC + WL   L+ I+ +                    C  P   KG  + ++  N F C   V   P  ++    G+   L C    A  + + ++W   N  I+  T    +   S       N ++V+ +D+G+Y C +         +  LNV  S
Sbjct:   61 ICTRRNLREVPDGISTNTRQLNLHENQIQIIKVDSFKHLRHLEVLQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFEYLSKLKELWLRNNPIE-SIPSYAFNRIPSLRRLDLGEMKRLSYISEGAFEGLSNLKYLNLGMCNLRDIPNLTPLVKLDELDLSGNHLSVLRPGSFQGLTHLQKLWIMHSQIQVIER--NAFDDLQSLVELNLAHNNLTLLPHDLFTPLHNLQ--RIQLHHNPWNCNCDILWLSWWLKEIVTTG-------------STCCARCSTPPSLKGTHIAELDHNYFTCYAPVIVEPPADLNVTEGMAAELKC---RASTSLTYVSWITPNGTIM--THGSYKVRISVLNDGTLNFTNVTVRDTGLYTCIVSNSAGNTTASATLNVTAS 446          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: islr2 (immunoglobulin superfamily containing leucine-rich repeat 2 [Source:NCBI gene;Acc:100145445])

HSP 1 Score: 80.8777 bits (198), Expect = 2.915e-15
Identity = 63/234 (26.92%), Postives = 113/234 (48.29%), Query Frame = 1
Query:  142 CIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVP 843
            C  K L  +P    S    L L+ N+IT+L +S+F+ + ++  L L  N I +I +      A  T ++LKN  +S ++L     R LA L +L+ + ++ N++  +  D F+N                         L +L+ L + NN+ +++ EG F+   +L  ++I++ NNP++C+CSL WL+   E    S            + +K N +C  P + KG P+ ++P
Sbjct:   37 CTYKKLQKIPSGFPSNVTTLSLSANKITSLKKSDFIGVPQVTSLWLAHNEISEIEEG-----ALATMVNLKNLDVSHNLLVEFPWRDLASLSALQLIKMNNNRMVNLPRDAFQN-------------------------LNELKSLRINNNQFSVIQEGTFKPLISL--SHIQIYNNPFHCSCSLMWLKKWAEEAQFS------------VPEKDNIACSSPEELKGTPISKIP 226          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: islr2 (immunoglobulin superfamily containing leucine-rich repeat 2 [Source:NCBI gene;Acc:100145445])

HSP 1 Score: 80.4925 bits (197), Expect = 3.704e-15
Identity = 63/234 (26.92%), Postives = 113/234 (48.29%), Query Frame = 1
Query:  142 CIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVP 843
            C  K L  +P    S    L L+ N+IT+L +S+F+ + ++  L L  N I +I +      A  T ++LKN  +S ++L     R LA L +L+ + ++ N++  +  D F+N                         L +L+ L + NN+ +++ EG F+   +L  ++I++ NNP++C+CSL WL+   E    S            + +K N +C  P + KG P+ ++P
Sbjct:   37 CTYKKLQKIPSGFPSNVTTLSLSANKITSLKKSDFIGVPQVTSLWLAHNEISEIEEG-----ALATMVNLKNLDVSHNLLVEFPWRDLASLSALQLIKMNNNRMVNLPRDAFQN-------------------------LNELKSLRINNNQFSVIQEGTFKPLISL--SHIQIYNNPFHCSCSLMWLKKWAEEAQFS------------VPEKDNIACSSPEELKGTPISKIP 226          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: vasn (vasorin [Source:NCBI gene;Acc:448556])

HSP 1 Score: 77.0258 bits (188), Expect = 3.991e-14
Identity = 69/226 (30.53%), Postives = 94/226 (41.59%), Query Frame = 1
Query:  199 LDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHL-------------------SISI--------------------LNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLR--MTLESIILSKQLNPD 753
            LDLT NQ+T +    F  L +L RL L+ NRI  I    F  +  L EL L NN L                   +I +                    L  +   +L+ L +L  LDLS NQL  +   L      +  L +       Q+ ++    LP L+ L L    L  LP+G+FRS   L    + LA NP+NC CSL WL   M +  ++L   L PD
Sbjct:  103 LDLTSNQLTEISADTFQGLSRLERLYLNGNRIRSIHPEAFKGIESLLELKLSNNQLVTPPAFSLPHLLLLDLSYNAIPVIQQGVFNAGNIESLRLAGLGLKEVPEELLSGLKNLHELDLSDNQLDKVPPGLHG----LTKLNIAGNVGFSQIQVDDLSNLPALQELDLSGLSLQTLPKGLFRSSKRL--RAVSLAQNPFNCVCSLGWLSEWMRVSGVVL---LRPD 319          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: vasn (vasorin [Source:NCBI gene;Acc:448556])

HSP 1 Score: 77.0258 bits (188), Expect = 4.343e-14
Identity = 69/226 (30.53%), Postives = 94/226 (41.59%), Query Frame = 1
Query:  199 LDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHL-------------------SISI--------------------LNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLR--MTLESIILSKQLNPD 753
            LDLT NQ+T +    F  L +L RL L+ NRI  I    F  +  L EL L NN L                   +I +                    L  +   +L+ L +L  LDLS NQL  +   L      +  L +       Q+ ++    LP L+ L L    L  LP+G+FRS   L    + LA NP+NC CSL WL   M +  ++L   L PD
Sbjct:  115 LDLTSNQLTEISADTFQGLSRLERLYLNGNRIRSIHPEAFKGIESLLELKLSNNQLVTPPAFSLPHLLLLDLSYNAIPVIQQGVFNAGNIESLRLAGLGLKEVPEELLSGLKNLHELDLSDNQLDKVPPGLHG----LTKLNIAGNVGFSQIQVDDLSNLPALQELDLSGLSLQTLPKGLFRSSKRL--RAVSLAQNPFNCVCSLGWLSEWMRVSGVVL---LRPD 331          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Igsf10 (immunoglobulin superfamily, member 10 [Source:MGI Symbol;Acc:MGI:1923481])

HSP 1 Score: 88.9669 bits (219), Expect = 9.360e-18
Identity = 80/279 (28.67%), Postives = 125/279 (44.80%), Query Frame = 1
Query:   82 PRNSIFNRKCPPQLDMGIYICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEM--------LSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLES----IILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFTP 882
            P + +  R+C   +   ++ C  ++L  +PD I +  + ++L  N +T L E++F  L +L  L+L  N I +++  TF  L  L  L +  N + I     I    L  L SL RL L +N +  I  + F    T+  LV     +  +L  ++F  L  L++        L L +N LT LP+ +  S  NL+  ++ L  NPW C+C LKWL   ++     I   K+  P S        +  P C  P   KG  +  VP  SF C      P
Sbjct:   24 PGSRVCPRRCACYVPTEVH-CTFRYLTSIPDGIPANVERVNLGYNSLTRLTENDFSGLSRLELLMLHSNGIHRVSDKTFSGLQSLQVLKMSYNKVQI-----IEKDTLYGLRSLTRLHLDHNNIEFINPEAFYGL-TLLRLVHLEGNRLTKLHPDTFVSLSYLQIFKTSFIKYLYLSDNFLTSLPKEMVSSMPNLE--SLYLHGNPWTCDCHLKWLSEWMQGNPDIIKCKKERIPSS-------PQQCPLCMNPRISKGRSIAMVPSGSFLCTKPTIDP 286          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Igsf10 (immunoglobulin superfamily, member 10 [Source:MGI Symbol;Acc:MGI:1923481])

HSP 1 Score: 88.9669 bits (219), Expect = 9.360e-18
Identity = 80/279 (28.67%), Postives = 125/279 (44.80%), Query Frame = 1
Query:   82 PRNSIFNRKCPPQLDMGIYICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEM--------LSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLES----IILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFTP 882
            P + +  R+C   +   ++ C  ++L  +PD I +  + ++L  N +T L E++F  L +L  L+L  N I +++  TF  L  L  L +  N + I     I    L  L SL RL L +N +  I  + F    T+  LV     +  +L  ++F  L  L++        L L +N LT LP+ +  S  NL+  ++ L  NPW C+C LKWL   ++     I   K+  P S        +  P C  P   KG  +  VP  SF C      P
Sbjct:   24 PGSRVCPRRCACYVPTEVH-CTFRYLTSIPDGIPANVERVNLGYNSLTRLTENDFSGLSRLELLMLHSNGIHRVSDKTFSGLQSLQVLKMSYNKVQI-----IEKDTLYGLRSLTRLHLDHNNIEFINPEAFYGL-TLLRLVHLEGNRLTKLHPDTFVSLSYLQIFKTSFIKYLYLSDNFLTSLPKEMVSSMPNLE--SLYLHGNPWTCDCHLKWLSEWMQGNPDIIKCKKERIPSS-------PQQCPLCMNPRISKGRSIAMVPSGSFLCTKPTIDP 286          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Igsf10 (immunoglobulin superfamily, member 10 [Source:MGI Symbol;Acc:MGI:1923481])

HSP 1 Score: 88.9669 bits (219), Expect = 9.360e-18
Identity = 80/279 (28.67%), Postives = 125/279 (44.80%), Query Frame = 1
Query:   82 PRNSIFNRKCPPQLDMGIYICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEM--------LSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLES----IILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFTP 882
            P + +  R+C   +   ++ C  ++L  +PD I +  + ++L  N +T L E++F  L +L  L+L  N I +++  TF  L  L  L +  N + I     I    L  L SL RL L +N +  I  + F    T+  LV     +  +L  ++F  L  L++        L L +N LT LP+ +  S  NL+  ++ L  NPW C+C LKWL   ++     I   K+  P S        +  P C  P   KG  +  VP  SF C      P
Sbjct:   24 PGSRVCPRRCACYVPTEVH-CTFRYLTSIPDGIPANVERVNLGYNSLTRLTENDFSGLSRLELLMLHSNGIHRVSDKTFSGLQSLQVLKMSYNKVQI-----IEKDTLYGLRSLTRLHLDHNNIEFINPEAFYGL-TLLRLVHLEGNRLTKLHPDTFVSLSYLQIFKTSFIKYLYLSDNFLTSLPKEMVSSMPNLE--SLYLHGNPWTCDCHLKWLSEWMQGNPDIIKCKKERIPSS-------PQQCPLCMNPRISKGRSIAMVPSGSFLCTKPTIDP 286          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Lrrc4c (leucine rich repeat containing 4C [Source:MGI Symbol;Acc:MGI:2442636])

HSP 1 Score: 85.5001 bits (210), Expect = 6.636e-17
Identity = 101/409 (24.69%), Postives = 164/409 (40.10%), Query Frame = 1
Query:  139 ICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLD------------------------ENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRI-------------------------------------------LAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFT-PQNNITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVPSTRTHSQXXXXXXXXXXXXXXXXXYQDSGVYHCQIQAGKEFIKTTIYLNVVKSS 1161
            IC+RK+L +VPD I + T+LL+L  NQI  +  ++F +L+ L  L L                         +NR+  I    F+ L+ L EL L+NN +  SI +   NRI                                           L PL+ L  LDLS N L  I    F+    +  L +  +   + +  N+F  L  L  ++L +N LT+LP  +F    +L+   I L +NPWNCNC + WL   +      + + P + +           C  P   KG  + ++  N F C   V   P  ++    G+   L C    A  + +S++W   N  ++  T    +   +       N ++V+ QD+G+Y C +         +  LNV  ++
Sbjct:   61 ICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIE-SIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQV-IERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLE--RIHLHHNPWNCNCDILWLSWWI------RDMAPSNTACCA-------RCNTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKC---RASTSLTSVSWITPNGTVM--THGAYKVRIAVLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASATLNVTAAT 447          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Lrrc4c (leucine rich repeat containing 4C [Source:MGI Symbol;Acc:MGI:2442636])

HSP 1 Score: 85.5001 bits (210), Expect = 6.636e-17
Identity = 101/409 (24.69%), Postives = 164/409 (40.10%), Query Frame = 1
Query:  139 ICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLD------------------------ENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRI-------------------------------------------LAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFT-PQNNITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVPSTRTHSQXXXXXXXXXXXXXXXXXYQDSGVYHCQIQAGKEFIKTTIYLNVVKSS 1161
            IC+RK+L +VPD I + T+LL+L  NQI  +  ++F +L+ L  L L                         +NR+  I    F+ L+ L EL L+NN +  SI +   NRI                                           L PL+ L  LDLS N L  I    F+    +  L +  +   + +  N+F  L  L  ++L +N LT+LP  +F    +L+   I L +NPWNCNC + WL   +      + + P + +           C  P   KG  + ++  N F C   V   P  ++    G+   L C    A  + +S++W   N  ++  T    +   +       N ++V+ QD+G+Y C +         +  LNV  ++
Sbjct:   61 ICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIE-SIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQV-IERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLE--RIHLHHNPWNCNCDILWLSWWI------RDMAPSNTACCA-------RCNTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKC---RASTSLTSVSWITPNGTVM--THGAYKVRIAVLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASATLNVTAAT 447          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P24014|SLIT_DROME (Protein slit OS=Drosophila melanogaster OX=7227 GN=sli PE=1 SV=2)

HSP 1 Score: 104.76 bits (260), Expect = 6.922e-22
Identity = 80/240 (33.33%), Postives = 120/240 (50.00%), Query Frame = 1
Query:  142 CIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQC 861
            C  + L  VP  I +  + L+L GN +T ++E++F  L KL  L L +N+I  I +N+F  L  L  L L NN L     N +T+       SL RLD+S N +  +   +FK + ++ SL LD+  +   L  ++F  L +LE+L+L NN LT LP  IF     L    +RL++NP+ C+C L WL   L S   + +L P +             C  P Q KG  +  +    F+C
Sbjct:   86 CSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSA-----SLLRLDISNNVITTVGRRVFKGAQSLRSLQLDN-NQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRA--LRLSDNPFACDCHLSWLSRFLRS---ATRLAPYT------------RCQSPSQLKGQNVADLHDQEFKC 302          

HSP 2 Score: 68.1662 bits (165), Expect = 1.993e-10
Identity = 56/182 (30.77%), Postives = 87/182 (47.80%), Query Frame = 1
Query:  328 AHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKV 873
            A  +EL L++N +       I    +  L SL RLDLS NQ+ ++++  F N + +++L++ S  K   L  ++   L  L +LSL  N ++MLPEG F    +L   +I L +NP  C+C LKW          S  +  D   P +        C  P Q K   +   P +SF C+ +V
Sbjct:  766 AETSELYLESNEIE-----QIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLII-SYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSL--THIALGSNPLYCDCGLKW---------FSDWIKLDYVEPGIAR------CAEPEQMKDKLILSTPSSSFVCRGRV 924          

HSP 3 Score: 56.225 bits (134), Expect = 9.145e-7
Identity = 53/185 (28.65%), Postives = 88/185 (47.57%), Query Frame = 1
Query:  319 LPLAHLTELSLKNNHLS-ISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTK 870
            +PL H TEL L +N L  IS     ++ +   L  L +L+L  NQL  I  + F+ +S I  L L    K  +++   F  L +L+ L+L +N+++ +  G F    +L   ++ LA+NP+NCNC L W    L      K LN  +             C  P + +   +  +P + F+C ++
Sbjct:  568 IPL-HTTELLLNDNELGRIS-----SDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQL-GENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSL--TSLNLASNPFNCNCHLAWFAEWLR----KKSLNGGA-----------ARCGAPSKVRDVQIKDLPHSEFKCSSE 728          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3V1M1|IGS10_MOUSE (Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2)

HSP 1 Score: 88.9669 bits (219), Expect = 6.547e-17
Identity = 80/279 (28.67%), Postives = 125/279 (44.80%), Query Frame = 1
Query:   82 PRNSIFNRKCPPQLDMGIYICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEM--------LSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLES----IILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFTP 882
            P + +  R+C   +   ++ C  ++L  +PD I +  + ++L  N +T L E++F  L +L  L+L  N I +++  TF  L  L  L +  N + I     I    L  L SL RL L +N +  I  + F    T+  LV     +  +L  ++F  L  L++        L L +N LT LP+ +  S  NL+  ++ L  NPW C+C LKWL   ++     I   K+  P S        +  P C  P   KG  +  VP  SF C      P
Sbjct:   24 PGSRVCPRRCACYVPTEVH-CTFRYLTSIPDGIPANVERVNLGYNSLTRLTENDFSGLSRLELLMLHSNGIHRVSDKTFSGLQSLQVLKMSYNKVQI-----IEKDTLYGLRSLTRLHLDHNNIEFINPEAFYGL-TLLRLVHLEGNRLTKLHPDTFVSLSYLQIFKTSFIKYLYLSDNFLTSLPKEMVSSMPNLE--SLYLHGNPWTCDCHLKWLSEWMQGNPDIIKCKKERIPSS-------PQQCPLCMNPRISKGRSIAMVPSGSFLCTKPTIDP 286          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6WRH9|IGS10_RAT (Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 2.434e-16
Identity = 79/277 (28.52%), Postives = 124/277 (44.77%), Query Frame = 1
Query:   82 PRNSIFNRKCPPQLDMGIYICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEM--------LSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLR--MTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFTP 882
            P +    R+C   +   ++ C  ++L  +PD I +  + ++L  N +T L E++F  L KL  L+L  N I +++  TF  L  L  L +  N + I     I       L SL RL L +N +  I  + F   +++  LV     +  +L  ++F  L  L++        L L +N LT LP+ +     NL+  ++ L  NPW C+C LKWL   M     I+  + +  S SP     +  P C  P   KG P   VP  +F C      P
Sbjct:   24 PGSRACPRRCACYVPTEVH-CTFRYLTSIPDGIPANVERINLGYNSLTRLTENDFDGLSKLELLMLHSNGIHRVSDKTFSGLQSLQVLKMSYNKVQI-----IRKDTFYGLGSLVRLHLDHNNIEFINPEAFYGLTSLR-LVHLEGNRLTKLHPDTFVSLSYLQIFKTSFIKYLFLSDNFLTSLPKEMVSYMPNLE--SLYLHGNPWTCDCHLKWLSEWMQGNPDIIKCKKDRSSSSP-----QQCPLCMNPRISKGRPFAMVPSGAFLCTKPTIDP 286          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9HCJ2|LRC4C_HUMAN (Leucine-rich repeat-containing protein 4C OS=Homo sapiens OX=9606 GN=LRRC4C PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.605e-16
Identity = 103/409 (25.18%), Postives = 161/409 (39.36%), Query Frame = 1
Query:  139 ICIRKHLIDVPDDIHSQTKLLDLTGNQI------------------------TTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRI-------------------------------------------LAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFT-PQNNITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVPSTRTHSQXXXXXXXXXXXXXXXXXYQDSGVYHCQIQAGKEFIKTTIYLNVVKSS 1161
            IC+RK+L +VPD I + T+LL+L  NQI                         T+    F  L  L  L L +NR+  I    F+ L+ L EL L+NN +  SI +   NRI                                           L PL+ L  LDLS N L  I    F+    +  L +  +   + +  N+F  L  L  ++L +N LT+LP  +F    +L+   I L +NPWNCNC + WL   +      K + P + +           C  P   KG  + ++  N F C   V   P  ++    G+   L C    A  + +S++W   N  ++  T    +   +       N ++V+ QD+G+Y C +         +  LNV  ++
Sbjct:   61 ICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIE-SIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQV-IERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLE--RIHLHHNPWNCNCDILWLSWWI------KDMAPSNTACCA-------RCNTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKC---RASTSLTSVSWITPNGTVM--THGAYKVRIAVLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASATLNVTAAT 447          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8C031|LRC4C_MOUSE (Leucine-rich repeat-containing protein 4C OS=Mus musculus OX=10090 GN=Lrrc4c PE=1 SV=2)

HSP 1 Score: 85.5001 bits (210), Expect = 4.642e-16
Identity = 101/409 (24.69%), Postives = 164/409 (40.10%), Query Frame = 1
Query:  139 ICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLD------------------------ENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRI-------------------------------------------LAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFT-PQNNITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVPSTRTHSQXXXXXXXXXXXXXXXXXYQDSGVYHCQIQAGKEFIKTTIYLNVVKSS 1161
            IC+RK+L +VPD I + T+LL+L  NQI  +  ++F +L+ L  L L                         +NR+  I    F+ L+ L EL L+NN +  SI +   NRI                                           L PL+ L  LDLS N L  I    F+    +  L +  +   + +  N+F  L  L  ++L +N LT+LP  +F    +L+   I L +NPWNCNC + WL   +      + + P + +           C  P   KG  + ++  N F C   V   P  ++    G+   L C    A  + +S++W   N  ++  T    +   +       N ++V+ QD+G+Y C +         +  LNV  ++
Sbjct:   61 ICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIE-SIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQV-IERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLE--RIHLHHNPWNCNCDILWLSWWI------RDMAPSNTACCA-------RCNTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKC---RASTSLTSVSWITPNGTVM--THGAYKVRIAVLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASATLNVTAAT 447          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A3P6H7Z1 (Ig-like domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS8697 PE=4 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 4.500e-35
Identity = 105/364 (28.85%), Postives = 168/364 (46.15%), Query Frame = 1
Query:  109 CPPQLDMGIYICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTE-LSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVI-TDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKV----------FTPQN---NITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVPSTR--THSQXXXXXXXXXXXXXXXXXYQDSGVYHCQIQAGKEFIKTTIYLNV 1149
            CPPQ+D+ ++ C R  L DVP   HS+T  +DL+ NQ+  LHE +F    +L +L+LD N+I+KIT      L+   E LSL+ N LS  I +      L  L +L+ LDLS N LGV+ T+ L     T+ +L L       ++   +F+ L  LE L   NN +  LPE  F+      +  + L +NPW+C+C L WLR  L+ +          D P    +    +C  P +F   P+  +PLN FQC   +          F  Q    ++   +G   +L C   F       + W+ N   + P  +   H+ +  +   + +   +  +  D+G Y C+    +   K   ++ +
Sbjct:   25 CPPQVDIHVFNCSRSGLADVPRRAHSETLTVDLSQNQLAILHEDSFAEYHRLSKLILDYNQIYKITDRAMNSLSLTLEYLSLRGNRLSNRISSDFAVSALHKLRNLRFLDLSENPLGVLGTNWLTPLGGTLRTLDLSGLVGETEIQEEAFFGLGHLEELDFSNNGIRSLPEDAFKGIRREKLAKLSLRDNPWHCDCKLLWLRQWLDDL---------RDRPLAHEQFATGTCSSPAEFDDAPLISLPLNRFQCPPMLQAMHSSAPYYFAQQGTTVHVVPSVGDSITLNCA--FVSQPKMLVKWFKNGVLLRPELKRFRHTVSKGTRFASVLTITALKAPGDNGNYTCKSSNNRGSAKGVFHVKI 377          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A0R3W0U6 (Ig-like domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS3313 PE=4 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 8.987e-35
Identity = 109/371 (29.38%), Postives = 170/371 (45.82%), Query Frame = 1
Query:  109 CPPQLDMGIYICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLA-HLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVI-TDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESI-ILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKV----------FTPQN---NITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVPSTRTHSQXXXXXXXXXXXXXXXXXY--QDSGVYHCQIQAGKEFIKTTIYLNVVKSSDE 1167
            CPPQ+D+ +  C R  L  VP  +H +T+ LDL+ N +  LHE +F    +L +L+LD N I+KIT      ++  L  LSL+ N LS+   ++     L  L +L+ LDLS N LGVI ++ L     T+ +L L S    ++L   +F+ L +LE L   NN    LPE  F       +  + L N PW+C+C L WLR  L  + I++    PD   P          C  P +F   P+ ++P++ FQC  K+          F  Q    +++  +G   +L C   F       + WY N   + P  +  +Q+    +  S     S      D+G Y C+    +   K   +L    S+ +
Sbjct:   32 CPPQVDIHLLNCSRSGLTSVPHRVHPETRTLDLSNNHLKVLHEDSFAEYYRLSQLILDYNDIYKITDKAMNSISTTLRLLSLRGNRLSVRASSNFPVSALTKLRNLRSLDLSENPLGVIFSNWLAPLGGTLRTLRLSSLIGQVELQDKTFFGLGRLEELDFSNNSFYHLPENAFFGIRPEKLEKLNLRNIPWHCDCKLLWLRQWLSRVNIITSPHEPDITGP----------CSYPPKFITVPLIRLPVSQFQCPPKLQSMHSSAPHYFGKQKALMHVSPSVGESVTLTCT--FVSQPKMLVQWYRNGALLRPELKRFAQSVTKGSKFSTILTISALRAPADNGNYTCKTSNNRGLAKGVFFLKSFNSARD 390          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A5K3FA63 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 9.355e-35
Identity = 90/253 (35.57%), Postives = 131/253 (51.78%), Query Frame = 1
Query:  109 CPPQLDMGIYICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTE-LSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVI-TDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQC 861
            CPPQ+D+ ++ C R  L DVP   HS+T  +DL+ NQ+  LHE +F    +L +L+LD N+I+KIT      L+   E LSL+ N LS  I +      L  L +L+ LDLS N LGV+ T+ L     T+ +L L       ++   +F+ L  LE L   NN +  LPE  F+      +  + L +NPW+C+C L WLR  L+ +          D P    +    +C  P +F   P+  +PLN FQC
Sbjct:   55 CPPQVDIHVFNCSRSGLADVPRRAHSETLTVDLSQNQLAILHEDSFAEYHRLSKLILDYNQIYKITDRAMNSLSLTLEYLSLRGNRLSNRISSDFAVSALHKLRNLRFLDLSENPLGVLGTNWLTPLGGTLRTLDLSGLVGETEIQEEAFFGLGHLEELDFSNNGIRSLPEDAFKGIRREKLAKLSLRDNPWHCDCKLLWLRQWLDDL---------RDRPLAHEQFATGTCSSPAEFDDAPLISLPLNRFQC 298          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A0R3X7X4 (Ig-like domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS9634 PE=4 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 1.576e-33
Identity = 112/368 (30.43%), Postives = 167/368 (45.38%), Query Frame = 1
Query:  109 CPPQLDMGIYICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAH-LTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVI-TDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESI-ILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKV----------FTPQN---NITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVPSTRTHSQXXXXXXXXXXXXXXXXXY--QDSGVYHCQIQAGKEFIKTTIYLNVVKS 1158
            CPPQ+D+ +  C    L  VP   H +T+ LDL+ N +  LHE +FV   +L +L+L+ N I+KIT      ++  L  LSL+ N LS+   ++     LA L +L+ LDLS N LGV+ T+ L     T+  L L S    ++L   +F+ L  LE     NN    LPE  F       +  + L N  W+C+C L WLR  L  I I++    PD   P          C  P +F   P+ ++P++ FQC  K+          F  QN   +I+  IG   +L C   F       + WY N   + P  +  +Q+    +  S     S     +D+G Y C+    +   K   +L V  S
Sbjct:   32 CPPQVDIHLLNCSGSGLTSVPHRGHPETRTLDLSNNHLKVLHEDSFVEYNRLSQLILNYNDIYKITDKAMDTISMTLRHLSLRGNRLSVRASSNFPVSALAKLRNLRSLDLSENPLGVMHTNWLAPLGGTMRILRLSSLIGQVELQPKTFFGLGLLEEFEFSNNTFYHLPENAFFGIRPEKLKKLNLRNILWHCDCKLLWLRQWLGKINIITPPHEPDITGP----------CSYPPKFSTVPLIRLPISQFQCPPKLQSMESNAPHYFGKQNALMHISPSIGESVTLTCT--FVSQPKMLVQWYRNGALLRPELKRFAQSVTKGSKFSTVLTISALRAPEDNGNYTCKTSNNRGLAKGVFFLKVFDS 387          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A068YAA2 (Leucine rich repeat containing protein 4 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000909100 PE=4 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 4.639e-33
Identity = 108/371 (29.11%), Postives = 167/371 (45.01%), Query Frame = 1
Query:  109 CPPQLDMGIYICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLA-HLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVI-TDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESI-ILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKV----------FTPQN---NITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVPSTRTHSQXXXXXXXXXXXXXXXXXY--QDSGVYHCQIQAGKEFIKTTIYLNVVKSSDE 1167
            CPPQ+D+ +  C    L  VP  +H +T+ LDL+ N +  LHE +F    +L +L+LD N I+KIT      ++  L  LSL+ N LSI   ++     L  L +L+ LDLS N LGVI T+ L     T+  L L S    ++L    F+ L +LE     NN L  LPE  F       +  + L N P++C+C L WLR  L  + I +    PD   P          C    +F   P+ ++P++ FQC  K+          F  Q    +++  +G   +L C   F       + WY N   ++P  +  +Q+    +  S     S      D+G Y C+    +   K   +L +  S+ +
Sbjct:   32 CPPQVDIHLLNCSGGGLTRVPHHVHPETRTLDLSNNHLKVLHEDSFGEYHRLSQLILDHNHIYKITDKAMNTISTTLRHLSLRGNQLSIRAPSNFPVSALTKLRNLRVLDLSENPLGVIFTNWLAPLGGTLRILRLSSLIGQVELQDKGFFGLGRLEEFDFSNNSLYHLPENAFFGIRPEKLKRLNLRNIPYHCDCKLLWLRQWLSGVKITTPPHEPDITGP----------CSYSHKFTTVPLIRLPISHFQCPPKLQSMHSSAPHYFAEQKALMHVSPSVGESVTLTCT--FVSQPKMLVQWYRNGALLIPELKRFAQSISKGSKFSTVLTISALRAPADNGNYTCKTSNNRGTAKGVFFLKIFNSASD 390          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrrc4ca (leucine-rich repeat-containing protein 4C [Source:NCBI gene;Acc:103046976])

HSP 1 Score: 83.9593 bits (206), Expect = 1.687e-16
Identity = 104/405 (25.68%), Postives = 156/405 (38.52%), Query Frame = 1
Query:  139 ICIRKHLIDVPDDIHSQTK------------------------LLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRI-------------------------------------------LAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFT-PQNNITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVPSTRTHSQXXXXXXXXXXXXXXXXXYQDSGVYHCQIQAGKEFIKTTIYLNV 1149
            IC R+ L DVPD I + T+                        +L L+ N I ++    F  L  L  L L +NR+  I    F  L+ L EL L+NN +  SI +   NR+                                           L PL+ L  L++S NQL VI    FK    +  L +  A +   +  N+F  L  L  L+L +N LT+LP  +F    +L+   + L +NPWNCNC + WL   L      K++ P + S           C  P   KG  + ++  N F C   V   P  ++    G+   L C       + +S++W   N  I+  T    +   S       N ++V+ QD+G Y C +         +  LNV
Sbjct:   62 ICTRRGLRDVPDGISTNTRYLNLQENLIQVIKVDSFKHLRHLEILQLSKNHIRSIEIGAFNGLASLNTLELFDNRLTTIPNGAFEYLSKLKELWLRNNPIE-SIPSYAFNRVPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLGMCNLKEIPNLIPLVRLDELEMSGNQLSVIRPGSFKGLVHLQKLWMMHA-QIQTIERNAFDDLQSLVELNLAHNNLTLLPHDLFTPLHHLE--RVHLHHNPWNCNCDILWLSWWL------KEMVPANTSCCA-------RCSTPTSHKGRYIGELDQNYFHCYAPVIVEPPADLNVTEGMAAELKC----RASSLTSVSWITPNGSIM--THGAYKVRISVLNDGTLNFTNVTMQDTGTYTCMVSNSAGNTTASATLNV 443          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrfn4a (leucine-rich repeat and fibronectin type-III domain-containing protein 4-like [Source:NCBI gene;Acc:103022039])

HSP 1 Score: 82.8037 bits (203), Expect = 4.989e-16
Identity = 89/319 (27.90%), Postives = 134/319 (42.01%), Query Frame = 1
Query:  139 ICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSI-------SILN----SITNRILAP---------LLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNEL-TMLPEGIF-RSQTNL-------DINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFTPQ-NNITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVPST 1005
            +C+ K L+ VP +I  +T  L L  N I  +  ++F N+  L+ L L  N I  +    F  L  L  L L  N L++        +LN     I N  L           LL+L+ LDLSYN L  +  +  +N +++++L LD      Q+   SF  L KL  L + +N L T+ P+ +F RSQ  +        I ++    NP +CNC L WLR          +L  + D           +C  PL   G   + +P   F C+  + T   N +    G   +L C           I W   + RIV +T
Sbjct:   87 LCVNKGLLFVPPNIDRRTVELRLADNYILEVGGADFANMTGLVDLTLSRNTIHALRPLAFADLESLRSLHLDTNRLTVVGPQDLTGLLNLQHLFINNNQLTDVSSDAFDDFLLTLEDLDLSYNNLRRVPWEAIQNMASLSTLNLDH-NLIDQIAEGSFGELYKLSRLDMTSNRLQTLPPDPLFSRSQIGVVSPTPYNAIISLNFGGNPLHCNCELLWLR----------RLTREDDM---------ETCATPLHLAGRYFWSIPEEEFTCEPPLITRNTNKLWVLEGQRATLKC--RSIGDPEPVIHWVSPDDRIVANT 383          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrfn4a (leucine-rich repeat and fibronectin type-III domain-containing protein 4-like [Source:NCBI gene;Acc:103022039])

HSP 1 Score: 82.8037 bits (203), Expect = 4.989e-16
Identity = 89/319 (27.90%), Postives = 134/319 (42.01%), Query Frame = 1
Query:  139 ICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSI-------SILN----SITNRILAP---------LLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNEL-TMLPEGIF-RSQTNL-------DINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFTPQ-NNITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVPST 1005
            +C+ K L+ VP +I  +T  L L  N I  +  ++F N+  L+ L L  N I  +    F  L  L  L L  N L++        +LN     I N  L           LL+L+ LDLSYN L  +  +  +N +++++L LD      Q+   SF  L KL  L + +N L T+ P+ +F RSQ  +        I ++    NP +CNC L WLR          +L  + D           +C  PL   G   + +P   F C+  + T   N +    G   +L C           I W   + RIV +T
Sbjct:   87 LCVNKGLLFVPPNIDRRTVELRLADNYILEVGGADFANMTGLVDLTLSRNTIHALRPLAFADLESLRSLHLDTNRLTVVGPQDLTGLLNLQHLFINNNQLTDVSSDAFDDFLLTLEDLDLSYNNLRRVPWEAIQNMASLSTLNLDH-NLIDQIAEGSFGELYKLSRLDMTSNRLQTLPPDPLFSRSQIGVVSPTPYNAIISLNFGGNPLHCNCELLWLR----------RLTREDDM---------ETCATPLHLAGRYFWSIPEEEFTCEPPLITRNTNKLWVLEGQRATLKC--RSIGDPEPVIHWVSPDDRIVANT 383          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrfn4a (leucine-rich repeat and fibronectin type-III domain-containing protein 4-like [Source:NCBI gene;Acc:103022039])

HSP 1 Score: 82.0333 bits (201), Expect = 6.460e-16
Identity = 99/359 (27.58%), Postives = 148/359 (41.23%), Query Frame = 1
Query:  139 ICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSI-------SILN----SITNRILAP---------LLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNEL-TMLPEGIF-RSQTNL-------DINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFTPQNN-ITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVPST-RTHSQXXXXXXXXXXXXXXXXXYQDSGVYHC-QIQAGKE 1119
            +C+ K L+ VP +I  +T  L L  N I  +  ++F N+  L+ L L  N I  +    F  L  L  L L  N L++        +LN     I N  L           LL+L+ LDLSYN L  +  +  +N +++++L LD      Q+   SF  L KL  L + +N L T+ P+ +F RSQ  +        I ++    NP +CNC L WLR          +L  + D           +C  PL   G   + +P   F C+  + T   N +    G   +L C           I W   + RIV +T R  S  + + +            +D GVY C  I A  E
Sbjct:   36 LCVNKGLLFVPPNIDRRTVELRLADNYILEVGGADFANMTGLVDLTLSRNTIHALRPLAFADLESLRSLHLDTNRLTVVGPQDLTGLLNLQHLFINNNQLTDVSSDAFDDFLLTLEDLDLSYNNLRRVPWEAIQNMASLSTLNLDH-NLIDQIAEGSFGELYKLSRLDMTSNRLQTLPPDPLFSRSQIGVVSPTPYNAIISLNFGGNPLHCNCELLWLR----------RLTREDDM---------ETCATPLHLAGRYFWSIPEEEFTCEPPLITRNTNKLWVLEGQRATLKC--RSIGDPEPVIHWVSPDDRIVANTSRIRSYYNGTLDFLVTRA------RDDGVYTCIAINAAGE 366          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000025613.2 (leucine-rich repeat transmembrane protein FLRT1 [Source:NCBI gene;Acc:103040256])

HSP 1 Score: 80.4925 bits (197), Expect = 2.032e-15
Identity = 62/194 (31.96%), Postives = 88/194 (45.36%), Query Frame = 1
Query:  148 RKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIW--KITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLES 723
            R HL  +P  + +  + L L  N+I+T+    F  L  L RLVLD N +   +I  +TF  L++LTELSL  N L    LN        P   L+RL L  N L                         + +   S   + +L+ L L  N LT LP G+FR   +L    + +  NPW+C C+L+WL   LE+
Sbjct:  176 RNHLSSIPSGLPASLEELRLDDNRISTIPTHAFRGLSSLRRLVLDGNLLANQRIADDTFSRLSNLTELSLVRNSLQTPPLN-------LPSAHLQRLSLQDNAL-------------------------IHMPRGSLDGMRRLQRLDLSGNNLTTLPRGLFRDLESL--GQLLVRGNPWHCGCNLRWLYDWLEA 335          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004916.1 (pep scaffold:Pmarinus_7.0:GL476584:229610:304495:-1 gene:ENSPMAG00000004069.1 transcript:ENSPMAT00000004916.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.7962 bits (190), Expect = 2.211e-16
Identity = 70/242 (28.93%), Postives = 109/242 (45.04%), Query Frame = 1
Query:  109 CPPQLDM-GIYI-CIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSI-------------------SILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCS-----LKWLRMTLESIILSKQLNPDS 756
            CP Q    G  + C  + L  VP  I + T++L L  N+IT L    F +L  L +L L  NR+  I    F  L +L EL L +N L+                    + L  +   +   L++L++L L  NQL  + D +F   + +  L L++  K   + I +F  L +L +L L +N+L  LP G+F    NL    + L+NN W+C C+       W+      +   +  NPDS
Sbjct:    2 CPSQCSCSGTQVNCHERRLASVPAGIPTTTQVLYLYTNKITKLEPGVFDSLVNLQQLYLHLNRLSSIPAGMFDKLTNLKELKLYSNQLTALPEGVFDKLTQLTLLELQNNQLKGVPRGLFDRLVNLQQLYLGGNQLSALPDGVFDKLTQLTHLGLNNQLK--NVPIGAFQRLTQLTILDLNSNQLQALPAGLFDRLGNLQ--QLDLSNNKWDCACTDIMYLSTWIGQNSGKVTKDRVNNPDS 239          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: lrig3 (leucine-rich repeats and immunoglobulin-like domains 3 [Source:NCBI gene;Acc:564554])

HSP 1 Score: 77.7962 bits (190), Expect = 2.310e-15
Identity = 78/278 (28.06%), Postives = 123/278 (44.24%), Query Frame = 1
Query:  184 SQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDL---FKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFTPQNNI--TTFIGLETS---LVCVFHFAKHANSSITWYHNNKRI 993
            S  + L+++ N ++ +    +   QKL  L L  N + +I + TF+ L  L  L L +NHLS     +I +     L SL  LDL+ N++    +D+   F     +N LVL S  K   +   +F  L +L  L L NN L  + +G F S   L    +RL ++   C+C+LKWL   LE       +  D              C  P   KG  +F V  +S+ C T    PQ ++   T + L +S    VC    +  +  + +W  +N+ I
Sbjct:  160 SSLQQLNMSHNNVSRIDLDAWEFCQKLDELDLSHNHLSRIEEGTFVGLGMLRSLLLAHNHLS-----NIADGAFKELRSLLTLDLAGNEISWTIEDMHGAFTGLENLNKLVL-SENKIKSIAKKAFIGLERLHSLDLSNNALMSIQDGSFSSLKAL--TEMRLNSSSLLCDCTLKWLSPWLEERGFRDTVEAD--------------CAHPEWLKGRDIFSVEPDSYVCDT-FPKPQISVQPETTMALRSSNVTFVCSARSSSDSPITFSWKKDNEVI 414          

HSP 2 Score: 47.3654 bits (111), Expect = 7.133e-6
Identity = 45/153 (29.41%), Postives = 73/153 (47.71%), Query Frame = 1
Query:  199 LDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIF---RSQTNLDI 648
            L+LT N+I  +   +F  L+ L  L L  N I ++    F  L  L  L     HL  + L ++T   L  L SL++L++S+N +  I  D ++    ++ L L S     ++   +F  L  L  L L +N L+ + +G F   RS   LD+
Sbjct:   93 LELTRNRIKRIESLSFFGLESLQSLRLQRNNIGRLMDGAFWRLEKLEIL-----HLDFNALTNVTKGWLYGLSSLQQLNMSHNNVSRIDLDAWEFCQKLDELDL-SHNHLSRIEEGTFVGLGMLRSLLLAHNHLSNIADGAFKELRSLLTLDL 239          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004394.1 (pep scaffold:Pmarinus_7.0:GL476584:2351:149177:1 gene:ENSPMAG00000004005.1 transcript:ENSPMAT00000004394.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 2.024e-14
Identity = 57/182 (31.32%), Postives = 82/182 (45.05%), Query Frame = 1
Query:  142 CIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCN 687
            C  K L  VP  I + T  L+L  NQIT L    F  L  L+   L ENR+  + +  F  L +L +L L  N LS     ++  R+   L  L  L+LS N+L  +   +F +                         L +L +L+L++N+L  LP G+F    NL    I L+NN W+CN
Sbjct:   10 CAGKSLASVPAGIPTTTHYLNLNSNQITKLEPGVFDRLTALVEARLSENRLMVVPEGVFDNLVNLQKLYLYTNQLS-----ALPVRMFDKLTQLTTLNLSENKLTALPAGVFDS-------------------------LTELTILALDSNQLQALPVGVFDRLGNLQ--QINLSNNQWDCN 159          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: LINGO2 (leucine rich repeat and Ig domain containing 2 [Source:HGNC Symbol;Acc:HGNC:21207])

HSP 1 Score: 74.7146 bits (182), Expect = 2.470e-14
Identity = 51/172 (29.65%), Postives = 89/172 (51.74%), Query Frame = 1
Query:  109 CPPQLDMGI----YICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLP 612
            CP + D        +C R+ L+ +P+ I ++T+LLDL+ N++  L   +F +  +L  L L+EN I  +    F  L HL  L ++ N + +     I   + A L +L RLD+S N++ V+ D  F++   +  L +    + + +T ++F  L  L  L+LE   LT +P
Sbjct:   45 CPARCDCSAPLRSVVCHRRKLVSIPEGIPTETRLLDLSKNRLRALSAGDFASHGQLEELQLNENVIAGVEPGAFGGLPHLRALGMRGNRIKL-----IPPGVFAGLGNLTRLDVSENKIVVLLDFAFRDLRRLLELRVGD-NELVYVTRHAFAGLAALRELALERCNLTAVP 210          

HSP 2 Score: 53.5286 bits (127), Expect = 1.174e-7
Identity = 50/202 (24.75%), Postives = 85/202 (42.08%), Query Frame = 1
Query:  358 NHLSISILNSITNRI----LAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMP-----LQFKGFPMFQVPLNSFQCQTKVFTPQ--NNITTFIGLETSLVC 930
            N  S+S+ N+   R+    L  L+ L+ LDLS+N +  +    F   + +  L ++  G  L +   +   + +L +L+L  N L  L EG   S   L++  +RL  NP  C+C L W+      + L+++     D          PSC  P      +F   P   +P     C+    +P+    +T   G    L+C
Sbjct:  267 NLTSLSVTNTNITRVPRLALQTLVHLRTLDLSFNAIASVEAGAFATLTRLRELRMERTGL-LVVEPRALQGVEQLGLLNLSGNGLRTLEEGALDSPGLLEV--LRLDGNPLACDCRLLWV------VALNRRGGLSFDG-------REPSCDAPESVSGAEFADLPE-PLPKGYLACRRPRISPRRTQQLTAVEGQAVHLMC 451          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: lingo4b (leucine rich repeat and Ig domain containing 4b [Source:ZFIN;Acc:ZDB-GENE-091214-3])

HSP 1 Score: 71.633 bits (174), Expect = 2.129e-13
Identity = 51/170 (30.00%), Postives = 92/170 (54.12%), Query Frame = 1
Query:  106 KCPPQLDMGIYICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPE 615
            +C P  +  + +C RK L+ +PD I   T++LDL+ N++  ++  +F    +L  L L EN I  I    F  L HL  + L++N L +     I+  + A L +L +LD+S N++ ++ D +F N   +  L++ +    + ++ ++F  L  LE L+LE   LT++P 
Sbjct:   43 ECLPSPNWSV-VCHRKRLLTIPDGIPIDTRVLDLSKNRLKCINYGDFSGYPQLQELDLHENVISNIEPGAFNNLHHLHTIHLQSNRLKL-----ISMGVFAGLQNLTQLDISENKIVILLDYMFHNLHNLRWLMM-AENDVVYISQHAFSGLYSLEQLTLEKYNLTVVPR 205          

HSP 2 Score: 53.5286 bits (127), Expect = 1.137e-7
Identity = 56/205 (27.32%), Postives = 94/205 (45.85%), Query Frame = 1
Query:  250 NLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQ 864
            + ++L+RL + E   W       LP   L  L+L +  ++   L +  +  +  L+ L+ L+LS+N LGVI      +   +  L + +A + L +   +F  L  L +L+   N LT L E +F++  NLD+  +RL  NP  C+C L W+      +       P   +P  +H +         + K FP   +P N F CQ
Sbjct:  231 SFKRLVRLKILEIDHWPYLSR--LPPKSLYGLNLTSLSVTHCNLTTFPHAAMHHLVYLRYLNLSHNPLGVIEAHALSDLVRLTELHVSNA-QLLAIEPQAFSGLLHLRVLNTSGNLLTTLEENVFQALGNLDV--LRLDGNPLACDCRLLWILRRRRRLNFDGH-QPICATPDYVHGQ---------ELKDFPEILLP-NHFTCQ 419          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO48179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK32])

HSP 1 Score: 57.7658 bits (138), Expect = 1.137e-8
Identity = 67/267 (25.09%), Postives = 110/267 (41.20%), Query Frame = 1
Query:  199 LDLTGNQITTLHESNFVNLQK---LLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDL---FKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFTPQNNI-----TTFIGLETSLVCVFHFAKHANSSI 966
            L L  NQI+T+  + F + +    L +L L+ NR+  I   TF  L  L  L+L NN +       I+    + L SL+ LDLS N +    +++   F+  + + SL LD   +   +   +F  L  ++ L+L  N +T + E  F+    L    + L  +   C+C +KW    L S             PS  H      C  P       +F +  ++F C T    PQ ++         G   +L C     +  +SS+
Sbjct:  324 LYLQSNQISTIITTKFADWRSFPVLRKLNLERNRLSHIQDTTFKHLLALKVLNLANNRIY-----HISQGSFSDLRSLEGLDLSNNDISWTVEEMNGPFRGLTNLASLRLD-GNRITAIAATAFLGLENIKYLNLSANIITSIQENSFQGMDKL--QKLWLNTSQLMCDCKIKWFGSWLRS------------RPSTRHTVR-ARCLHPQTLYMKSVFNITPDAFVCDTSNPIPQISVHPPSQKAMRGDNVTLRCRVQVVQRNSSSV 569          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO49136 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGZ6])

HSP 1 Score: 56.225 bits (134), Expect = 1.819e-8
Identity = 48/169 (28.40%), Postives = 75/169 (44.38%), Query Frame = 1
Query:  139 ICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLD 645
            +C R+ L   P  +   T  LDL GN + T+      NL++LL L L  N+I  I   TF  +A                              L+ LDLS NQL  I++ +F     + +L L    + L L  + F+  P L++LS+  N +T L + +FR+  +L+
Sbjct:   36 VCRRQDLWLAPPGVSPHTTHLDLLGNLLITVTRGYLRNLRQLLELNLGMNQIDYIASGTFTDMA-----------------------------KLELLDLSGNQLTFISEGMFTGLRNLTTLFL-FMNEILDLPASLFWGTPNLKILSINRNNITKLHQHLFRNSLHLE 174          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO35407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLJ8])

HSP 1 Score: 51.9878 bits (123), Expect = 2.172e-7
Identity = 46/144 (31.94%), Postives = 72/144 (50.00%), Query Frame = 1
Query:  193 KLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQ-LGV-ITDDLFKNSSTINSLVLDSAG--KPLQLTINSFYYLPKLEMLSLENNELTMLP 612
            K LDL+ N I+ + +  F NL+ L +L L EN+I  ++ + F  L  L +L L+ N L      ++   +  PL SL+ L L  N+ +G  I +  F     +  L + + G  K  Q T  S   L  L++L + NN LT +P
Sbjct:   21 KWLDLSNNDISDIQDGTFENLRYLKQLNLGENKIRTVSASMFKGLVSLEKLDLRFNDLK-----ALPRGVFKPLKSLRELFLHDNRNMGSRIEEGAFNGLDNLRKLHVSATGMKKITQGTFGSLMSLEFLDVLHINNNSLTTVP 159          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO47109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNB0])

HSP 1 Score: 52.7582 bits (125), Expect = 2.723e-7
Identity = 65/240 (27.08%), Postives = 98/240 (40.83%), Query Frame = 1
Query:  193 KLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAH-LTELSLKNNHLSISILNSITNRILAPL---------------LSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPL-QLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQC 861
            + L L  N I T+ +  F     L+ L +  NR+ +    T   L+  LTEL L++N L    +    N  L  L               LSL++L L  N+L  I +   K    +  L  D +G  L ++T +    L  +E L L  N ++ +  G  R    L    I L+ NP +C+C L WL+  L+    S+Q      SP       + +C  P   KG     +   SF C
Sbjct:  147 RYLSLRHNSIRTIGDGAFRFSAFLICLDISFNRLSEFKTETLRGLSSTLTELRLRSNILRRVAIKRRFNITLLDLGDNLLEVFEVDAFDGLSLRKLRLDGNKLDEIPEAFAKVGHFLQEL--DMSGNYLHEITSDQLLDLHAIERLDLNENNISKIRIGALRGMKKL--RQISLSGNPLSCDCRLVWLKHVLD----SRQDQLHLSSP------QSTTCASPASVKGQTFLGLDARSFLC 372          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO39412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA74])

HSP 1 Score: 52.7582 bits (125), Expect = 3.143e-7
Identity = 64/203 (31.53%), Postives = 86/203 (42.36%), Query Frame = 1
Query:  142 CIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLP-LAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSST------------------------INSLVLDSAGKPLQLTINSFY-YLPKLEMLSLENNELTMLPEGIFRSQTNLD---INNIRL 663
            C  K+L   PD + + T  L LT N++  L     + L+ L  L L +NRI  ++    L  L  LT L L NN      L+SI       L SLK   +  NQ+  + DD+F+N S                         ++ L L S G  +    N F  Y P LE L L NN+L  LP  +F + T L    INN  L
Sbjct:   43 CRGKYLTSFPDQVDNTTVELILTYNRLKALPPYP-LQLENLTILDLHDNRINNLSNCASLKGLRRLTILYLSNN-----FLDSIPGGCFLDLKSLKHFFVGDNQIKKVADDVFQNVSNGFKLDIGRNKMNGVPDAVKRVMDRLSYLWLSSTG--ITEIPNGFLDYFPALEALYLSNNKLEQLPSALFNNNTRLQYLYINNNEL 237          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lrrc4cb (leucine rich repeat containing 4C [Source:NCBI gene;Acc:101160634])

HSP 1 Score: 88.5817 bits (218), Expect = 4.658e-18
Identity = 112/450 (24.89%), Postives = 178/450 (39.56%), Query Frame = 1
Query:    7 LSMIEILIFVLILSAFTRGQSVKSRPRNSIFNRKCPPQLDMGIYICIRKHLIDVPDDIHSQTK------------------------LLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRI-------------------------------------------LAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSL-VLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFT-PQNNITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVPSTRTHSQXXXXXXXXXXXXXXXXXYQDSGVYHCQIQAGKEFIKTTIYLNV 1149
            L ++ + + +L+++   R Q+  S          C         IC R+ L DVPD I + T+                        +L L+ N I ++    F  L  L  L L +NR+  I    F  L+ L EL L+NN +  SI +   NR+                                           + PL+ L+ L++S NQL VI    F   + +  L ++ S  + ++   NSF  L  L  L+L +N LT LP  +F    +L+   + L +NPWNCNC + WL   L+  + +          S   + H PS      FKG  + ++  + FQC   V   P +++    G+   L C      ++ +SI+W   N  +V  T    +   S       N +SV+ QD+G Y C +      I  +  LNV
Sbjct:   27 LFVLLLALHILVVAGLVRAQTCPS---------VCSCSNQFSKVICTRRSLRDVPDGISTNTRYLNLQDNLIQVIKVDSFKHLRHLEILQLSKNHIRSIEIGAFNGLASLNTLELFDNRLTTIPNGAFEYLSKLKELWLRNNPIE-SIPSYAFNRVPSLRRLDLGELKRLSYISELAFKDLSNLRYLNLGMCNLKEIPNIIPLVKLEELEMSGNQLTVIKPSSFTGLANLQKLWMMHSQVQTIER--NSFDDLQSLVELNLAHNNLTFLPHDLFTPLHHLE--RVHLHHNPWNCNCDILWLSWWLKETVPANT--------SCCARCHTPSV-----FKGRYIGELDHSYFQCDVPVIVEPPSDLNVTEGMGAELKC----RTNSMTSISWLTPNGSMV--THGAYKVRLSVLNDGTLNFTSVTMQDTGTYTCMVSNTAGNISASAVLNV 443          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000037040.1 (pep primary_assembly:ASM223467v1:2:3885569:3886678:1 gene:ENSORLG00000030416.1 transcript:ENSORLT00000037040.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.7962 bits (190), Expect = 4.804e-15
Identity = 83/327 (25.38%), Postives = 131/327 (40.06%), Query Frame = 1
Query:    1 SFLSMIEILIFVLILSAFTRGQSVKSRPRNSIFNRKCPPQLDMGIYICIRKHLIDVPDDIHSQTKLLDLT------------------------GNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINN-----------------------IRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQV 840
             FL  + +L++++          V SR   +  +  C  + D+   IC R      P  I   T+LLDL+                         N I+ + + +F  L+ L +L L  NRI  +T    + L  L EL L +NHL+     S+  R    L SL+RL+L+ N++  I    F + S++  L L+   +   LT  +F  L  LE+L+L  N +  +  G+F   T+L + N                       I L  NPWNC C L+ +   L SI               L   +N +C  P   +G+ +  V
Sbjct:   13 GFLGQVMLLLWLV--------AQVSSRSNVTRCDPGCDCREDLRFTICSRAFFTQPPGIIPDSTELLDLSDNLISVIPKHTFDKNRKLRVLLVQNNNISVVEDGSFSQLEFLQKLDLSWNRICTLTAGFSVGLTFLRELQLAHNHLT-----SLDTRSFLHLDSLQRLNLTSNRIQAIHSRSFTSMSSLRQLHLED-NRLTSLTSGAFSMLRSLEILNLAGNRIGTMDTGVFNPLTSLTLLNLADNQLSSVGFKTFLSIHSYSTHILLQGNPWNCECELQRVFRKLRSI-----------QRLFLDDYYNLTCREPAVLQGYLLMDV 314          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000036623.1 (carboxypeptidase N subunit 2-like [Source:NCBI gene;Acc:105353900])

HSP 1 Score: 77.411 bits (189), Expect = 1.866e-14
Identity = 62/174 (35.63%), Postives = 87/174 (50.00%), Query Frame = 1
Query:  199 LDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLK----WLR 708
            L L  N +T L E  FV   KL  L L++N++  +    F  +  LTELSL+ N+LS     ++   I +PL  +K+LDLS N    ++ D F     +  L L    +   L  N F  L  L  L L NN L  LP  IF     L  + + L+NNPW+C+C+LK    W+R
Sbjct:  166 LYLDNNLLTGLPEGYFVGFPKLKVLTLNKNKLNSLPSVLFGEMPKLTELSLQLNNLS-----TLPTGIFSPLKKVKKLDLSKNHFVTLSADYFLGPEKLTDLNLQH-NQIKTLDANLFENLQSLTSLKLSNNNLHALPGNIFEPLVKL--SKLDLSNNPWHCDCNLKDLHGWIR 331          

HSP 2 Score: 57.3806 bits (137), Expect = 3.649e-8
Identity = 53/147 (36.05%), Postives = 72/147 (48.98%), Query Frame = 1
Query:  184 SQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIF 624
            S  + L L  N+++ L    F  L KL  L L EN+I  I    F  L +L +LSL  N+L+     S++    + L  LK L +  NQL  I +DL KN   +  + L    +   L  N F +  KL  L L+NN LT LPEG F
Sbjct:   41 SNLETLILKFNKLSGLQNGLFEGLGKLRDLQLHENKIQVIEDQVFQGLDNLEKLSLAKNNLT-----SVSTDWFSDLKKLKVLRIYDNQLTTIPEDLLKNFPNLEEVGL-QGNQITSLPPNLFPHKNKLTKLYLDNNLLTGLPEGYF 181          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lrrc4bb (leucine-rich repeat-containing protein 4B [Source:NCBI gene;Acc:101159140])

HSP 1 Score: 77.411 bits (189), Expect = 2.224e-14
Identity = 99/406 (24.38%), Postives = 155/406 (38.18%), Query Frame = 1
Query:  139 ICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTF--LP----------------------LAHLTELSLKNN--------------------------------------------HLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFT-PQNNITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVPSTRTHSQXXXXXXXXXXXXXXXXXYQDSGVYHCQIQAGKEFIKTTIYLNV 1149
            IC RK+L  +PD I   T+ L+L  N I  +    F +L+ L  L L +N I +I    F  LP                      L+ L EL L+NN                                            +L +  L  I N  L PL+ L+ L+LS NQLG++    F+   ++  L L  + +   +  N+F  L  LE L+L +N L  LP  +F     L+   + L +NPW CNC + WL   L+  +      P + +           C  P   KG  + ++  + F C   V   P  ++    G+   L C       + +S+ W+  N  ++  T    +   S       N ++V+ QD+G Y C +         +  LNV
Sbjct:   53 ICTRKNLDQIPDSISENTRYLNLQENSIQVIKSDTFKHLRHLEILQLSKNHIRQIEVGAFNGLPNLNTLELFDNRLTVVPSQAFEYLSKLRELWLRNNPIETLGAFAFHRVPSLRRLDLGELRKLDFISEAAFEGLVNLRFLNLGMCGLKDIPN--LTPLVKLEELELSGNQLGIVRPGSFQGLVSLRKLWLMHS-RVSVIERNAFDELKSLEELNLSHNSLHSLPHDLFTPLHQLE--RVHLNHNPWVCNCDVLWLSWWLKETV------PSNTTCCA-------RCHAPPGLKGKYIGELDQSHFPCYAPVIVEPPTDLNVTEGMAAELKC---RTGTSMTSVNWFTPNGTLM--THGSYRVRISVLHDGTLNFTNVTVQDTGQYTCMVTNSAGNTTASAVLNV 435          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000000072.2 (pep primary_assembly:ASM223467v1:1:1576629:1604541:-1 gene:ENSORLG00000000055.2 transcript:ENSORLT00000000072.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 2.307e-14
Identity = 63/203 (31.03%), Postives = 95/203 (46.80%), Query Frame = 1
Query:  103 RKCP-PQLDMGIYI-CIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWL 705
            R CP P    G  + C  + +  VP +I   T+ LDL GN +T + +S+   L+ L  L L EN+I  I +  F  L  L  L L  N LS      +   +     +L RLDLS N++  +    F+ ++ + +L LD       +   +F  L  LE+L+L NN ++ +P   F     L     RL +N   C+C L WL
Sbjct:   43 RGCPAPCTCAGNTVDCHGRGIQSVPKNIPRGTERLDLNGNNLTVITKSDLSGLRHLRVLHLMENQISNIERGAFDELKELERLRLNRNRLS-----QLPELLFQKNEALSRLDLSENRIQAVPRRAFRGAADLKNLQLDKNHISC-VEEGAFRALRSLEVLTLNNNNISSIPVSSFNHMPKL--RTFRLHSNSLRCDCHLAWL 237          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000025727.1 (SMESG000025727.1)

HSP 1 Score: 1100.12 bits (2844), Expect = 0.000e+0
Identity = 594/594 (100.00%), Postives = 594/594 (100.00%), Query Frame = 1
Query:   13 MIEILIFVLILSAFTRGQSVKSRPRNSIFNRKCPPQLDMGIYICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFTPQNNITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVPSTRTHSQXXXXXXXXXXXXXXXXXYQDSGVYHCQIQAGKEFIKTTIYLNVVKSSDEIVISGIRVIFTIGTXXXXXXXXXXXXXXXXXXXKHRSLFCSDDSKFYPEQHSKPNEREIKNQDSILNQISRSQPPNIPQNDQTLSLLPCSRHEYLTLQSAHHNYSRQPYLILPKPAFQCTHNHQFILNQTANLSGDYSFDSTMEPCQPNRDNXXXXXXXXXXXXXXEIDPYQKCPIHGIQSETETQSILSRSATNSLNVNCPLHGYKSD 1794
            MIEILIFVLILSAFTRGQSVKSRPRNSIFNRKCPPQLDMGIYICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFTPQNNITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVPSTRTHSQNSYSTNITSIFNISSVSYQDSGVYHCQIQAGKEFIKTTIYLNVVKSSDEIVISGIRVIFTIGTILASFIIVIVAVLAIVYLIKHRSLFCSDDSKFYPEQHSKPNEREIKNQDSILNQISRSQPPNIPQNDQTLSLLPCSRHEYLTLQSAHHNYSRQPYLILPKPAFQCTHNHQFILNQTANLSGDYSFDSTMEPCQPNRDNCDTCATCTTLETGTEIDPYQKCPIHGIQSETETQSILSRSATNSLNVNCPLHGYKSD
Sbjct:    1 MIEILIFVLILSAFTRGQSVKSRPRNSIFNRKCPPQLDMGIYICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFTPQNNITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVPSTRTHSQNSYSTNITSIFNISSVSYQDSGVYHCQIQAGKEFIKTTIYLNVVKSSDEIVISGIRVIFTIGTILASFIIVIVAVLAIVYLIKHRSLFCSDDSKFYPEQHSKPNEREIKNQDSILNQISRSQPPNIPQNDQTLSLLPCSRHEYLTLQSAHHNYSRQPYLILPKPAFQCTHNHQFILNQTANLSGDYSFDSTMEPCQPNRDNCDTCATCTTLETGTEIDPYQKCPIHGIQSETETQSILSRSATNSLNVNCPLHGYKSD 594          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000006503.1 (SMESG000006503.1)

HSP 1 Score: 115.931 bits (289), Expect = 7.584e-27
Identity = 83/288 (28.82%), Postives = 135/288 (46.88%), Query Frame = 1
Query:  139 ICIRKHLIDVPDD--IHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDS-----PSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFTPQNNITTFIGLETSLVCVFHFAKHANSSITWYHN 981
            +CI   LI  P    I+    +LDL+ N I  L+E    + + L+ L LD N+IWKIT N F   + L  LSL+NN L IS  N+  + +   L+ L+ LDLS N +G+I +  F +   +  L L+   K +++   +F  L  L++LSL  N    LP  +      + +  + L +NPW C+C ++W +  L +      LN ++D       ++L   H   C  P   +   +  +PL+ F+C+ K       +        +L C   F     S + W+ N
Sbjct:   29 VCIENDLITFPKSNFINKDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISN-NTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGAFSNLFNLKLLSLAKNNFLSLPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLIT------LNQNNDYLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTLRLGKTLVVKHLENVTLSC--QFESFPKSYVKWFKN 307          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000006317.1 (SMESG000006317.1)

HSP 1 Score: 106.686 bits (265), Expect = 6.228e-24
Identity = 93/372 (25.00%), Postives = 152/372 (40.86%), Query Frame = 1
Query:  127 MGIYICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLES--IILSKQLNPD-SDSPSVLHKKHNPSCFMPLQFKGFPMF-------QVPLNSFQCQTKVFTPQNNITTFIGLETSLVCVFHFAKHANSSITWYHNNKRIVPSTRTHSQXXXXXXXXXXXXXXXXXYQ-DSGVYHCQIQAGKEFIKTTIYLNVVKSSDEIVISGIRVIFTIGT 1209
            M I    + +   +P+    Q   + +    ++ +  +   NL  L+ L L+ N+I K++ N F  +  L  L L  N + +   NS+ +  L  L  L  LDLS N LG + D  F+    +  L L +A K   +  N  Y L  L++L L NN  T L EG+  S   + +N   L NNPWNC+C+L+WL+    S  +  +K L+ D + +   + +   P C  P       +F        + +N  +C  ++FT             +  C FH   +   ++TW  N   +    R  S N         +       + DSG + C +      +  T  L V+   + I    I     IG 
Sbjct:   44 MSICTNYKANFTRIPERFPDQVAEIIIENQNLSVIDSAQLKNLPNLVNLTLNSNKITKLSPNAFTHVPQLISLRLSGNQIYLG-ENSMPSSSLIYLKKLHTLDLSENPLGFVPDYYFQLLKQLRILNLSTANKGFYIETNGLYGLTNLQVLDLTNNHFTTLSEGLSISLKAMQLNEFYLFNNPWNCDCNLQWLKAWFTSHKVKYTKDLSKDITINGGKIIEDLQPKCESPFPLSERNIFSDSTNTDSIGINDLKCAPRIFTQDRVYEMTKDHNITFTCEFH--ANPGGTVTWSKNGMIVQNHWRRVSWNRSQGIKFKAWLTLQNVEENDSGNWRCILTTHVSKVNATFLLKVISPQNIIDFKSILKYVGIGA 412          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000058478.1 (SMESG000058478.1)

HSP 1 Score: 102.064 bits (253), Expect = 2.374e-22
Identity = 81/297 (27.27%), Postives = 129/297 (43.43%), Query Frame = 1
Query:  139 ICIR--KHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQLGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLR---MTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQ-------VPLNSFQCQTKVFTPQNNITTFIGLETSLVCVFHFAKHANSSITWYHNNKRI 993
            IC R       +P D+    + L++    I +L     V +  L  L LD N++  I  + F  +  L  LSLK+N L +   NS  +  L  L  LK LDL  N LG + D  F+    +  L+L  A     L  NS   L  LE L +  + LT L   I  +  N+ + +     N W C+C+LKWL+   +  + + + K+ +  +   ++L     P CF P +F+G+ +F+       +      C  K+FT    I    G   +L+C   F      ++ W  N  R+
Sbjct:   43 ICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILG-GNSFPSAALLQLKHLKVLDLDNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNLKWLKKWGLKHKDVRIFKKFSRSNGQSALLQ----PQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFTKNQQIQIDQGKNLTLMC--EFEADPGGTVEWSKNGMRV 332          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000051096.1 (SMESG000051096.1)

HSP 1 Score: 98.2117 bits (243), Expect = 3.535e-21
Identity = 85/319 (26.65%), Postives = 150/319 (47.02%), Query Frame = 1
Query:   22 ILIFVLILSAFT-RGQSVKSRPRNSIFNRKC---PPQLDMGIYICIRKHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWKITQNTFLPLAHLTELSLKNNHLSISILNSIT--NRILAPLLSLKRLDLSYNQLGVITDDLFKN-SSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNELTMLPEGIFRSQTNLD-INNIRLANNPWNCNCSLKWLRMTLESIILSKQLNPDSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLN-----SFQCQTKVFTPQNNITTFIGLETSLVCVFH 939
            I I +L+   F+ +G +V  R + S   +     P Q+           L  +P D+      L+++   + T++   F++L KL  L +  + +  I +  F+ L++L  LSL NN L IS  NS++    I  PLLSL ++DLSYN +G I D  F + + T+ SL L  +   + L+ NS  Y+  L+ + LE +++T +   +  S   +  +  I L  N WNC+C L+W  + +        +  ++    +   +   SC  P + + + +F   LN      FQC  +  T  + ++ + G   SL  +F 
Sbjct:   11 IFILILVKPCFSVKGCTVILRSQQSSLKKAVCNMPEQI-----------LKSIPTDLPEALVELEISFQDLQTIYNKEFIHLPKLEYLSIVSSNVQTIQEGAFIQLSNLKSLSLFNNSLIISTGNSMSMSKYIFFPLLSLTKVDLSYNSIGNIPDFFFNHVNQTLESLHLSHSKTEIILSGNSLMYMTNLKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWI--------IKNNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQCIPEPITSNSTVSIYAGQNISLTSIFR 310          
The following BLAST results are available for this feature:
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRC4C5.425e-1725.18leucine rich repeat containing 4C [Source:HGNC Sym... [more]
LRRC4C5.425e-1725.18leucine rich repeat containing 4C [Source:HGNC Sym... [more]
LRRC4C5.425e-1725.18leucine rich repeat containing 4C [Source:HGNC Sym... [more]
LRRC4C5.425e-1725.18leucine rich repeat containing 4C [Source:HGNC Sym... [more]
LRRC4C5.425e-1725.18leucine rich repeat containing 4C [Source:HGNC Sym... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slt-11.862e-1632.12Slit homolog 1 protein [Source:UniProtKB/Swiss-Pr... [more]
lron-76.315e-1028.94ELRR (Extracellular Leucine-Rich Repeat) ONly [So... [more]
lron-76.811e-1028.94ELRR (Extracellular Leucine-Rich Repeat) ONly [So... [more]
let-41.245e-831.35Leucine-rich repeat-containing protein let-4 [Sou... [more]
lron-93.804e-825.09ELRR (Extracellular Leucine-Rich Repeat) ONly [So... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sli4.569e-2333.33gene:FBgn0264089 transcript:FBtr0330734[more]
sli6.905e-2333.33gene:FBgn0264089 transcript:FBtr0330733[more]
sli6.905e-2333.33gene:FBgn0264089 transcript:FBtr0330731[more]
kek16.473e-1927.40gene:FBgn0015399 transcript:FBtr0346702[more]
kek16.473e-1927.40gene:FBgn0015399 transcript:FBtr0332210[more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc4ca9.224e-1724.83leucine rich repeat containing 4C, genome duplicat... [more]
flrt23.625e-1628.92fibronectin leucine rich transmembrane protein 2 [... [more]
lrfn4a3.054e-1525.93leucine rich repeat and fibronectin type III domai... [more]
lrfn4b3.744e-1527.16leucine rich repeat and fibronectin type III domai... [more]
lrrc4cb1.621e-1425.00leucine rich repeat containing 4C, genome duplicat... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRC4C7.783e-1625.43leucine rich repeat containing 4C [Source:NCBI gen... [more]
islr22.915e-1526.92immunoglobulin superfamily containing leucine-rich... [more]
islr23.704e-1526.92immunoglobulin superfamily containing leucine-rich... [more]
vasn3.991e-1430.53vasorin [Source:NCBI gene;Acc:448556][more]
vasn4.343e-1430.53vasorin [Source:NCBI gene;Acc:448556][more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Igsf109.360e-1828.67immunoglobulin superfamily, member 10 [Source:MGI ... [more]
Igsf109.360e-1828.67immunoglobulin superfamily, member 10 [Source:MGI ... [more]
Igsf109.360e-1828.67immunoglobulin superfamily, member 10 [Source:MGI ... [more]
Lrrc4c6.636e-1724.69leucine rich repeat containing 4C [Source:MGI Symb... [more]
Lrrc4c6.636e-1724.69leucine rich repeat containing 4C [Source:MGI Symb... [more]
back to top
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P24014|SLIT_DROME6.922e-2233.33Protein slit OS=Drosophila melanogaster OX=7227 GN... [more]
sp|Q3V1M1|IGS10_MOUSE6.547e-1728.67Immunoglobulin superfamily member 10 OS=Mus muscul... [more]
sp|Q6WRH9|IGS10_RAT2.434e-1628.52Immunoglobulin superfamily member 10 OS=Rattus nor... [more]
sp|Q9HCJ2|LRC4C_HUMAN2.605e-1625.18Leucine-rich repeat-containing protein 4C OS=Homo ... [more]
sp|Q8C031|LRC4C_MOUSE4.642e-1624.69Leucine-rich repeat-containing protein 4C OS=Mus m... [more]
back to top
BLAST of Ig-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P6H7Z14.500e-3528.85Ig-like domain-containing protein OS=Mesocestoides... [more]
A0A0R3W0U68.987e-3529.38Ig-like domain-containing protein OS=Taenia asiati... [more]
A0A5K3FA639.355e-3535.57Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3X7X41.576e-3330.43Ig-like domain-containing protein OS=Hydatigena ta... [more]
A0A068YAA24.639e-3329.11Leucine rich repeat containing protein 4 OS=Echino... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc4ca1.687e-1625.68leucine-rich repeat-containing protein 4C [Source:... [more]
lrfn4a4.989e-1627.90leucine-rich repeat and fibronectin type-III domai... [more]
lrfn4a4.989e-1627.90leucine-rich repeat and fibronectin type-III domai... [more]
lrfn4a6.460e-1627.58leucine-rich repeat and fibronectin type-III domai... [more]
ENSAMXT00000025613.22.032e-1531.96leucine-rich repeat transmembrane protein FLRT1 [S... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004916.12.211e-1628.93pep scaffold:Pmarinus_7.0:GL476584:229610:304495:-... [more]
lrig32.310e-1528.06leucine-rich repeats and immunoglobulin-like domai... [more]
ENSPMAT00000004394.12.024e-1431.32pep scaffold:Pmarinus_7.0:GL476584:2351:149177:1 g... [more]
LINGO22.470e-1429.65leucine rich repeat and Ig domain containing 2 [So... [more]
lingo4b2.129e-1330.00leucine rich repeat and Ig domain containing 4b [S... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO481791.137e-825.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491361.819e-828.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354072.172e-731.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471092.723e-727.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO394123.143e-731.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc4cb4.658e-1824.89leucine rich repeat containing 4C [Source:NCBI gen... [more]
ENSORLT00000037040.14.804e-1525.38pep primary_assembly:ASM223467v1:2:3885569:3886678... [more]
ENSORLT00000036623.11.866e-1435.63carboxypeptidase N subunit 2-like [Source:NCBI gen... [more]
lrrc4bb2.224e-1424.38leucine-rich repeat-containing protein 4B [Source:... [more]
ENSORLT00000000072.22.307e-1431.03pep primary_assembly:ASM223467v1:1:1576629:1604541... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025727.10.000e+0100.00SMESG000025727.1[more]
SMESG000006503.17.584e-2728.82SMESG000006503.1[more]
SMESG000006317.16.228e-2425.00SMESG000006317.1[more]
SMESG000058478.12.374e-2227.27SMESG000058478.1[more]
SMESG000051096.13.535e-2126.65SMESG000051096.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001742 ID=SMED30001742|Name=Ig-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1794bp
AGCTTCCTTTCAATGATTGAGATTTTAATATTTGTTTTAATTCTCTCGGC
TTTCACGAGAGGTCAGAGTGTAAAATCGAGACCGAGAAATAGTATTTTCA
ATCGAAAATGCCCACCGCAATTGGATATGGGTATTTATATATGTATCCGG
AAGCATCTAATTGACGTACCGGATGATATACATAGTCAAACGAAACTGCT
CGATCTCACCGGAAATCAGATTACGACTTTGCACGAGAGCAATTTTGTCA
ATCTTCAAAAATTACTTCGGTTGGTGCTCGATGAAAATCGGATCTGGAAA
ATCACACAAAATACATTTTTGCCACTGGCTCATCTGACAGAACTTTCATT
GAAAAATAATCATTTATCTATTAGCATTCTTAATAGCATTACCAATAGGA
TATTAGCCCCATTGTTGTCATTAAAACGCTTGGATTTGTCGTATAATCAG
CTAGGCGTTATAACTGATGACTTGTTTAAGAATTCCTCAACGATAAACAG
TTTAGTCTTAGACTCTGCAGGCAAACCTCTTCAATTAACCATAAATTCCT
TTTACTACCTACCGAAATTGGAGATGCTGTCATTGGAAAATAATGAATTA
ACCATGCTACCCGAAGGGATATTTCGAAGTCAAACCAATCTTGATATTAA
CAATATTCGACTGGCCAACAATCCTTGGAATTGTAATTGTTCTTTGAAAT
GGTTACGGATGACTTTGGAATCAATCATTCTATCAAAACAACTGAACCCT
GACTCTGACTCTCCATCTGTTTTGCATAAAAAGCACAATCCATCGTGTTT
TATGCCTTTACAGTTTAAGGGATTTCCCATGTTCCAAGTTCCTTTAAACA
GTTTTCAATGCCAAACAAAAGTTTTTACACCTCAAAATAACATTACAACC
TTCATAGGATTAGAGACTAGTTTGGTATGCGTCTTCCATTTCGCTAAGCA
CGCAAACTCTTCCATAACTTGGTATCATAACAATAAGCGGATTGTTCCAT
CTACAAGAACACATTCTCAGAATTCGTATTCCACAAATATTACAAGTATT
TTCAATATATCATCGGTGAGCTATCAGGACTCGGGTGTTTATCATTGCCA
AATCCAAGCTGGTAAAGAGTTTATTAAAACAACAATATATTTAAACGTAG
TAAAATCAAGTGATGAAATTGTAATATCTGGAATAAGGGTAATATTTACT
ATTGGGACGATTCTAGCTTCCTTTATTATTGTTATTGTGGCCGTCCTAGC
TATTGTATACTTAATAAAACATAGATCACTCTTTTGTTCAGATGATTCAA
AATTCTACCCGGAGCAGCATTCAAAACCCAATGAAAGGGAAATTAAAAAT
CAAGACAGTATATTAAATCAAATAAGTCGAAGTCAACCTCCAAATATCCC
TCAAAACGATCAAACGTTATCGCTGTTGCCATGTTCAAGACATGAGTATT
TAACTTTACAGAGTGCTCATCATAATTATTCAAGACAACCCTACCTGATT
CTACCAAAACCGGCTTTTCAATGCACTCACAATCACCAGTTCATTCTCAA
CCAAACTGCAAATCTATCAGGGGATTATTCATTCGACAGTACCATGGAAC
CCTGTCAACCCAACCGAGACAATTGTGACACCTGTGCCACCTGTACTACC
CTTGAAACTGGAACCGAGATTGATCCCTATCAAAAATGTCCAATACACGG
AATCCAGTCAGAGACAGAAACTCAAAGTATTCTATCAAGATCCGCTACGA
ATTCCCTCAATGTCAATTGTCCCTTGCACGGATACAAGTCGGAC
back to top

protein sequence of SMED30001742-orf-1

>SMED30001742-orf-1 ID=SMED30001742-orf-1|Name=SMED30001742-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=598bp
SFLSMIEILIFVLILSAFTRGQSVKSRPRNSIFNRKCPPQLDMGIYICIR
KHLIDVPDDIHSQTKLLDLTGNQITTLHESNFVNLQKLLRLVLDENRIWK
ITQNTFLPLAHLTELSLKNNHLSISILNSITNRILAPLLSLKRLDLSYNQ
LGVITDDLFKNSSTINSLVLDSAGKPLQLTINSFYYLPKLEMLSLENNEL
TMLPEGIFRSQTNLDINNIRLANNPWNCNCSLKWLRMTLESIILSKQLNP
DSDSPSVLHKKHNPSCFMPLQFKGFPMFQVPLNSFQCQTKVFTPQNNITT
FIGLETSLVCVFHFAKHANSSITWYHNNKRIVPSTRTHSQNSYSTNITSI
FNISSVSYQDSGVYHCQIQAGKEFIKTTIYLNVVKSSDEIVISGIRVIFT
IGTILASFIIVIVAVLAIVYLIKHRSLFCSDDSKFYPEQHSKPNEREIKN
QDSILNQISRSQPPNIPQNDQTLSLLPCSRHEYLTLQSAHHNYSRQPYLI
LPKPAFQCTHNHQFILNQTANLSGDYSFDSTMEPCQPNRDNCDTCATCTT
LETGTEIDPYQKCPIHGIQSETETQSILSRSATNSLNVNCPLHGYKSD
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR000483Cys-rich_flank_reg_C
IPR003591Leu-rich_rpt_typical-subtyp
IPR003599Ig_sub
IPR001611Leu-rich_rpt
IPR013783Ig-like_fold
IPR032675LRR_dom_sf
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 295..384
e-value: 2.7E-6
score: 36.9
IPR003591Leucine-rich repeat, typical subtypeSMARTSM00369LRR_typ_2coord: 109..137
e-value: 100.0
score: 4.9
coord: 85..108
e-value: 5.6
score: 15.3
coord: 187..210
e-value: 2.0E-5
score: 34.0
coord: 138..161
e-value: 0.022
score: 24.0
IPR000483Cysteine-rich flanking region, C-terminalSMARTSM00082lrrct1coord: 224..288
e-value: 2.4E-6
score: 37.1
NoneNo IPR availablePFAMPF13927Ig_3coord: 293..368
e-value: 2.4E-8
score: 34.4
NoneNo IPR availablePANTHERPTHR45842FAMILY NOT NAMEDcoord: 9..502
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.883
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 46..292
NoneNo IPR availableTMHMMTMhelixcoord: 400..422
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 36..175
e-value: 5.0E-22
score: 79.8
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 177..287
e-value: 6.9E-17
score: 63.3
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 288..390
e-value: 1.2E-12
score: 49.7
IPR001611Leucine-rich repeatPFAMPF13855LRR_8coord: 65..122
e-value: 1.1E-9
score: 37.9
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 140..161
score: 7.273
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 189..210
score: 6.603
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 63..84
score: 5.987
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 87..108
score: 6.703
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 111..131
score: 6.272
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 276..382
score: 10.372
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 291..384