WASH complex subunit 5

Overview
NameWASH complex subunit 5
Smed IDSMED30001740
Length (bp)3722
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WASH complex subunit 5 (SMED30001740) t-SNE clustered cells

Violin plots show distribution of expression levels for WASH complex subunit 5 (SMED30001740) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WASH complex subunit 5 (SMED30001740) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WASH complex subunit 5 (SMED30001740) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001740

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30001740SMESG000050769.1 Contig372GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001740SMESG000078787.1 Contig372GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30001740SMESG000078787.1 dd_Smed_v4_3369_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001740SMESG000078787.1 dd_Smed_v4_3369_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WASH complex subunit 5 vs. Ensembl Human
Match: WASHC5 (WASH complex subunit 5 [Source:HGNC Symbol;Acc:HGNC:28984])

HSP 1 Score: 1119.38 bits (2894), Expect = 0.000e+0
Identity = 577/1186 (48.65%), Postives = 815/1186 (68.72%), Query Frame = 2
Query:  110 MTEFYLDTNW-GPILLPLVARGSAIICEICRLSDYIPSEY--KPNAIKNEYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVFKSRT--SELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQA-NFKDKKNLDIMDSFLRNVNPISKSVVF---KIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDDIRT 3640
            M +F  + N  G  +L +V+ G+AII E+ RLS++IP+ +  K  A + +Y +II DFSYF   E +E K+DA+PELQDLDE+FR+N++E++ RFY  F+S+ +++ DLN +L  L +G ++Q  L +V+ +EDGKQL+CEALYLYG+MLL+IDQKIEG  RE++LVSY+RYS  +S+ DSN D++ +LLRSTGYS S P  KRP +YPESYF R+ IN  +ISMV+ +LRSDD Y+Q  AYPLPEHRS A A QA M+YV LYF P+ LH+  A MREIVDK+F DNWV+  Y+G  VNLVD W PYKAA  AL N ++L+NV+   + Y  + +++   + + LKEG L +E VLD I KL++ +R+CNV IRWLMLH+ + S    +NK+  Q+++ ++T + +N   +FQLL  T+QFE  L +MF+ +L  K+  W   K EG +RM ELA+VFSG K L RV KN+ LQ WF ++SKQI +L++ ++T AGR   QLIQAL EV EFHQL+SNL V QF+ DT   L QM+R +N++E VL+ + I  D+S+A  +ID +T  MQ  I  +P +V KLRA FLKLA++ D+PL+R+NQ +S DLLSV+QYYS ELV YVRKVLQIIPE MF  L KII LQT++I E+PTRLDKDK+++Y     R E+A+LTH IS+FT+GILMMKTTLVGII++DP +LLEDGIRKEL+K V+ A  + L+F  R   SEL  KL +L  TMDGF RSFEYIQDYVNIYGLK+W+EEVSRIIN+NVE+ECN+FLR KI D+QS+YQS  IPIP + PVDES++FIGRL +EIL++TDPK   ++  +N+WYD+KT  E+ + +LFS++++   +FGL  +DRL   ++VK LQNFL   Q    +D+   D + + +  V+P+ KS+V    KIY     +  KI    ++ I+K+GQ+Q+LR+ IAN+LN S +F++K L +AL   N +LL D+E H  +P + PYP                         D  ++   +  L +AG+H+P++++YITT +  +  +   L L + L KL Y++    ++ ++  D +D   L +GL+TLL+Q H    ++++ L+ Q+  S      S+  +   P +++  +L L+D+   ++ P  V  A +P ++ D+ RT
Sbjct:    1 MLDFLAENNLCGQAILRIVSCGNAIIAELLRLSEFIPAVFRLKDRADQQKYGDIIFDFSYFKGPELWESKLDAKPELQDLDEEFRENNIEIVTRFYLAFQSVHKYIVDLNRYLDDLNEGVYIQQTLETVLLNEDGKQLLCEALYLYGVMLLVIDQKIEGEVRERMLVSYYRYSAARSSADSNMDDICKLLRSTGYS-SQPGAKRPSNYPESYFQRVPINESFISMVIGRLRSDDIYNQVSAYPLPEHRSTALANQAAMLYVILYFEPSILHTHQAKMREIVDKYFPDNWVISIYMGITVNLVDAWEPYKAAKTALNNTLDLSNVREQASRYATVSERVHAQVQQFLKEGYLREEMVLDNIPKLLNCLRDCNVAIRWLMLHTAD-SACDPNNKRLRQIKDQILTDSRYNPRILFQLLLDTAQFEFILKEMFKQMLSEKQTKWEHYKKEGSERMTELADVFSGVKPLTRVEKNENLQAWFREISKQILSLNYDDSTAAGRKTVQLIQALEEVQEFHQLESNLQVCQFLADTRKFLHQMIRTINIKEEVLITMQIVGDLSFAWQLIDSFTSIMQESIRVNPSMVTKLRATFLKLASALDLPLLRINQANSPDLLSVSQYYSGELVSYVRKVLQIIPESMFTSLLKIIKLQTHDIIEVPTRLDKDKLRDYAQLGPRYEVAKLTHAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRKELVKRVAFALHRGLIFNPRAKPSELMPKLKELGATMDGFHRSFEYIQDYVNIYGLKIWQEEVSRIINYNVEQECNNFLRTKIQDWQSMYQSTHIPIPKFTPVDESVTFIGRLCREILRITDPKMTCHIDQLNTWYDMKTHQEVTSSRLFSEIQTTLGTFGLNGLDRLLCFMIVKELQNFLSMFQKIILRDRTVQDTLKTLMNAVSPL-KSIVANSNKIYFSAIAKTQKIWTAYLEAIMKVGQMQILRQQIANELNYSCRFDSKHLAAALENLNKALLADIEAHYQDP-SLPYPK-----------------------EDNTLLYEITAYLEAAGIHNPLNKIYITTKRLPYFPIVNFLFLIAQLPKLQYNKNL-GMVCRKPTDPVDWPPLVLGLLTLLKQFHSRYTEQFLALIGQFICSTVEQCTSQK-IPEIPADVVGALLFLEDYVRYTKLPRRVAEAHVPNFIFDEFRT 1157          
BLAST of WASH complex subunit 5 vs. Ensembl Human
Match: WASHC5 (WASH complex subunit 5 [Source:HGNC Symbol;Acc:HGNC:28984])

HSP 1 Score: 978.778 bits (2529), Expect = 0.000e+0
Identity = 508/1038 (48.94%), Postives = 709/1038 (68.30%), Query Frame = 2
Query:  545 MLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVFKSRT--SELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQA-NFKDKKNLDIMDSFLRNVNPISKSVVF---KIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDDIRT 3640
            MLL+IDQKIEG  RE++LVSY+RYS  +S+ DSN D++ +LLRSTGYS S P  KRP +YPESYF R+ IN  +ISMV+ +LRSDD Y+Q  AYPLPEHRS A A QA M+YV LYF P+ LH+  A MREIVDK+F DNWV+  Y+G  VNLVD W PYKAA  AL N ++L+NV+   + Y  + +++   + + LKEG L +E VLD I KL++ +R+CNV IRWLMLH+ + S    +NK+  Q+++ ++T + +N   +FQLL  T+QFE  L +MF+ +L  K+  W   K EG +RM ELA+VFSG K L RV KN+ LQ WF ++SKQI +L++ ++T AGR   QLIQAL EV EFHQL+SNL V QF+ DT   L QM+R +N++E VL+ + I  D+S+A  +ID +T  MQ  I  +P +V KLRA FLKLA++ D+PL+R+NQ +S DLLSV+QYYS ELV YVRKVLQIIPE MF  L KII LQT++I E+PTRLDKDK+++Y     R E+A+LTH IS+FT+GILMMKTTLVGII++DP +LLEDGIRKEL+K V+ A  + L+F  R   SEL  KL +L  TMDGF RSFEYIQDYVNIYGLK+W+EEVSRIIN+NVE+ECN+FLR KI D+QS+YQS  IPIP + PVDES++FIGRL +EIL++TDPK   ++  +N+WYD+KT  E+ + +LFS++++   +FGL  +DRL   ++VK LQNFL   Q    +D+   D + + +  V+P+ KS+V    KIY     +  KI    ++ I+K+GQ+Q+LR+ IAN+LN S +F++K L +AL   N +LL D+E H  +P + PYP        KE               D  ++   +  L +AG+H+P++++YITT +  +  +   L L + L KL Y++    ++ ++  D +D   L +GL+TLL+Q H    ++++ L+ Q+  S      S+  +   P +++  +L L+D+   ++ P  V  A +P ++ D+ RT
Sbjct:    1 MLLVIDQKIEGEVRERMLVSYYRYSAARSSADSNMDDICKLLRSTGYS-SQPGAKRPSNYPESYFQRVPINESFISMVIGRLRSDDIYNQVSAYPLPEHRSTALANQAAMLYVILYFEPSILHTHQAKMREIVDKYFPDNWVISIYMGITVNLVDAWEPYKAAKTALNNTLDLSNVREQASRYATVSERVHAQVQQFLKEGYLREEMVLDNIPKLLNCLRDCNVAIRWLMLHTAD-SACDPNNKRLRQIKDQILTDSRYNPRILFQLLLDTAQFEFILKEMFKQMLSEKQTKWEHYKKEGSERMTELADVFSGVKPLTRVEKNENLQAWFREISKQILSLNYDDSTAAGRKTVQLIQALEEVQEFHQLESNLQVCQFLADTRKFLHQMIRTINIKEEVLITMQIVGDLSFAWQLIDSFTSIMQESIRVNPSMVTKLRATFLKLASALDLPLLRINQANSPDLLSVSQYYSGELVSYVRKVLQIIPESMFTSLLKIIKLQTHDIIEVPTRLDKDKLRDYAQLGPRYEVAKLTHAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRKELVKRVAFALHRGLIFNPRAKPSELMPKLKELGATMDGFHRSFEYIQDYVNIYGLKIWQEEVSRIINYNVEQECNNFLRTKIQDWQSMYQSTHIPIPKFTPVDESVTFIGRLCREILRITDPKMTCHIDQLNTWYDMKTHQEVTSSRLFSEIQTTLGTFGLNGLDRLLCFMIVKELQNFLSMFQKIILRDRTVQDTLKTLMNAVSPL-KSIVANSNKIYFSAIAKTQKIWTAYLEAIMKVGQMQILRQQIANELNYSCRFDSKHLAAALENLNKALLADIEAHYQDP-SLPYP--------KE---------------DNTLLYEITAYLEAAGIHNPLNKIYITTKRLPYFPIVNFLFLIAQLPKLQYNKNL-GMVCRKPTDPVDWPPLVLGLLTLLKQFHSRYTEQFLALIGQFICSTVEQCTSQK-IPEIPADVVGALLFLEDYVRYTKLPRRVAEAHVPNFIFDEFRT 1009          
BLAST of WASH complex subunit 5 vs. Ensembl Human
Match: WASHC5 (WASH complex subunit 5 [Source:HGNC Symbol;Acc:HGNC:28984])

HSP 1 Score: 220.32 bits (560), Expect = 1.441e-65
Identity = 105/163 (64.42%), Postives = 126/163 (77.30%), Query Frame = 2
Query:  545 MLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAA 1033
            MLL+IDQKIEG  RE++LVSY+RYS  +S+ DSN D++ +LLRSTGYS S P  KRP +YPESYF R+ IN  +ISMV+ +LRSDD Y+Q  AYPLPEHRS A A QA M+YV LYF P+ LH+  A MREIVDK+F DNWV+  Y+G  VNLVD W PYKAA
Sbjct:    1 MLLVIDQKIEGEVRERMLVSYYRYSAARSSADSNMDDICKLLRSTGYS-SQPGAKRPSNYPESYFQRVPINESFISMVIGRLRSDDIYNQVSAYPLPEHRSTALANQAAMLYVILYFEPSILHTHQAKMREIVDKYFPDNWVISIYMGITVNLVDAWEPYKAA 162          
BLAST of WASH complex subunit 5 vs. Ensembl Celegans
Match: T05E7.3 (pep chromosome:WBcel235:I:6188157:6192632:1 gene:WBGene00020259.1 transcript:T05E7.3.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T05E7.3)

HSP 1 Score: 181.415 bits (459), Expect = 3.378e-46
Identity = 197/881 (22.36%), Postives = 396/881 (44.95%), Query Frame = 2
Query:  158 LVARGSAIICEICRLSDYIPSEYKPNAIKNEYSEII-CDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNK---RPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLS--VTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVFKSRTSELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQH 2782
            L+  G +I+ EI RLS +IP +++     +++  I+  DF Y S  +  E ++++   LQ    +F      +L  F +LF SI  FV     F+   ++   +  +  + M      +L    LY+ GI+++ +D  I    RE++ ++ +R    +S++  N + +   L++T     +P N    R +  PES+     INA  I               +L  P           +A ++YV L F    L +  A+M +I +  + + WV+    G I N+ D W  +K+A  A+ + I   + + ++  + +++ +   +  +++ E +           + + KI  CN +++WL LHS    IS K+++   + R         +++ +FQ L   S+ E+ L +++   LE+++   ++ K      + +LAE F         S+      W   LS+ +E +   +TT +  T+ Q+I+ + +V +   L  NL +K  ++     L+ +M +L+L + ++  +    + +Y   +I +    +Q  +       + +R +F KL+ S  +  ++L+  S KD ++  +   YS  L + ++ VLQ +P+ +F  +  +I       K     ++K +++    F   S +   T  I+  + GI  M  T VG IE++P +LLE+G+ ++L K +     KK++  +  +     L  + + ++  R SF Y+ DY+N+ G  +W   +     F+   E  +F R+                      +   ++I  L    +K+T+PK   +     SW D+K    + +  +F ++E       L SI+    + L K L  ++ +
Sbjct:   12 LILHGESILAEIFRLSSFIPKDFRDPTKSSKFKNIVQLDFKYLSKVDQIEKELESHLRLQT---QFYSTFEPVLIAFEQLFSSISEFV---QSFISYTKEAEIINGE--TRMDVNRTSELEAYCLYISGILIIYMDTYIPAPIRERIYIAIYR----KSDVRENAEFLVDFLKAT-----VPGNDSMIRRIPLPESFITS-TINAIEI-----------IEGTSLQIP-----------KAQLMYVALQFDRQTLTNDSAIMTKIANSIYRETWVINLGFGVIANVFDGWYNFKSAWNAINSTITQQDAQRIMEKHLKMMNE--TSFPQVINEMI--------DFEQNLKKISMCNRSLKWLFLHS---KISQKTSRPLNKYRLP-------SDDQLFQWLLHVSRCEILLLNLYTTTLENRDVEGTERKQNIRTLLHQLAEFFEHGFVKMGESQKTNFVKWVRNLSETVEKIDLNDTTESVETIQQIIRRVKQVGDQLGLSINLTLKDCLSTLDTDLRALMSVLSLSDSMIPEVYSKMESTYLWPLISQLIPRIQQNLVSTSNTDV-VRQIFTKLSISCYMLKLKLSNFSDKDHVASRIANTYSYALEKNLKTVLQSVPQHLFGIMYNVI--MPGLGKTFEPYIEKTELRELSEFVTNSRLVETTSLIANTSMGISRMMLTRVGTIEINPKELLEEGMIRQLYKEI-----KKMIGTTSATSSIENLLKMCDNIETMRCSFLYLCDYMNLDGEHVWSVAMDDF--FSRISEERAFARSS--------------------GELEKNYIAEL---FIKITNPKASRFSESSLSWKDVKMSKTVLSFDVFDRIEKIVPFHILTSIETHITVELEKMLIEYISN 799          
BLAST of WASH complex subunit 5 vs. Ensembl Celegans
Match: T05E7.3 (pep chromosome:WBcel235:I:6188159:6192632:1 gene:WBGene00020259.1 transcript:T05E7.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T05E7.3)

HSP 1 Score: 181.415 bits (459), Expect = 3.378e-46
Identity = 197/881 (22.36%), Postives = 396/881 (44.95%), Query Frame = 2
Query:  158 LVARGSAIICEICRLSDYIPSEYKPNAIKNEYSEII-CDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNK---RPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLS--VTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVFKSRTSELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQH 2782
            L+  G +I+ EI RLS +IP +++     +++  I+  DF Y S  +  E ++++   LQ    +F      +L  F +LF SI  FV     F+   ++   +  +  + M      +L    LY+ GI+++ +D  I    RE++ ++ +R    +S++  N + +   L++T     +P N    R +  PES+     INA  I               +L  P           +A ++YV L F    L +  A+M +I +  + + WV+    G I N+ D W  +K+A  A+ + I   + + ++  + +++ +   +  +++ E +           + + KI  CN +++WL LHS    IS K+++   + R         +++ +FQ L   S+ E+ L +++   LE+++   ++ K      + +LAE F         S+      W   LS+ +E +   +TT +  T+ Q+I+ + +V +   L  NL +K  ++     L+ +M +L+L + ++  +    + +Y   +I +    +Q  +       + +R +F KL+ S  +  ++L+  S KD ++  +   YS  L + ++ VLQ +P+ +F  +  +I       K     ++K +++    F   S +   T  I+  + GI  M  T VG IE++P +LLE+G+ ++L K +     KK++  +  +     L  + + ++  R SF Y+ DY+N+ G  +W   +     F+   E  +F R+                      +   ++I  L    +K+T+PK   +     SW D+K    + +  +F ++E       L SI+    + L K L  ++ +
Sbjct:   12 LILHGESILAEIFRLSSFIPKDFRDPTKSSKFKNIVQLDFKYLSKVDQIEKELESHLRLQT---QFYSTFEPVLIAFEQLFSSISEFV---QSFISYTKEAEIINGE--TRMDVNRTSELEAYCLYISGILIIYMDTYIPAPIRERIYIAIYR----KSDVRENAEFLVDFLKAT-----VPGNDSMIRRIPLPESFITS-TINAIEI-----------IEGTSLQIP-----------KAQLMYVALQFDRQTLTNDSAIMTKIANSIYRETWVINLGFGVIANVFDGWYNFKSAWNAINSTITQQDAQRIMEKHLKMMNE--TSFPQVINEMI--------DFEQNLKKISMCNRSLKWLFLHS---KISQKTSRPLNKYRLP-------SDDQLFQWLLHVSRCEILLLNLYTTTLENRDVEGTERKQNIRTLLHQLAEFFEHGFVKMGESQKTNFVKWVRNLSETVEKIDLNDTTESVETIQQIIRRVKQVGDQLGLSINLTLKDCLSTLDTDLRALMSVLSLSDSMIPEVYSKMESTYLWPLISQLIPRIQQNLVSTSNTDV-VRQIFTKLSISCYMLKLKLSNFSDKDHVASRIANTYSYALEKNLKTVLQSVPQHLFGIMYNVI--MPGLGKTFEPYIEKTELRELSEFVTNSRLVETTSLIANTSMGISRMMLTRVGTIEINPKELLEEGMIRQLYKEI-----KKMIGTTSATSSIENLLKMCDNIETMRCSFLYLCDYMNLDGEHVWSVAMDDF--FSRISEERAFARSS--------------------GELEKNYIAEL---FIKITNPKASRFSESSLSWKDVKMSKTVLSFDVFDRIEKIVPFHILTSIETHITVELEKMLIEYISN 799          
BLAST of WASH complex subunit 5 vs. Ensembl Fly
Match: Strump (gene:FBgn0036571 transcript:FBtr0075452)

HSP 1 Score: 842.032 bits (2174), Expect = 0.000e+0
Identity = 471/1217 (38.70%), Postives = 737/1217 (60.56%), Query Frame = 2
Query:  122 YLDTN--WGPILLPLVARGSAIICEICRLSDYIPSEYKPN--AIKNEYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYS---VKQSNLDSNTDEVYQLLRSTGY----------------------SVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSC-ELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIID-KYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVF-----KSRTSELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPV--DESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVE--IANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQANF-KDKKNLDIMDSFLRNV------NPISKSVVFKIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDD 3631
            +LD N   G  LL +V+ G++II EI RL DY+PS Y+ +  A K +Y E+I DFSYF ++E  E +I+  PEL +LD++ R   + L+ RFY  F+SI  + SDL  ++  L  G+++Q  L +V+Q+E+G+QL+CE+LYL+G++LL++D  I G  RE+LL++Y+RYS      S  +SN  +V  LLRSTGY                      S+ +P       YPE+YF+R   +  ++ +V+ +LR DD Y+Q   YP P HRS A +TQA M+YVCLYF P  LHSQ + MREIVDK F DNW +  Y+G  VNLVD W  +KAA  A+ N+I    +K+L       + K+     +I++EGVL   FVL+  +K++  +R+ NV +RW  LH+  E+ I   +     Q+++ V+    FN  +++ LL   SQ EL + +    I + KEE W++ + E + R+ EL+E F+G++ L+++ +N +LQ WF +++ +++ L       +GR + Q++QAL +V E+H L SN++VKQ + +T   L QM +L+NL+E + +++ + +D SYA +++   +T  MQ  I + P  VI +RAVFLKLA++ ++PL+R+NQ  S+DL+SV+ YYS+EL  ++R+VLQI+PE MF  LAKII L TN IKE PT+++K+++K+Y  FE+R+++A+LT+ I+VFT+GILMMKTTLVG+IELDP +LLEDGIRKEL+ H++ A++  L+F     K+    L  KL  L+ T++G+RRSFEYI+DY+ + GL++  EE  RIIN+NVEKECN+FLRNK+ ++QS +QS+ IPIP++PP+  D S +FIGRL  EIL+ TDPK  I++   ++WY+ K   +  +A    F  L  A    G+  ++RL+  +L   L+  L+ +Q N   D+  +D + +  R +       P       K Y  Y  R  K+ P  +D++L IGQ QLLR+ IA +L+ SSK +AK L +   T N +LL +L    ++ + C    + +L   +E                         LL++ G  +P+ QV++ T      +++  L   + L ++ +S   D ++ K + D +D     +GLVT+LQQ H  +   +I  +SQY  + + +      ++   PE++  +  L  F  I+R P+ VL   IP  ++ +
Sbjct:    3 FLDDNNACGQNLLNIVSVGNSIIAEILRLKDYVPSIYRLDNKADKAKYGELILDFSYFKIAEDHERRIEQSPELTELDDEAR-AQLPLITRFYLAFQSIHHYASDLQQYIEELNTGYYIQQTLETVLQEEEGRQLLCESLYLFGVILLMVDFHIPGDVRERLLIAYYRYSGGDATPSGDESNIHDVCLLLRSTGYVHPSIAAKVLGLGGKQAGARAASLVVPR------YPEAYFSRFRFDENFVDLVVARLRCDDIYNQLNLYPHPAHRSTALSTQAAMLYVCLYFCPQVLHSQGSQMREIVDKFFCDNWTISVYMGMTVNLVDAWLDFKAARSAIENVISPPAIKALCQQQKEQLGKITQKTQEIVREGVLNDNFVLEHANKIIHLMRQSNVLLRWFCLHTSREVFIFAHTATLTGQVQKCVLHELQFNRNTLYNLLLNCSQMELSVREFLAEIQQTKEERWTKSREEAMQRLNELSEAFAGSRPLSKIEQNPQLQQWFGEVAGRLQKLELSRPQKSGRLIIQVMQALDDVQEYHNLHSNMLVKQQLQETRDMLNQMAQLINLKEDIEIHIQMITDFSYAWHLLQFDFTPPMQEHIKRQPQAVIGIRAVFLKLASTLEVPLMRINQARSEDLVSVSNYYSTELANFLRRVLQIVPETMFSILAKIIYLLTNVIKEFPTKVEKERLKDYAQFEERAKVAQLTNSIAVFTKGILMMKTTLVGVIELDPKQLLEDGIRKELVNHLANAYNLGLIFTPEKGKTPVQLLQQKLQALAKTIEGYRRSFEYIEDYLRVQGLRILLEESQRIINYNVEKECNAFLRNKVQEFQSEHQSQIIPIPNFPPLLGDPSNNFIGRLAHEILRCTDPKQTIFLDLKSTWYEKKAPHQEVLAGSGFFEILREALAPAGMVGLERLYAHMLADELKRNLERLQRNLTSDRMWVDTLAALTRELEARDFPTPEVSKQPLKYYQAYTQRWLKVWPTLLDWVLCIGQKQLLRREIAGELSFSSKCDAKLLENTADTLNKALLLELS---LSKDLCDEKGVVMLTELQE------------------------TLLYT-GNFEPLEQVFLITKNTHNMALFMFLFTIAHLGRMQHSTITDCLLPKSAKDNIDNVPFIVGLVTILQQFHKNVKMLYISYMSQYVVTVSEAQLLDKEILG--PEVVTALHFLLAFIRIARLPLGVLEQRIPNIILSE 1182          
BLAST of WASH complex subunit 5 vs. Ensembl Fly
Match: Strump (gene:FBgn0036571 transcript:FBtr0301912)

HSP 1 Score: 842.032 bits (2174), Expect = 0.000e+0
Identity = 471/1217 (38.70%), Postives = 737/1217 (60.56%), Query Frame = 2
Query:  122 YLDTN--WGPILLPLVARGSAIICEICRLSDYIPSEYKPN--AIKNEYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYS---VKQSNLDSNTDEVYQLLRSTGY----------------------SVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSC-ELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIID-KYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVF-----KSRTSELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPV--DESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVE--IANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQANF-KDKKNLDIMDSFLRNV------NPISKSVVFKIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDD 3631
            +LD N   G  LL +V+ G++II EI RL DY+PS Y+ +  A K +Y E+I DFSYF ++E  E +I+  PEL +LD++ R   + L+ RFY  F+SI  + SDL  ++  L  G+++Q  L +V+Q+E+G+QL+CE+LYL+G++LL++D  I G  RE+LL++Y+RYS      S  +SN  +V  LLRSTGY                      S+ +P       YPE+YF+R   +  ++ +V+ +LR DD Y+Q   YP P HRS A +TQA M+YVCLYF P  LHSQ + MREIVDK F DNW +  Y+G  VNLVD W  +KAA  A+ N+I    +K+L       + K+     +I++EGVL   FVL+  +K++  +R+ NV +RW  LH+  E+ I   +     Q+++ V+    FN  +++ LL   SQ EL + +    I + KEE W++ + E + R+ EL+E F+G++ L+++ +N +LQ WF +++ +++ L       +GR + Q++QAL +V E+H L SN++VKQ + +T   L QM +L+NL+E + +++ + +D SYA +++   +T  MQ  I + P  VI +RAVFLKLA++ ++PL+R+NQ  S+DL+SV+ YYS+EL  ++R+VLQI+PE MF  LAKII L TN IKE PT+++K+++K+Y  FE+R+++A+LT+ I+VFT+GILMMKTTLVG+IELDP +LLEDGIRKEL+ H++ A++  L+F     K+    L  KL  L+ T++G+RRSFEYI+DY+ + GL++  EE  RIIN+NVEKECN+FLRNK+ ++QS +QS+ IPIP++PP+  D S +FIGRL  EIL+ TDPK  I++   ++WY+ K   +  +A    F  L  A    G+  ++RL+  +L   L+  L+ +Q N   D+  +D + +  R +       P       K Y  Y  R  K+ P  +D++L IGQ QLLR+ IA +L+ SSK +AK L +   T N +LL +L    ++ + C    + +L   +E                         LL++ G  +P+ QV++ T      +++  L   + L ++ +S   D ++ K + D +D     +GLVT+LQQ H  +   +I  +SQY  + + +      ++   PE++  +  L  F  I+R P+ VL   IP  ++ +
Sbjct:    3 FLDDNNACGQNLLNIVSVGNSIIAEILRLKDYVPSIYRLDNKADKAKYGELILDFSYFKIAEDHERRIEQSPELTELDDEAR-AQLPLITRFYLAFQSIHHYASDLQQYIEELNTGYYIQQTLETVLQEEEGRQLLCESLYLFGVILLMVDFHIPGDVRERLLIAYYRYSGGDATPSGDESNIHDVCLLLRSTGYVHPSIAAKVLGLGGKQAGARAASLVVPR------YPEAYFSRFRFDENFVDLVVARLRCDDIYNQLNLYPHPAHRSTALSTQAAMLYVCLYFCPQVLHSQGSQMREIVDKFFCDNWTISVYMGMTVNLVDAWLDFKAARSAIENVISPPAIKALCQQQKEQLGKITQKTQEIVREGVLNDNFVLEHANKIIHLMRQSNVLLRWFCLHTSREVFIFAHTATLTGQVQKCVLHELQFNRNTLYNLLLNCSQMELSVREFLAEIQQTKEERWTKSREEAMQRLNELSEAFAGSRPLSKIEQNPQLQQWFGEVAGRLQKLELSRPQKSGRLIIQVMQALDDVQEYHNLHSNMLVKQQLQETRDMLNQMAQLINLKEDIEIHIQMITDFSYAWHLLQFDFTPPMQEHIKRQPQAVIGIRAVFLKLASTLEVPLMRINQARSEDLVSVSNYYSTELANFLRRVLQIVPETMFSILAKIIYLLTNVIKEFPTKVEKERLKDYAQFEERAKVAQLTNSIAVFTKGILMMKTTLVGVIELDPKQLLEDGIRKELVNHLANAYNLGLIFTPEKGKTPVQLLQQKLQALAKTIEGYRRSFEYIEDYLRVQGLRILLEESQRIINYNVEKECNAFLRNKVQEFQSEHQSQIIPIPNFPPLLGDPSNNFIGRLAHEILRCTDPKQTIFLDLKSTWYEKKAPHQEVLAGSGFFEILREALAPAGMVGLERLYAHMLADELKRNLERLQRNLTSDRMWVDTLAALTRELEARDFPTPEVSKQPLKYYQAYTQRWLKVWPTLLDWVLCIGQKQLLRREIAGELSFSSKCDAKLLENTADTLNKALLLELS---LSKDLCDEKGVVMLTELQE------------------------TLLYT-GNFEPLEQVFLITKNTHNMALFMFLFTIAHLGRMQHSTITDCLLPKSAKDNIDNVPFIVGLVTILQQFHKNVKMLYISYMSQYVVTVSEAQLLDKEILG--PEVVTALHFLLAFIRIARLPLGVLEQRIPNIILSE 1182          
BLAST of WASH complex subunit 5 vs. Ensembl Fly
Match: Strump (gene:FBgn0036571 transcript:FBtr0333292)

HSP 1 Score: 812.757 bits (2098), Expect = 0.000e+0
Identity = 461/1217 (37.88%), Postives = 721/1217 (59.24%), Query Frame = 2
Query:  122 YLDTN--WGPILLPLVARGSAIICEICRLSDYIPSEYKPN--AIKNEYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYS---VKQSNLDSNTDEVYQLLRSTGY----------------------SVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSC-ELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIID-KYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVF-----KSRTSELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPV--DESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVE--IANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQANF-KDKKNLDIMDSFLRNV------NPISKSVVFKIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDD 3631
            +LD N   G  LL +V+ G++II EI RL DY+PS Y+ +  A K +Y E+I DFSYF ++E  E +I+  P                         SI  + SDL  ++  L  G+++Q  L +V+Q+E+G+QL+CE+LYL+G++LL++D  I G  RE+LL++Y+RYS      S  +SN  +V  LLRSTGY                      S+ +P       YPE+YF+R   +  ++ +V+ +LR DD Y+Q   YP P HRS A +TQA M+YVCLYF P  LHSQ + MREIVDK F DNW +  Y+G  VNLVD W  +KAA  A+ N+I    +K+L       + K+     +I++EGVL   FVL+  +K++  +R+ NV +RW  LH+  E+ I   +     Q+++ V+    FN  +++ LL   SQ EL + +    I + KEE W++ + E + R+ EL+E F+G++ L+++ +N +LQ WF +++ +++ L       +GR + Q++QAL +V E+H L SN++VKQ + +T   L QM +L+NL+E + +++ + +D SYA +++   +T  MQ  I + P  VI +RAVFLKLA++ ++PL+R+NQ  S+DL+SV+ YYS+EL  ++R+VLQI+PE MF  LAKII L TN IKE PT+++K+++K+Y  FE+R+++A+LT+ I+VFT+GILMMKTTLVG+IELDP +LLEDGIRKEL+ H++ A++  L+F     K+    L  KL  L+ T++G+RRSFEYI+DY+ + GL++  EE  RIIN+NVEKECN+FLRNK+ ++QS +QS+ IPIP++PP+  D S +FIGRL  EIL+ TDPK  I++   ++WY+ K   +  +A    F  L  A    G+  ++RL+  +L   L+  L+ +Q N   D+  +D + +  R +       P       K Y  Y  R  K+ P  +D++L IGQ QLLR+ IA +L+ SSK +AK L +   T N +LL +L    ++ + C    + +L   +E                         LL++ G  +P+ QV++ T      +++  L   + L ++ +S   D ++ K + D +D     +GLVT+LQQ H  +   +I  +SQY  + + +      ++   PE++  +  L  F  I+R P+ VL   IP  ++ +
Sbjct:    3 FLDDNNACGQNLLNIVSVGNSIIAEILRLKDYVPSIYRLDNKADKAKYGELILDFSYFKIAEDHERRIEQSP-------------------------SIHHYASDLQQYIEELNTGYYIQQTLETVLQEEEGRQLLCESLYLFGVILLMVDFHIPGDVRERLLIAYYRYSGGDATPSGDESNIHDVCLLLRSTGYVHPSIAAKVLGLGGKQAGARAASLVVPR------YPEAYFSRFRFDENFVDLVVARLRCDDIYNQLNLYPHPAHRSTALSTQAAMLYVCLYFCPQVLHSQGSQMREIVDKFFCDNWTISVYMGMTVNLVDAWLDFKAARSAIENVISPPAIKALCQQQKEQLGKITQKTQEIVREGVLNDNFVLEHANKIIHLMRQSNVLLRWFCLHTSREVFIFAHTATLTGQVQKCVLHELQFNRNTLYNLLLNCSQMELSVREFLAEIQQTKEERWTKSREEAMQRLNELSEAFAGSRPLSKIEQNPQLQQWFGEVAGRLQKLELSRPQKSGRLIIQVMQALDDVQEYHNLHSNMLVKQQLQETRDMLNQMAQLINLKEDIEIHIQMITDFSYAWHLLQFDFTPPMQEHIKRQPQAVIGIRAVFLKLASTLEVPLMRINQARSEDLVSVSNYYSTELANFLRRVLQIVPETMFSILAKIIYLLTNVIKEFPTKVEKERLKDYAQFEERAKVAQLTNSIAVFTKGILMMKTTLVGVIELDPKQLLEDGIRKELVNHLANAYNLGLIFTPEKGKTPVQLLQQKLQALAKTIEGYRRSFEYIEDYLRVQGLRILLEESQRIINYNVEKECNAFLRNKVQEFQSEHQSQIIPIPNFPPLLGDPSNNFIGRLAHEILRCTDPKQTIFLDLKSTWYEKKAPHQEVLAGSGFFEILREALAPAGMVGLERLYAHMLADELKRNLERLQRNLTSDRMWVDTLAALTRELEARDFPTPEVSKQPLKYYQAYTQRWLKVWPTLLDWVLCIGQKQLLRREIAGELSFSSKCDAKLLENTADTLNKALLLELS---LSKDLCDEKGVVMLTELQE------------------------TLLYT-GNFEPLEQVFLITKNTHNMALFMFLFTIAHLGRMQHSTITDCLLPKSAKDNIDNVPFIVGLVTILQQFHKNVKMLYISYMSQYVVTVSEAQLLDKEILG--PEVVTALHFLLAFIRIARLPLGVLEQRIPNIILSE 1158          
BLAST of WASH complex subunit 5 vs. Ensembl Zebrafish
Match: washc5 (WASH complex subunit 5 [Source:NCBI gene;Acc:393152])

HSP 1 Score: 1030.78 bits (2664), Expect = 0.000e+0
Identity = 526/1046 (50.29%), Postives = 727/1046 (69.50%), Query Frame = 2
Query:  518 CEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVF--KSRTSELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQAN-FKDKKNLDIMDSFLRNVNPISKSV--VFKIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDDIRT 3640
            CEALYLYG+MLL+IDQK+EG  RE++LVSY+RYS  +S+ DSN D++ +LLRSTGYS S P  KRP +YPESYF R+ I++ +ISMV+ +LRSDD Y+Q  AYPLPEHRS A ATQA M+YVCLYF P+ LH+Q A MREIVDK+F DNWV+  Y+G  VNLV+ W PYKAA +AL   ++  N++     Y   ++ L P + ++LKEG L +E +LD I KL++ +R+CNV IRWLMLH+ E S    +NK+  Q+++ V+  + +N + +FQLL  T+QFE  L +MF+ +L  K+  W   K EG +RM ELAEVFSG K L RV KN+ LQ WF ++SKQIE+L+++++T AGR   QLIQAL EV EFHQL+SNL V QF+ DT   L QM+R +N++E VL+ + I  D+SYA  IID +T  MQ  I  +P +V KLRA FLKLA++ D+PL+R+NQ +S DLLSV+Q+YS ELV YVRKVLQIIPE MF  LAKII LQ ++I E+PTRLDKDK+K+Y     R E+A+LTH ISVFT+GILMMKTTLVGII++DP +LLEDGIRKEL+K V+ A  K L+F  K++ SEL  KL +++ TMDGF RSFEYIQDYV+IYGLK+W+EEVSRIIN+NVE+ECNSFLR KI D+QS++QS  IPIP YP VDES +FIGRL +EIL++TDPK   Y+  +N+WYD++T  E+ N +LFS+++    +FGL  +DRL   ++VK LQNFL  +Q +  KDK  +D+  + L  VNP+   V    K+Y +   +  KI    ++ I+K+GQ+Q+LR+ IAN+LN S KF++K L +AL   N SLL+D+E H  +P + PYP        KE               D  ++   +  L +AG+H+P++++YITT +  +  +   L L + L KL Y+++   +  ++  DALD   L +GL+TLL+Q H    ++++ L+ Q+ RS      S+  +   P +++  ++ L+D+   ++ P  V  A +P ++ D+ RT
Sbjct:    2 CEALYLYGVMLLVIDQKMEGEVRERMLVSYYRYSAARSSADSNLDDICKLLRSTGYS-SHPGAKRPTNYPESYFQRVPISSTFISMVIGRLRSDDIYNQVSAYPLPEHRSTALATQAAMLYVCLYFTPSILHTQQAKMREIVDKYFPDNWVISIYMGITVNLVEAWEPYKAAKIALNYTLDTANIREQAGRYAASVETLRPQVQQLLKEGFLREEIILDNIPKLLNCLRDCNVAIRWLMLHTAE-SAYDPNNKRLRQIKDQVINDSKYNPKILFQLLLDTAQFEFILKEMFKQMLAEKQLKWESYKKEGSERMMELAEVFSGVKPLTRVEKNENLQAWFREISKQIESLNYEDSTAAGRKTVQLIQALVEVQEFHQLESNLQVCQFLADTRKFLHQMIRTINIKEEVLITMQIVGDLSYAWQIIDSFTAIMQESIRANPSMVTKLRATFLKLASALDLPLLRINQVNSPDLLSVSQFYSGELVAYVRKVLQIIPESMFTSLAKIIKLQIHDIMEVPTRLDKDKLKDYSQLSARYEVAKLTHAISVFTEGILMMKTTLVGIIQVDPKQLLEDGIRKELVKRVAYALHKGLIFNPKAKPSELMPKLKEMAATMDGFYRSFEYIQDYVSIYGLKIWQEEVSRIINYNVEQECNSFLRTKIQDWQSVHQSTHIPIPKYPSVDESATFIGRLCREILRITDPKVTCYIDQLNTWYDLRTHQEVTNNRLFSEIQDTLGTFGLNGLDRLLCFMIVKELQNFLTVLQKSILKDKAVVDVFKALLTAVNPVKGIVANASKVYTNAAAKTQKIWSPYLESIMKVGQMQILRQQIANELNYSCKFDSKHLAAALDNLNKSLLSDIEAHYQDP-SLPYP--------KE---------------DNTLLYEITAYLEAAGIHNPLNKIYITTKRLPYFPIVNFLFLIAQLPKLQYNKS-QGMACRKPADALDWAPLVLGLLTLLKQFHSRYTEQFLALIGQFIRSIMEQCTSQK-IPDMPSDVVGALMFLEDYVRYTKLPRKVAEAHVPSFIFDEFRT 1019          
BLAST of WASH complex subunit 5 vs. Ensembl Xenopus
Match: washc5 (WASH complex subunit 5 [Source:NCBI gene;Acc:448397])

HSP 1 Score: 1136.71 bits (2939), Expect = 0.000e+0
Identity = 579/1186 (48.82%), Postives = 819/1186 (69.06%), Query Frame = 2
Query:  110 MTEFYLDTNW-GPILLPLVARGSAIICEICRLSDYIPSEY--KPNAIKNEYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVFKSRT--SELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNF-LQHMQANFKDKKNLDIMDSFLRNVNPISKSVV--FKIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPN-TCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDDIRT 3640
            M +F  + N  G  +L +V+RG+AII E+ RLS+++PS +  K  A + +Y +II DFSYF   E  E +++A+PELQDLDE+FR+N++E+L RFY  FES+ +++ DLN +L  L +G ++Q  L +V+ +EDGKQL+CEALYLYG+MLL+IDQKIEG  RE++LV+Y+RYS  +S++DSN D++ +LLRSTGYS S P  KRP +YPESYF+R+ I+  +ISMV+ +LRSDD Y+Q  AYPLPEHRS A ATQA ++YV LYF P  LH+  A MREIVDK+F DNWV+  Y+G  VNL++ W PYKAA  AL   ++L N+K   + Y ++I+ L P + + LKEG L +EFVLD I KL++ +R+CNV IRWLMLH+ + S    +NK+  Q+++ V+  + +N + +FQLL  T+QFE  L +MF+ +L  K+  W   K EG +RM ELA+VFSG K L RV KN+ LQ WF +++KQI +L++ ++T AGR   QLIQAL EV EFHQL++NL V QF+ DT   L QM+R +N++E VL+ + I  D+SYA  +ID +T  MQ  I  +P +V KLRA FLKLA++ D+PL+R+NQ +S DLLSV+QYYS ELV YVRKVLQIIPE MF  LAKII LQT++I E+PTRLDKDK+++Y     R E+A+LT+ IS+FT+GILMMKTTLVGII++DP +LLEDGIRKEL+K V+ A  K L+F SR   SEL  KL D++ TMDGF RSFEYIQDYV+IYGLK+W+EEVSRI+N+NVE+ECN+FLR KI D+QS+YQS  IPIP +PPVDES++FIGRL +EIL++TDPK   Y+  +N+WYD+KT  E+ N  LFS++  +  +FGL  +DRL   ++VK LQNF L + +   +DK   + + +  + V P+   V    KIY+    +  KI P  +D I+K+GQ+Q+LR+ IAN+LN S KF++K L  AL  FN ++L D++ H  +P+  CP     LL                            +  L +AG H+P++++YITT +  F  +   L L + L KL Y++    +  ++  D +D   L +GL+TLL+Q H    ++++ L+ Q+ RS +L   +   +   P +++  ++ L+D+ + ++ P  V+ A +P ++ D+ RT
Sbjct:    1 MVDFLAENNLCGQAILRIVSRGNAIIAELLRLSEFVPSVFRLKDKADQQKYGDIIFDFSYFKGPEVCEGRLEAKPELQDLDEEFRENNIEILTRFYLAFESVHKYIVDLNRYLEDLNEGIYIQQTLETVLLNEDGKQLLCEALYLYGVMLLVIDQKIEGEVRERMLVAYYRYSAARSSVDSNMDDICKLLRSTGYS-SQPGAKRPPNYPESYFSRVPISETFISMVIGRLRSDDIYNQVSAYPLPEHRSTALATQAAILYVILYFHPPTLHTHQAKMREIVDKYFPDNWVISIYMGITVNLMEVWEPYKAAKTALNYTLDLPNIKEQASRYAKIIESLHPQVQQFLKEGFLREEFVLDNIPKLLNCLRDCNVAIRWLMLHTAD-SAYDPNNKRLRQVKDQVLADSKYNPKILFQLLLDTAQFEFLLKEMFKQMLSEKQNKWESYKKEGSERMTELADVFSGVKPLTRVEKNEHLQAWFREIAKQIHSLNYDDSTAAGRKTVQLIQALEEVQEFHQLETNLQVCQFLADTRKFLHQMIRTINIKEEVLITMQIVGDLSYAWQLIDSFTAIMQESIRANPSMVTKLRATFLKLASALDLPLLRINQANSPDLLSVSQYYSGELVFYVRKVLQIIPESMFTSLAKIIKLQTHDIIEVPTRLDKDKLRDYAQLGARYEVAKLTNAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRKELVKRVAVALHKGLIFNSRAKPSELLPKLKDMAATMDGFHRSFEYIQDYVSIYGLKIWQEEVSRIVNYNVEQECNNFLRTKIQDWQSMYQSTHIPIPKFPPVDESMTFIGRLCREILRITDPKVTCYIDQMNTWYDMKTHQEVTNNHLFSEINDSLGTFGLNGLDRLLCFMIVKELQNFILLYQRLILRDKSAQETLRALQKVVTPVKGIVANSAKIYSAAIAKTQKIWPAYLDAIMKVGQMQVLRQQIANELNYSCKFDSKHLAGALENFNEAILADIQAHYQDPSLPCPREDNTLL-------------------------YEITAYLEAAGTHNPLNKIYITTKQLSFFPIVNFLFLVAQLPKLQYNKNL-GMTCRKPADPIDWVPLVLGLLTLLKQFHSRYTEQFLALIGQFIRS-SLEQSTSQKIPEMPADVVGALMFLEDYVHFAKLPRRVVEAHVPNFIFDEFRT 1157          
BLAST of WASH complex subunit 5 vs. Ensembl Xenopus
Match: washc5 (WASH complex subunit 5 [Source:NCBI gene;Acc:448397])

HSP 1 Score: 1102.04 bits (2849), Expect = 0.000e+0
Identity = 554/1085 (51.06%), Postives = 763/1085 (70.32%), Query Frame = 2
Query:  110 MTEFYLDTNW-GPILLPLVARGSAIICEICRLSDYIPSEY--KPNAIKNEYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVFKSRT--SELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNF-LQHMQANFKDKKNLDIMDSFLRNVNPISKSVV--FKIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPN-TCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSR 3337
            M +F  + N  G  +L +V+RG+AII E+ RLS+++PS +  K  A + +Y +II DFSYF   E  E +++A+PELQDLDE+FR+N++E+L RFY  FES+ +++ DLN +L  L +G ++Q  L +V+ +EDGKQL+CEALYLYG+MLL+IDQKIEG  RE++LV+Y+RYS  +S++DSN D++ +LLRSTGYS S P  KRP +YPESYF+R+ I+  +ISMV+ +LRSDD Y+Q  AYPLPEHRS A ATQA ++YV LYF P  LH+  A MREIVDK+F DNWV+  Y+G  VNL++ W PYKAA  AL   ++L N+K   + Y ++I+ L P + + LKEG L +EFVLD I KL++ +R+CNV IRWLMLH+ + S    +NK+  Q+++ V+  + +N + +FQLL  T+QFE  L +MF+ +L  K+  W   K EG +RM ELA+VFSG K L RV KN+ LQ WF +++KQI +L++ ++T AGR   QLIQAL EV EFHQL++NL V QF+ DT   L QM+R +N++E VL+ + I  D+SYA  +ID +T  MQ  I  +P +V KLRA FLKLA++ D+PL+R+NQ +S DLLSV+QYYS ELV YVRKVLQIIPE MF  LAKII LQT++I E+PTRLDKDK+++Y     R E+A+LT+ IS+FT+GILMMKTTLVGII++DP +LLEDGIRKEL+K V+ A  K L+F SR   SEL  KL D++ TMDGF RSFEYIQDYV+IYGLK+W+EEVSRI+N+NVE+ECN+FLR KI D+QS+YQS  IPIP +PPVDES++FIGRL +EIL++TDPK   Y+  +N+WYD+KT  E+ N  LFS++  +  +FGL  +DRL   ++VK LQNF L + +   +DK   + + +  + V P+   V    KIY+    +  KI P  +D I+K+GQ+Q+LR+ IAN+LN S KF++K L  AL  FN ++L D++ H  +P+  CP     LL                            +  L +AG H+P++++YITT +  F  +   L L + L KL Y++
Sbjct:    1 MVDFLAENNLCGQAILRIVSRGNAIIAELLRLSEFVPSVFRLKDKADQQKYGDIIFDFSYFKGPEVCEGRLEAKPELQDLDEEFRENNIEILTRFYLAFESVHKYIVDLNRYLEDLNEGIYIQQTLETVLLNEDGKQLLCEALYLYGVMLLVIDQKIEGEVRERMLVAYYRYSAARSSVDSNMDDICKLLRSTGYS-SQPGAKRPPNYPESYFSRVPISETFISMVIGRLRSDDIYNQVSAYPLPEHRSTALATQAAILYVILYFHPPTLHTHQAKMREIVDKYFPDNWVISIYMGITVNLMEVWEPYKAAKTALNYTLDLPNIKEQASRYAKIIESLHPQVQQFLKEGFLREEFVLDNIPKLLNCLRDCNVAIRWLMLHTAD-SAYDPNNKRLRQVKDQVLADSKYNPKILFQLLLDTAQFEFLLKEMFKQMLSEKQNKWESYKKEGSERMTELADVFSGVKPLTRVEKNEHLQAWFREIAKQIHSLNYDDSTAAGRKTVQLIQALEEVQEFHQLETNLQVCQFLADTRKFLHQMIRTINIKEEVLITMQIVGDLSYAWQLIDSFTAIMQESIRANPSMVTKLRATFLKLASALDLPLLRINQANSPDLLSVSQYYSGELVFYVRKVLQIIPESMFTSLAKIIKLQTHDIIEVPTRLDKDKLRDYAQLGARYEVAKLTNAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRKELVKRVAVALHKGLIFNSRAKPSELLPKLKDMAATMDGFHRSFEYIQDYVSIYGLKIWQEEVSRIVNYNVEQECNNFLRTKIQDWQSMYQSTHIPIPKFPPVDESMTFIGRLCREILRITDPKVTCYIDQMNTWYDMKTHQEVTNNHLFSEINDSLGTFGLNGLDRLLCFMIVKELQNFILLYQRLILRDKSAQETLRALQKVVTPVKGIVANSAKIYSAAIAKTQKIWPAYLDAIMKVGQMQVLRQQIANELNYSCKFDSKHLAGALENFNEAILADIQAHYQDPSLPCPREDNTLL-------------------------YEITAYLEAAGTHNPLNKIYITTKQLSFFPIVNFLFLVAQLPKLQYNK 1058          
BLAST of WASH complex subunit 5 vs. Ensembl Xenopus
Match: washc5 (WASH complex subunit 5 [Source:NCBI gene;Acc:448397])

HSP 1 Score: 1067.37 bits (2759), Expect = 0.000e+0
Identity = 554/1171 (47.31%), Postives = 783/1171 (66.87%), Query Frame = 2
Query:  110 MTEFYLDTNW-GPILLPLVARGSAIICEICRLSDYIPSEY--KPNAIKNEYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVFKSRT--SELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNF-LQHMQANFKDKKNLDIMDSFLRNVNPISKSVV--FKIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPN-TCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINV 3595
            M +F  + N  G  +L +V+RG+AII E+ RLS+++PS +  K  A + +Y +II DFSYF   E  E +++A+PELQDLDE+FR+N++E+L RFY  FES+ +++ DLN +L  L +G ++Q  L +V+ +EDGKQL+CEALYLYG+MLL+IDQKIEG  RE++LV+Y+RYS  +S++DSN D++ +LLRSTGYS S P  KRP +YPESYF+R+ I+  +ISMV+ +LRSDD Y+Q  AYPLPEHRS A ATQA ++YV LYF P  LH+  A MREIVDK+F DNWV+  Y+G  VNL++ W PYKAA  AL   ++L N+K   + Y ++I+ L P + + LKEG L +EFVLD I KL++ +R+CNV IRWLMLH+ + S    +NK+  Q+++ V+  + +N + +FQLL  T+QFE  L +MF+ +L  K+  W   K EG +RM ELA+VFSG K L RV KN+ LQ WF +++KQI +L++ ++T AGR   QLIQAL EV EFHQL++NL V QF+ DT   L QM+R +N++E VL+ + I  D+SYA  +ID +T  MQ  I  +P +V KLRA FLKLA++ D+PL+R+NQ +S DLLSV+QYYS ELV YVRKVLQIIPE MF  LAKII LQT++I E+PTRLDKDK+++Y     R E+                           DP +LLEDGIRKEL+K V+ A  K L+F SR   SEL  KL D++ TMDGF RSFEYIQDYV+IYGLK+W+EEVSRI+N+NVE+ECN+FLR KI D+QS+YQS  IPIP +PPVDES++FIGRL +EIL++TDPK   Y+  +N+WYD+KT  E+ N  LFS++  +  +FGL  +DRL   ++VK LQNF L + +   +DK   + + +  + V P+   V    KIY+    +  KI P  +D I+K+GQ+Q+LR+ IAN+LN S KF++K L  AL  FN ++L D++ H  +P+  CP     LL                            +  L +AG H+P++++YITT +  F  +   L L + L KL Y++    +  ++  D +D   L +GL+TLL+Q H    ++++ L+ Q+ RS +L   +   +   P +++  ++ L+D+ + ++ P  V
Sbjct:    1 MVDFLAENNLCGQAILRIVSRGNAIIAELLRLSEFVPSVFRLKDKADQQKYGDIIFDFSYFKGPEVCEGRLEAKPELQDLDEEFRENNIEILTRFYLAFESVHKYIVDLNRYLEDLNEGIYIQQTLETVLLNEDGKQLLCEALYLYGVMLLVIDQKIEGEVRERMLVAYYRYSAARSSVDSNMDDICKLLRSTGYS-SQPGAKRPPNYPESYFSRVPISETFISMVIGRLRSDDIYNQVSAYPLPEHRSTALATQAAILYVILYFHPPTLHTHQAKMREIVDKYFPDNWVISIYMGITVNLMEVWEPYKAAKTALNYTLDLPNIKEQASRYAKIIESLHPQVQQFLKEGFLREEFVLDNIPKLLNCLRDCNVAIRWLMLHTAD-SAYDPNNKRLRQVKDQVLADSKYNPKILFQLLLDTAQFEFLLKEMFKQMLSEKQNKWESYKKEGSERMTELADVFSGVKPLTRVEKNEHLQAWFREIAKQIHSLNYDDSTAAGRKTVQLIQALEEVQEFHQLETNLQVCQFLADTRKFLHQMIRTINIKEEVLITMQIVGDLSYAWQLIDSFTAIMQESIRANPSMVTKLRATFLKLASALDLPLLRINQANSPDLLSVSQYYSGELVFYVRKVLQIIPESMFTSLAKIIKLQTHDIIEVPTRLDKDKLRDYAQLGARYEV---------------------------DPKQLLEDGIRKELVKRVAVALHKGLIFNSRAKPSELLPKLKDMAATMDGFHRSFEYIQDYVSIYGLKIWQEEVSRIVNYNVEQECNNFLRTKIQDWQSMYQSTHIPIPKFPPVDESMTFIGRLCREILRITDPKVTCYIDQMNTWYDMKTHQEVTNNHLFSEINDSLGTFGLNGLDRLLCFMIVKELQNFILLYQRLILRDKSAQETLRALQKVVTPVKGIVANSAKIYSAAIAKTQKIWPAYLDAIMKVGQMQVLRQQIANELNYSCKFDSKHLAGALENFNEAILADIQAHYQDPSLPCPREDNTLL-------------------------YEITAYLEAAGTHNPLNKIYITTKQLSFFPIVNFLFLVAQLPKLQYNKNL-GMTCRKPADPIDWVPLVLGLLTLLKQFHSRYTEQFLALIGQFIRS-SLEQSTSQKIPEMPADVVGALMFLEDYVHFAKLPRRV 1115          
BLAST of WASH complex subunit 5 vs. Ensembl Xenopus
Match: washc5 (WASH complex subunit 5 [Source:NCBI gene;Acc:448397])

HSP 1 Score: 1026.93 bits (2654), Expect = 0.000e+0
Identity = 540/1171 (46.11%), Postives = 770/1171 (65.76%), Query Frame = 2
Query:  110 MTEFYLDTNW-GPILLPLVARGSAIICEICRLSDYIPSEY--KPNAIKNEYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVFKSRT--SELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNF-LQHMQANFKDKKNLDIMDSFLRNVNPISKSVV--FKIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPN-TCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINV 3595
            M +F  + N  G  +L +V+RG+AII E+ RLS+++PS +  K  A + +Y +II DFSYF   E  E +++A+PELQDLDE+FR+N++E+L RFY  FES+ +++ DLN +L  L +G ++Q  L +V+ +EDGKQL+CEALYLYG+MLL+IDQKIEG  RE++LV+Y+RYS  +S++DSN D++ +LLRSTGYS S P  KRP +YPESYF+R+ I+  +ISMV+ +LRSDD Y                                                   N V+  Y+G  VNL++ W PYKAA  AL   ++L N+K   + Y ++I+ L P + + LKEG L +EFVLD I KL++ +R+CNV IRWLMLH+ + S    +NK+  Q+++ V+  + +N + +FQLL  T+QFE  L +MF+ +L  K+  W   K EG +RM ELA+VFSG K L RV KN+ LQ WF +++KQI +L++ ++T AGR   QLIQAL EV EFHQL++NL V QF+ DT   L QM+R +N++E VL+ + I  D+SYA  +ID +T  MQ  I  +P +V KLRA FLKLA++ D+PL+R+NQ +S DLLSV+QYYS ELV YVRKVLQIIPE MF  LAKII LQT++I E+PTRLDKDK+++Y     R E+A+LT+ IS+FT+GILMMKTTLVGII++DP +LLEDGIRKEL+K V+ A  K L+F SR   SEL  KL D++ TMDGF RSFEYIQDYV+IYGLK+W+EEVSRI+N+NVE+ECN+FLR KI D+QS+YQS  IPIP +PPVDES++FIGRL +EIL++TDPK   Y+  +N+WYD+KT  E+ N  LFS++  +  +FGL  +DRL   ++VK LQNF L + +   +DK   + + +  + V P+   V    KIY+    +  KI P  +D I+K+GQ+Q+LR+ IAN+LN S KF++K L  AL  FN ++L D++ H  +P+  CP     LL                            +  L +AG H+P++++YITT +  F  +   L L + L KL Y++    +  ++  D +D   L +GL+TLL+Q H    ++++ L+ Q+ RS +L   +   +   P +++  ++ L+D+ + ++ P  V
Sbjct:    1 MVDFLAENNLCGQAILRIVSRGNAIIAELLRLSEFVPSVFRLKDKADQQKYGDIIFDFSYFKGPEVCEGRLEAKPELQDLDEEFRENNIEILTRFYLAFESVHKYIVDLNRYLEDLNEGIYIQQTLETVLLNEDGKQLLCEALYLYGVMLLVIDQKIEGEVRERMLVAYYRYSAARSSVDSNMDDICKLLRSTGYS-SQPGAKRPPNYPESYFSRVPISETFISMVIGRLRSDDIY---------------------------------------------------NQVISIYMGITVNLMEVWEPYKAAKTALNYTLDLPNIKEQASRYAKIIESLHPQVQQFLKEGFLREEFVLDNIPKLLNCLRDCNVAIRWLMLHTAD-SAYDPNNKRLRQVKDQVLADSKYNPKILFQLLLDTAQFEFLLKEMFKQMLSEKQNKWESYKKEGSERMTELADVFSGVKPLTRVEKNEHLQAWFREIAKQIHSLNYDDSTAAGRKTVQLIQALEEVQEFHQLETNLQVCQFLADTRKFLHQMIRTINIKEEVLITMQIVGDLSYAWQLIDSFTAIMQESIRANPSMVTKLRATFLKLASALDLPLLRINQANSPDLLSVSQYYSGELVFYVRKVLQIIPESMFTSLAKIIKLQTHDIIEVPTRLDKDKLRDYAQLGARYEVAKLTNAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRKELVKRVAVALHKGLIFNSRAKPSELLPKLKDMAATMDGFHRSFEYIQDYVSIYGLKIWQEEVSRIVNYNVEQECNNFLRTKIQDWQSMYQSTHIPIPKFPPVDESMTFIGRLCREILRITDPKVTCYIDQMNTWYDMKTHQEVTNNHLFSEINDSLGTFGLNGLDRLLCFMIVKELQNFILLYQRLILRDKSAQETLRALQKVVTPVKGIVANSAKIYSAAIAKTQKIWPAYLDAIMKVGQMQVLRQQIANELNYSCKFDSKHLAGALENFNEAILADIQAHYQDPSLPCPREDNTLL-------------------------YEITAYLEAAGTHNPLNKIYITTKQLSFFPIVNFLFLVAQLPKLQYNKNL-GMTCRKPADPIDWVPLVLGLLTLLKQFHSRYTEQFLALIGQFIRS-SLEQSTSQKIPEMPADVVGALMFLEDYVHFAKLPRRV 1091          
BLAST of WASH complex subunit 5 vs. Ensembl Xenopus
Match: washc5 (WASH complex subunit 5 [Source:NCBI gene;Acc:448397])

HSP 1 Score: 1003.43 bits (2593), Expect = 0.000e+0
Identity = 531/1169 (45.42%), Postives = 758/1169 (64.84%), Query Frame = 2
Query:  110 MTEFYLDTNW-GPILLPLVARGSAIICEICRLSDYIPSEY--KPNAIKNEYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVFKSRTSELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNF-LQHMQANFKDKKNLDIMDSFLRNVNPISKSVV--FKIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPN-TCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINV 3595
            M +F  + N  G  +L +V+RG+AII E+ RLS+++PS +  K  A + +Y +II DFSYF   E  E +++A+PELQDLDE+FR+N++E+L RFY  FES+ +++ DLN +L  L +G ++Q  L +V+ +EDGKQL+CEALYLYG+MLL+IDQKIEG  RE++LV+Y+RYS  +S++DSN D++ +LLRSTGYS S P  KRP +YPESYF+R+ I+  +ISMV+ +LRSDD Y+Q  AYPLPEHRS A ATQA ++YV LYF P  LH+  A MREIVDK+F DNWV+  Y+G  VNL++ W PYKAA  AL   ++L N+K   + Y ++I+ L P + + LKEG L +EFVLD I KL++ +R+CNV IRWLMLH+ + S    +NK+  Q+++ V+  + +N + +FQLL  T+QFE  L +MF+ +L  K+  W   K EG +RM ELA+VFSG K L RV KN+ LQ WF +++KQI +L++ ++T AGR   QLIQAL EV EFHQL++NL V QF+ DT   L QM+R +N++E VL+ + I  D+SYA  +ID +T  MQ  I  +P +V KLRA FLKLA++ D+PL+R+NQ +S DLLSV+QYYS ELV YVRKVLQIIPE MF  LAKII LQT++I E+PTRLDKDK+++Y     R E+A+LT+ IS+FT+GILMMKTTLVGII++DP +LLEDGIRKEL+K V+ A  K L+F SR     AK+ D                                                     +QS+YQS  IPIP +PPVDES++FIGRL +EIL++TDPK   Y+  +N+WYD+KT  E+ N  LFS++  +  +FGL  +DRL   ++VK LQNF L + +   +DK   + + +  + V P+   V    KIY+    +  KI P  +D I+K+GQ+Q+LR+ IAN+LN S KF++K L  AL  FN ++L D++ H  +P+  CP     LL                            +  L +AG H+P++++YITT +  F  +   L L + L KL Y++    +  ++  D +D   L +GL+TLL+Q H    ++++ L+ Q+ RS +L   +   +   P +++  ++ L+D+ + ++ P  V
Sbjct:    1 MVDFLAENNLCGQAILRIVSRGNAIIAELLRLSEFVPSVFRLKDKADQQKYGDIIFDFSYFKGPEVCEGRLEAKPELQDLDEEFRENNIEILTRFYLAFESVHKYIVDLNRYLEDLNEGIYIQQTLETVLLNEDGKQLLCEALYLYGVMLLVIDQKIEGEVRERMLVAYYRYSAARSSVDSNMDDICKLLRSTGYS-SQPGAKRPPNYPESYFSRVPISETFISMVIGRLRSDDIYNQVSAYPLPEHRSTALATQAAILYVILYFHPPTLHTHQAKMREIVDKYFPDNWVISIYMGITVNLMEVWEPYKAAKTALNYTLDLPNIKEQASRYAKIIESLHPQVQQFLKEGFLREEFVLDNIPKLLNCLRDCNVAIRWLMLHTAD-SAYDPNNKRLRQVKDQVLADSKYNPKILFQLLLDTAQFEFLLKEMFKQMLSEKQNKWESYKKEGSERMTELADVFSGVKPLTRVEKNEHLQAWFREIAKQIHSLNYDDSTAAGRKTVQLIQALEEVQEFHQLETNLQVCQFLADTRKFLHQMIRTINIKEEVLITMQIVGDLSYAWQLIDSFTAIMQESIRANPSMVTKLRATFLKLASALDLPLLRINQANSPDLLSVSQYYSGELVFYVRKVLQIIPESMFTSLAKIIKLQTHDIIEVPTRLDKDKLRDYAQLGARYEVAKLTNAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRKELVKRVAVALHKGLIFNSR-----AKIQD-----------------------------------------------------WQSMYQSTHIPIPKFPPVDESMTFIGRLCREILRITDPKVTCYIDQMNTWYDMKTHQEVTNNHLFSEINDSLGTFGLNGLDRLLCFMIVKELQNFILLYQRLILRDKSAQETLRALQKVVTPVKGIVANSAKIYSAAIAKTQKIWPAYLDAIMKVGQMQVLRQQIANELNYSCKFDSKHLAGALENFNEAILADIQAHYQDPSLPCPREDNTLL-------------------------YEITAYLEAAGTHNPLNKIYITTKQLSFFPIVNFLFLVAQLPKLQYNKNL-GMTCRKPADPIDWVPLVLGLLTLLKQFHSRYTEQFLALIGQFIRS-SLEQSTSQKIPEMPADVVGALMFLEDYVHFAKLPRRV 1082          
BLAST of WASH complex subunit 5 vs. Ensembl Mouse
Match: Washc5 (WASH complex subunit 5 [Source:MGI Symbol;Acc:MGI:2146110])

HSP 1 Score: 1112.06 bits (2875), Expect = 0.000e+0
Identity = 572/1186 (48.23%), Postives = 809/1186 (68.21%), Query Frame = 2
Query:  110 MTEFYLDTNW-GPILLPLVARGSAIICEICRLSDYIPSEY--KPNAIKNEYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVFKSRT--SELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQA-NFKDKKNLDIMDSFLRNVNPISKSVVF---KIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDDIRT 3640
            M +F  + N  G  +L +V+ G+AII E+ RLS++IP+ +  K  A +  Y +II DFSYF   E +E K++A+PELQDLDE+FR+N++E++ RFY  F+S+ +++ DLN +L  L +G ++Q  L +V+  EDGKQL+CEALYLYG+MLL+IDQKIEG  RE++LVSY+RYS  +S+ DSN D++ +LLRSTGYS S P  KRP +YPESYF R+ IN  +ISMV+ +LRSDD Y+Q  AYPLPEHRS A A QA M+YV LYF P+ LH+  A MREIVDK+F DNWV+  Y+G  VNL D W PYKAA  AL N ++L NVK   + Y  +  ++   + + LKEG L +E +LD I +L++ +R+CNV IRWLMLH+ + S    +NK+  Q+++ ++  + +N + +FQLL  T+QFE  L +MF+ +L  K+  W   K EG +RM ELA+VFSG K L RV KN+ LQ WF ++SKQI +L++ ++T AGR   QLIQAL EV EFHQL+SNL V QF+ DT   L QM+R +N++E VL+ + I  D+S+A  +ID +T  MQ  I  +P +V KLRA FLKLA++ D+PL+R+NQ +S DLLSV+QYYS ELV YVRKVLQIIPE MF  L KII LQT++I E+PTRLDKDK+++Y     R E+A+LTH IS+FT+GILMMKTTLVGII++DP +LLEDGIRKEL+K V+ A  + L+F  R   SEL  KL +L  TMDGF RSFEYIQDYV+IYGLK+W+EEVSRIIN+NVE+ECN+FLR KI D+QS+YQS  IPIP + PVDES++FIGRL +EIL++TDPK   Y+  +N+WYD+KT  E+ + +LFS++++   +FGL  +DRL   ++VK LQNFL   Q    K++   + +   +  VNP+ KS+V    K+Y     +  KI    ++ I+K+GQ+Q+LR+ IAN+LN S +F+++ L +AL   N +LL D+E H  +P + PYP                         D  ++   +  L +AG+H+P++++YITT +  +  +   L L + L KL Y++    ++ ++  D +D   L +GL+TLL+Q H    ++++ L+ Q+ RS      S+  +   P + +  +L L+D+   ++ P  V  A +P ++ D+ RT
Sbjct:    1 MLDFLAENNLCGQAILRIVSCGNAIIAEVLRLSEFIPAVFLLKDRADQQRYGDIIFDFSYFKGPEFWESKLEAKPELQDLDEEFRENNIEIVTRFYLAFQSVHKYIVDLNRYLDDLNEGVYIQQTLETVLLSEDGKQLLCEALYLYGVMLLVIDQKIEGEVRERMLVSYYRYSAARSSADSNMDDICKLLRSTGYS-SQPGAKRPPNYPESYFQRVPINETFISMVIGRLRSDDIYNQVSAYPLPEHRSTALANQAAMLYVILYFEPSILHTHQAKMREIVDKYFPDNWVISIYMGITVNLADAWEPYKAAKTALNNTLDLANVKEQASRYASVSDRVRAQVQQFLKEGYLREEVLLDNIPRLLNCLRDCNVAIRWLMLHTAD-SACDPNNKRLRQIKDQILADSRYNPKILFQLLLDTAQFEFILKEMFKQMLSEKQSKWEHYKKEGSERMTELADVFSGVKPLTRVEKNENLQAWFREISKQILSLNYDDSTAAGRKTVQLIQALEEVQEFHQLESNLQVCQFLADTRKFLHQMIRTINIKEEVLITVQIIGDLSFAWQLIDSFTSIMQESIRVNPSMVTKLRATFLKLASALDLPLLRINQANSPDLLSVSQYYSGELVSYVRKVLQIIPESMFTSLLKIIKLQTHDIMEVPTRLDKDKLRDYAQLGPRYEVAKLTHAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRKELVKRVAFALHRGLIFNPRAKPSELMPKLKELGATMDGFHRSFEYIQDYVSIYGLKIWQEEVSRIINYNVEQECNNFLRTKIQDWQSMYQSTHIPIPKFAPVDESITFIGRLCREILRITDPKMTCYIDQLNTWYDVKTHQEVTSSRLFSEIQTTLGTFGLNGLDRLLCFMIVKELQNFLSMFQKIILKERTVQETLKMLMSAVNPL-KSIVANSSKVYLSAITKTQKIWSAYLEAIMKVGQMQILRQQIANELNSSCRFDSRHLAAALDNLNKALLADIEAHYRDP-SLPYPK-----------------------EDNTLLYEITAYLEAAGIHNPLNKIYITTKRLPYFPIVNFLFLIAQLPKLQYNKNL-GMVCRKPADPVDWPPLVLGLLTLLKQFHSRYTEQFLALIGQFIRSTMEQCTSQK-MPEMPADAVGALLFLEDYVRYTKLPRRVAEAHVPNFIFDEFRT 1157          
BLAST of WASH complex subunit 5 vs. Ensembl Mouse
Match: Washc5 (WASH complex subunit 5 [Source:MGI Symbol;Acc:MGI:2146110])

HSP 1 Score: 631.713 bits (1628), Expect = 0.000e+0
Identity = 337/726 (46.42%), Postives = 484/726 (66.67%), Query Frame = 2
Query: 1481 GTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVFKSRT--SELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQA-NFKDKKNLDIMDSFLRNVNPISKSVVF---KIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDDIRT 3640
            G KA  +  + + LQ WF ++SKQI +L++ ++T AGR   QLIQAL EV EFHQL+SNL V QF+ DT   L QM+R +N++E VL+ + I  D+S+A  +ID +T  MQ  I  +P +V KLRA FLKLA++ D+PL+R+NQ +S DLLSV+QYYS ELV YVRKVLQIIPE MF  L KII LQT++I E+PTRLDKDK+++Y     R E+A+LTH IS+FT+GILMMKTTLVGII++DP +LLEDGIRKEL+K V+ A  + L+F  R   SEL  KL +L  TMDGF RSFEYIQDYV+IYGLK+W+EEVSRIIN+NVE+ECN+FLR KI D+QS+YQS  IPIP + PVDES++FIGRL +EIL++TDPK   Y+  +N+WYD+KT  E+ + +LFS++++   +FGL  +DRL   ++VK LQNFL   Q    K++   + +   +  VNP+ KS+V    K+Y     +  KI    ++ I+K+GQ+Q+LR+ IAN+LN S +F+++ L +AL   N +LL D+E H  +P + PYP        KE               D  ++   +  L +AG+H+P++++YITT +  +  +   L L + L KL Y++    ++ ++  D +D   L +GL+TLL+Q H    ++++ L+ Q+ RS      S+  +   P + +  +L L+D+   ++ P  V  A +P ++ D+ RT
Sbjct:    9 GCKASGQEEELENLQAWFREISKQILSLNYDDSTAAGRKTVQLIQALEEVQEFHQLESNLQVCQFLADTRKFLHQMIRTINIKEEVLITVQIIGDLSFAWQLIDSFTSIMQESIRVNPSMVTKLRATFLKLASALDLPLLRINQANSPDLLSVSQYYSGELVSYVRKVLQIIPESMFTSLLKIIKLQTHDIMEVPTRLDKDKLRDYAQLGPRYEVAKLTHAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRKELVKRVAFALHRGLIFNPRAKPSELMPKLKELGATMDGFHRSFEYIQDYVSIYGLKIWQEEVSRIINYNVEQECNNFLRTKIQDWQSMYQSTHIPIPKFAPVDESITFIGRLCREILRITDPKMTCYIDQLNTWYDVKTHQEVTSSRLFSEIQTTLGTFGLNGLDRLLCFMIVKELQNFLSMFQKIILKERTVQETLKMLMSAVNPL-KSIVANSSKVYLSAITKTQKIWSAYLEAIMKVGQMQILRQQIANELNSSCRFDSRHLAAALDNLNKALLADIEAHYRDP-SLPYP--------KE---------------DNTLLYEITAYLEAAGIHNPLNKIYITTKRLPYFPIVNFLFLIAQLPKLQYNKNL-GMVCRKPADPVDWPPLVLGLLTLLKQFHSRYTEQFLALIGQFIRSTMEQCTSQK-MPEMPADAVGALLFLEDYVRYTKLPRRVAEAHVPNFIFDEFRT 707          
BLAST of WASH complex subunit 5 vs. UniProt/SwissProt
Match: sp|Q7ZVM1|WASC5_DANRE (WASH complex subunit 5 OS=Danio rerio OX=7955 GN=washc5 PE=2 SV=1)

HSP 1 Score: 1154.43 bits (2985), Expect = 0.000e+0
Identity = 588/1185 (49.62%), Postives = 822/1185 (69.37%), Query Frame = 2
Query:  110 MTEFYLDTNW-GPILLPLVARGSAIICEICRLSDYIPSEYK--PNAIKNEYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVF--KSRTSELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQAN-FKDKKNLDIMDSFLRNVNPISKSV--VFKIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDDIRT 3640
            M +F  + N  G  +L +V+RG+AII E+ RLSD+IP+ ++      + +Y +IICDFSYF   E +E K++A+PELQDLDE+FR+N++E+L RFY  FES+ ++V DL   L  L +G ++Q  L +V+ +EDGKQL+CEALYLYG+MLL+IDQK+EG  RE++LVSY+RYS  +S+ DSN D++ +LLRSTGYS S P  KRP +YPESYF R+ I++ +ISMV+ +LRSDD Y+Q  AYPLPEHRS A ATQA M+YVCLYF P+ LH+Q A MREIVDK+F DNWV+  Y+G  VNLV+ W PYKAA +AL   ++  N++     Y   ++ L P + ++LKEG L +E +LD I KL++ +R+CNV IRWLMLH+ E S    +NK+  Q+++ V+  + +N + +FQLL  T+QFE  L +MF+ +L  K+  W   K EG +RM ELAEVFSG K L RV KN+ LQ WF ++SKQIE+L+++++T AGR   QLIQAL EV EFHQL+SNL V QF+ DT   L QM+R +N++E VL+ + I  D+SYA  IID +T  MQ  I  +P +V KLRA  LKLA++ D+PL+R+NQ +S DLLSV+Q+YS ELV YVRKVLQIIPE MF  LAKII LQ ++I E+PTRLDKDK+K+Y     R E+A+LTH ISVFT+GILMMKTTLVGII++DP +LLEDGIRKEL+K V+ A  K L+F  K++ SEL  KL +++ TMDGF RSFEYIQDYV+IYGLK+W+EEVSRIIN+NVE+ECNSFLR KI D+QS++QS  IPIP YP VDES +FIGRL +EIL++TDPK   Y+  +N+WYD++T  E+ N +LFS+++    +FGL  +DRL   ++VK LQNFL  +Q +  KDK  +D+  + L  VNP+   V    K+Y +   +  KI    ++ I+K+GQ+Q+LR+ IAN+LN S KF++K L +AL   N SLL+D+E H  +P + PYP                         D  ++   +  L +AG+H+P++++YITT +  +  +   L L + L KL Y+++   +  ++  DALD   L +GL+TLL+Q H    ++++ L+ Q+ RS      S+  +   P +++  ++ L+D+   ++ P  V  A +P ++ D+ RT
Sbjct:    1 MVDFLAENNLCGQAILRIVSRGNAIIAELLRLSDFIPAVFRLRDKTDQQKYGDIICDFSYFKGPEYYEGKLEAKPELQDLDEEFRENNIEILTRFYLAFESVHKYVVDLIRCLDDLNEGVYIQQTLETVLLNEDGKQLLCEALYLYGVMLLVIDQKMEGEVRERMLVSYYRYSAARSSADSNLDDICKLLRSTGYS-SHPGAKRPTNYPESYFQRVPISSTFISMVIGRLRSDDIYNQVSAYPLPEHRSTALATQAAMLYVCLYFTPSILHTQQAKMREIVDKYFPDNWVISIYMGITVNLVEAWEPYKAAKIALNYTLDTANIREQAGRYAASVETLRPQVQQLLKEGFLREEIILDNIPKLLNCLRDCNVAIRWLMLHTAE-SAYDPNNKRLRQIKDQVINDSKYNPKILFQLLLDTAQFEFILKEMFKQMLAEKQLKWESYKKEGSERMMELAEVFSGVKPLTRVEKNENLQAWFREISKQIESLNYEDSTAAGRKTVQLIQALVEVQEFHQLESNLQVCQFLADTRKFLHQMIRTINIKEEVLITMQIVGDLSYAWQIIDSFTAIMQESIRANPSMVTKLRATLLKLASALDLPLLRINQVNSPDLLSVSQFYSGELVAYVRKVLQIIPESMFTSLAKIIKLQIHDIMEVPTRLDKDKLKDYSQLSARYEVAKLTHAISVFTEGILMMKTTLVGIIQVDPKQLLEDGIRKELVKRVAYALHKGLIFNPKAKPSELMPKLKEMAATMDGFYRSFEYIQDYVSIYGLKIWQEEVSRIINYNVEQECNSFLRTKIQDWQSVHQSTHIPIPKYPSVDESATFIGRLCREILRITDPKVTCYIDQLNTWYDLRTHQEVTNNRLFSEIQDTLGTFGLNGLDRLLCFMIVKELQNFLTVLQKSILKDKAVVDVFKALLTAVNPVKGIVANASKVYTNAAAKTQKIWSPYLESIMKVGQMQILRQQIANELNYSCKFDSKHLAAALDNLNKSLLSDIEAHYQDP-SLPYPK-----------------------EDNTLLYEITAYLEAAGIHNPLNKIYITTKRLPYFPIVNFLFLIAQLPKLQYNKS-QGMACRKPADALDWAPLVLGLLTLLKQFHSRYTEQFLALIGQFIRSIMEQCTSQK-IPDMPSDVVGALMFLEDYVRYTKLPRKVAEAHVPSFIFDEFRT 1157          
BLAST of WASH complex subunit 5 vs. UniProt/SwissProt
Match: sp|Q6DIP9|WASC5_XENTR (WASH complex subunit 5 OS=Xenopus tropicalis OX=8364 GN=washc5 PE=2 SV=1)

HSP 1 Score: 1137.09 bits (2940), Expect = 0.000e+0
Identity = 578/1186 (48.74%), Postives = 820/1186 (69.14%), Query Frame = 2
Query:  110 MTEFYLDTNW-GPILLPLVARGSAIICEICRLSDYIPSEY--KPNAIKNEYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVFKSRT--SELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQ-HMQANFKDKKNLDIMDSFLRNVNPISKSVV--FKIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPN-TCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDDIRT 3640
            M +F  + N  G  +L +V+RG+AII E+ RLS+++PS +  K  A + +Y +II DFSYF   E  E +++A+PELQDLDE+FR+N++E+L RFY  FES+ +++ DLN +L  L +G ++Q  L +V+ +EDGKQL+CEALYLYG+MLL+IDQKIEG  RE++LV+Y+RYS  +S++DSN D++ +LLRSTGYS S P  KRP +YPESYF+R+ I+  +ISMV+ +LRSDD Y+Q  AYPLPEHRS A ATQA ++YV LYF P  LH+  A MREIVDK+F DNWV+  Y+G  VNL++ W PYKAA  AL   ++L N+K   + Y ++I+ L P + + LKEG L +EFVLD I KL++ +R+CNV IRWLMLH+ + S    +NK+  Q+++ V+  + +N + +FQLL  T+QFE  L +MF+ +L  K+  W   K EG +RM ELA+VFSG K L RV KN+ LQ WF +++KQI +L++ ++T AGR   QLIQAL EV EFHQL++NL V QF+ DT   L QM+R +N++E VL+ + I  D+SYA  +ID +T  MQ  I  +P +V KLRA FLKLA++ D+PL+R+NQ +S DLLSV+QYYS ELV YVRKVLQIIPE MF  LAKII LQT++I E+PTRLDKDK+++Y     R E+A+LT+ IS+FT+GILMMKTTLVGII++DP +LLEDGIRKEL+K V+ A  K L+F SR   SEL  KL D++ TMDGF RSFEYIQDYV+IYGLK+W+EEVSRI+N+NVE+ECN+FLR KI D+QS+YQS  IPIP +PPVDES++FIGRL +EIL++TDPK   Y+  +N+WYD+KT  E+ N  LFS++  +  +FGL  +DRL   ++VK LQNF++ + +   +DK   + + +  + V P+   V    KIY+    +  KI P  +D I+K+GQ+Q+LR+ IAN+LN S KF++K L  AL  FN ++L D++ H  +P+  CP     LL                            +  L +AG H+P++++YITT +  F  +   L L + L KL Y++    +  ++  D +D   L +GL+TLL+Q H    ++++ L+ Q+ RS +L   +   +   P +++  ++ L+D+ + ++ P  V+ A +P ++ D+ RT
Sbjct:    1 MVDFLAENNLCGQAILRIVSRGNAIIAELLRLSEFVPSVFRLKDKADQQKYGDIIFDFSYFKGPEVCEGRLEAKPELQDLDEEFRENNIEILTRFYLAFESVHKYIVDLNRYLEDLNEGIYIQQTLETVLLNEDGKQLLCEALYLYGVMLLVIDQKIEGEVRERMLVAYYRYSAARSSVDSNMDDICKLLRSTGYS-SQPGAKRPPNYPESYFSRVPISETFISMVIGRLRSDDIYNQVSAYPLPEHRSTALATQAAILYVILYFHPPTLHTHQAKMREIVDKYFPDNWVISIYMGITVNLMEVWEPYKAAKTALNYTLDLPNIKEQASRYAKIIESLHPQVQQFLKEGFLREEFVLDNIPKLLNCLRDCNVAIRWLMLHTAD-SAYDPNNKRLRQVKDQVLADSKYNPKILFQLLLDTAQFEFLLKEMFKQMLSEKQNKWESYKKEGSERMTELADVFSGVKPLTRVEKNEHLQAWFREIAKQIHSLNYDDSTAAGRKTVQLIQALEEVQEFHQLETNLQVCQFLADTRKFLHQMIRTINIKEEVLITMQIVGDLSYAWQLIDSFTAIMQESIRANPSMVTKLRATFLKLASALDLPLLRINQANSPDLLSVSQYYSGELVFYVRKVLQIIPESMFTSLAKIIKLQTHDIIEVPTRLDKDKLRDYAQLGARYEVAKLTNAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRKELVKRVAVALHKGLIFNSRAKPSELLPKLKDMAATMDGFHRSFEYIQDYVSIYGLKIWQEEVSRIVNYNVEQECNNFLRTKIQDWQSMYQSTHIPIPKFPPVDESMTFIGRLCREILRITDPKVTCYIDQMNTWYDMKTHQEVTNNHLFSEINDSLGTFGLNGLDRLLCFMIVKELQNFIRLYQRLILRDKSGQETLRALQKVVTPVKGIVANSAKIYSAAIAKTQKIWPAYLDAIMKVGQMQVLRQQIANELNYSCKFDSKHLAGALENFNEAILADIQAHYQDPSLPCPREDNTLL-------------------------YEITAYLEAAGTHNPLNKIYITTKQLSFFPIVNFLFLVAQLPKLQYNKNL-GMTCRKPADPIDWVPLVLGLLTLLKQFHSRYTEQFLALIGQFIRS-SLEQSTSQKIPEMPADVVGALMFLEDYVHFAKLPRRVVEAHVPNFIFDEFRT 1157          
BLAST of WASH complex subunit 5 vs. UniProt/SwissProt
Match: sp|Q12768|WASC5_HUMAN (WASH complex subunit 5 OS=Homo sapiens OX=9606 GN=WASHC5 PE=1 SV=1)

HSP 1 Score: 1119.38 bits (2894), Expect = 0.000e+0
Identity = 577/1186 (48.65%), Postives = 815/1186 (68.72%), Query Frame = 2
Query:  110 MTEFYLDTNW-GPILLPLVARGSAIICEICRLSDYIPSEY--KPNAIKNEYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVFKSRT--SELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQA-NFKDKKNLDIMDSFLRNVNPISKSVVF---KIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDDIRT 3640
            M +F  + N  G  +L +V+ G+AII E+ RLS++IP+ +  K  A + +Y +II DFSYF   E +E K+DA+PELQDLDE+FR+N++E++ RFY  F+S+ +++ DLN +L  L +G ++Q  L +V+ +EDGKQL+CEALYLYG+MLL+IDQKIEG  RE++LVSY+RYS  +S+ DSN D++ +LLRSTGYS S P  KRP +YPESYF R+ IN  +ISMV+ +LRSDD Y+Q  AYPLPEHRS A A QA M+YV LYF P+ LH+  A MREIVDK+F DNWV+  Y+G  VNLVD W PYKAA  AL N ++L+NV+   + Y  + +++   + + LKEG L +E VLD I KL++ +R+CNV IRWLMLH+ + S    +NK+  Q+++ ++T + +N   +FQLL  T+QFE  L +MF+ +L  K+  W   K EG +RM ELA+VFSG K L RV KN+ LQ WF ++SKQI +L++ ++T AGR   QLIQAL EV EFHQL+SNL V QF+ DT   L QM+R +N++E VL+ + I  D+S+A  +ID +T  MQ  I  +P +V KLRA FLKLA++ D+PL+R+NQ +S DLLSV+QYYS ELV YVRKVLQIIPE MF  L KII LQT++I E+PTRLDKDK+++Y     R E+A+LTH IS+FT+GILMMKTTLVGII++DP +LLEDGIRKEL+K V+ A  + L+F  R   SEL  KL +L  TMDGF RSFEYIQDYVNIYGLK+W+EEVSRIIN+NVE+ECN+FLR KI D+QS+YQS  IPIP + PVDES++FIGRL +EIL++TDPK   ++  +N+WYD+KT  E+ + +LFS++++   +FGL  +DRL   ++VK LQNFL   Q    +D+   D + + +  V+P+ KS+V    KIY     +  KI    ++ I+K+GQ+Q+LR+ IAN+LN S +F++K L +AL   N +LL D+E H  +P + PYP                         D  ++   +  L +AG+H+P++++YITT +  +  +   L L + L KL Y++    ++ ++  D +D   L +GL+TLL+Q H    ++++ L+ Q+  S      S+  +   P +++  +L L+D+   ++ P  V  A +P ++ D+ RT
Sbjct:    1 MLDFLAENNLCGQAILRIVSCGNAIIAELLRLSEFIPAVFRLKDRADQQKYGDIIFDFSYFKGPELWESKLDAKPELQDLDEEFRENNIEIVTRFYLAFQSVHKYIVDLNRYLDDLNEGVYIQQTLETVLLNEDGKQLLCEALYLYGVMLLVIDQKIEGEVRERMLVSYYRYSAARSSADSNMDDICKLLRSTGYS-SQPGAKRPSNYPESYFQRVPINESFISMVIGRLRSDDIYNQVSAYPLPEHRSTALANQAAMLYVILYFEPSILHTHQAKMREIVDKYFPDNWVISIYMGITVNLVDAWEPYKAAKTALNNTLDLSNVREQASRYATVSERVHAQVQQFLKEGYLREEMVLDNIPKLLNCLRDCNVAIRWLMLHTAD-SACDPNNKRLRQIKDQILTDSRYNPRILFQLLLDTAQFEFILKEMFKQMLSEKQTKWEHYKKEGSERMTELADVFSGVKPLTRVEKNENLQAWFREISKQILSLNYDDSTAAGRKTVQLIQALEEVQEFHQLESNLQVCQFLADTRKFLHQMIRTINIKEEVLITMQIVGDLSFAWQLIDSFTSIMQESIRVNPSMVTKLRATFLKLASALDLPLLRINQANSPDLLSVSQYYSGELVSYVRKVLQIIPESMFTSLLKIIKLQTHDIIEVPTRLDKDKLRDYAQLGPRYEVAKLTHAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRKELVKRVAFALHRGLIFNPRAKPSELMPKLKELGATMDGFHRSFEYIQDYVNIYGLKIWQEEVSRIINYNVEQECNNFLRTKIQDWQSMYQSTHIPIPKFTPVDESVTFIGRLCREILRITDPKMTCHIDQLNTWYDMKTHQEVTSSRLFSEIQTTLGTFGLNGLDRLLCFMIVKELQNFLSMFQKIILRDRTVQDTLKTLMNAVSPL-KSIVANSNKIYFSAIAKTQKIWTAYLEAIMKVGQMQILRQQIANELNYSCRFDSKHLAAALENLNKALLADIEAHYQDP-SLPYPK-----------------------EDNTLLYEITAYLEAAGIHNPLNKIYITTKRLPYFPIVNFLFLIAQLPKLQYNKNL-GMVCRKPTDPVDWPPLVLGLLTLLKQFHSRYTEQFLALIGQFICSTVEQCTSQK-IPEIPADVVGALLFLEDYVRYTKLPRRVAEAHVPNFIFDEFRT 1157          
BLAST of WASH complex subunit 5 vs. UniProt/SwissProt
Match: sp|Q5R5P0|WASC5_PONAB (WASH complex subunit 5 OS=Pongo abelii OX=9601 GN=WASHC5 PE=2 SV=1)

HSP 1 Score: 1118.61 bits (2892), Expect = 0.000e+0
Identity = 576/1186 (48.57%), Postives = 815/1186 (68.72%), Query Frame = 2
Query:  110 MTEFYLDTNW-GPILLPLVARGSAIICEICRLSDYIPSEY--KPNAIKNEYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVFKSRT--SELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQA-NFKDKKNLDIMDSFLRNVNPISKSVVF---KIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDDIRT 3640
            M +F  + N  G  +L +V+ G+AII E+ RLS++IP+ +  K  A + +Y +II DFSYF   E +E K+DA+PELQDLDE+FR+N++E++ RFY  F+S+ +++ DLN +L  L +G ++Q  L +V+ +EDGKQL+CEALYLYG+MLL+IDQKIEG  RE++LVSY+RYS  +S+ DSN D++ +LLRSTGYS S P  +RP +YPESYF R+ IN  +ISMV+ +LRSDD Y+Q  AYPLPEHRS A A QA M+YV LYF P+ LH+  A MREIVDK+F DNWV+  Y+G  VNLVD W PYKAA  AL N ++L+NV+   + Y  + +++   + + LKEG L +E VLD I KL++ +R+CNV IRWLMLH+ + S    +NK+  Q+++ ++T + +N   +FQLL  T+QFE  L +MF+ +L  K+  W   K EG +RM ELA+VFSG K L RV KN+ LQ WF ++SKQI +L++ ++T AGR   QLIQAL EV EFHQL+SNL V QF+ DT   L QM+R +N++E VL+ + I  D+S+A  +ID +T  MQ  I  +P +V KLRA FLKLA++ D+PL+R+NQ +S DLLSV+QYYS ELV YVRKVLQIIPE MF  L KII LQT++I E+PTRLDKDK+++Y     R E+A+LTH IS+FT+GILMMKTTLVGII++DP +LLEDGIRKEL+K V+ A  + L+F  R   SEL  KL +L  TMDGF RSFEYIQDYVNIYGLK+W+EEVSRIIN+NVE+ECN+FLR KI D+QS+YQS  IPIP + PVDES++FIGRL +EIL++TDPK   ++  +N+WYD+KT  E+ + +LFS++++   +FGL  +DRL   ++VK LQNFL   Q    +D+   D + + +  V+P+ KS+V    KIY     +  KI    ++ I+K+GQ+Q+LR+ IAN+LN S +F++K L +AL   N +LL D+E H  +P + PYP                         D  ++   +  L +AG+H+P++++YITT +  +  +   L L + L KL Y++    ++ ++  D +D   L +GL+TLL+Q H    ++++ L+ Q+  S      S+  +   P +++  +L L+D+   ++ P  V  A +P ++ D+ RT
Sbjct:    1 MLDFLAENNLCGQAILRIVSCGNAIIAELLRLSEFIPAVFRLKDRADQQKYGDIIFDFSYFKGPELWESKLDAKPELQDLDEEFRENNIEIVTRFYLAFQSVHKYIVDLNRYLDDLNEGVYIQQTLETVLLNEDGKQLLCEALYLYGVMLLVIDQKIEGEVRERMLVSYYRYSAARSSADSNMDDICKLLRSTGYS-SQPGARRPPNYPESYFQRVPINESFISMVIGRLRSDDIYNQVSAYPLPEHRSTALANQAAMLYVILYFEPSILHTHQAKMREIVDKYFPDNWVISIYMGITVNLVDAWEPYKAAKTALNNTLDLSNVREQASRYATVSERVHAQVQQFLKEGYLREEMVLDNIPKLLNCLRDCNVAIRWLMLHTAD-SACDPNNKRLRQIKDQILTDSRYNPRILFQLLLDTAQFEFILKEMFKQMLSEKQTKWEHYKKEGSERMTELADVFSGVKPLTRVEKNENLQAWFREISKQILSLNYDDSTAAGRKTVQLIQALEEVQEFHQLESNLQVCQFLADTRKFLHQMIRTINIKEEVLITMQIVGDLSFAWQLIDSFTSIMQESIRVNPSMVTKLRATFLKLASALDLPLLRINQANSPDLLSVSQYYSGELVSYVRKVLQIIPESMFTSLLKIIKLQTHDIIEVPTRLDKDKLRDYAQLGPRYEVAKLTHAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRKELVKRVAFALHRGLIFNPRAKPSELMPKLKELGATMDGFHRSFEYIQDYVNIYGLKIWQEEVSRIINYNVEQECNNFLRTKIQDWQSMYQSTHIPIPKFTPVDESVTFIGRLCREILRITDPKMTCHIDQLNTWYDMKTHQEVTSSRLFSEIQTTLGTFGLNGLDRLLCFMIVKELQNFLSMFQKIILRDRTVQDTLKTLMNAVSPL-KSIVANSNKIYFSAIAKTQKIWTAYLEAIMKVGQMQILRQQIANELNYSCRFDSKHLAAALENLNKALLADIEAHYQDP-SLPYPK-----------------------EDNTLLYEITAYLEAAGIHNPLNKIYITTKRLPYFPIVNFLFLIAQLPKLQYNKNL-GMVCRKPTDPVDWPPLVLGLLTLLKQFHSRYTEQFLALIGQFICSTVEQCTSQK-IPEIPADVVGALLFLEDYARYTKLPRRVAEAHVPNFIFDEFRT 1157          
BLAST of WASH complex subunit 5 vs. UniProt/SwissProt
Match: sp|Q8C2E7|WASC5_MOUSE (WASH complex subunit 5 OS=Mus musculus OX=10090 GN=Washc5 PE=1 SV=2)

HSP 1 Score: 1112.06 bits (2875), Expect = 0.000e+0
Identity = 572/1186 (48.23%), Postives = 809/1186 (68.21%), Query Frame = 2
Query:  110 MTEFYLDTNW-GPILLPLVARGSAIICEICRLSDYIPSEY--KPNAIKNEYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVFKSRT--SELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQA-NFKDKKNLDIMDSFLRNVNPISKSVVF---KIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDDIRT 3640
            M +F  + N  G  +L +V+ G+AII E+ RLS++IP+ +  K  A +  Y +II DFSYF   E +E K++A+PELQDLDE+FR+N++E++ RFY  F+S+ +++ DLN +L  L +G ++Q  L +V+  EDGKQL+CEALYLYG+MLL+IDQKIEG  RE++LVSY+RYS  +S+ DSN D++ +LLRSTGYS S P  KRP +YPESYF R+ IN  +ISMV+ +LRSDD Y+Q  AYPLPEHRS A A QA M+YV LYF P+ LH+  A MREIVDK+F DNWV+  Y+G  VNL D W PYKAA  AL N ++L NVK   + Y  +  ++   + + LKEG L +E +LD I +L++ +R+CNV IRWLMLH+ + S    +NK+  Q+++ ++  + +N + +FQLL  T+QFE  L +MF+ +L  K+  W   K EG +RM ELA+VFSG K L RV KN+ LQ WF ++SKQI +L++ ++T AGR   QLIQAL EV EFHQL+SNL V QF+ DT   L QM+R +N++E VL+ + I  D+S+A  +ID +T  MQ  I  +P +V KLRA FLKLA++ D+PL+R+NQ +S DLLSV+QYYS ELV YVRKVLQIIPE MF  L KII LQT++I E+PTRLDKDK+++Y     R E+A+LTH IS+FT+GILMMKTTLVGII++DP +LLEDGIRKEL+K V+ A  + L+F  R   SEL  KL +L  TMDGF RSFEYIQDYV+IYGLK+W+EEVSRIIN+NVE+ECN+FLR KI D+QS+YQS  IPIP + PVDES++FIGRL +EIL++TDPK   Y+  +N+WYD+KT  E+ + +LFS++++   +FGL  +DRL   ++VK LQNFL   Q    K++   + +   +  VNP+ KS+V    K+Y     +  KI    ++ I+K+GQ+Q+LR+ IAN+LN S +F+++ L +AL   N +LL D+E H  +P + PYP                         D  ++   +  L +AG+H+P++++YITT +  +  +   L L + L KL Y++    ++ ++  D +D   L +GL+TLL+Q H    ++++ L+ Q+ RS      S+  +   P + +  +L L+D+   ++ P  V  A +P ++ D+ RT
Sbjct:    1 MLDFLAENNLCGQAILRIVSCGNAIIAEVLRLSEFIPAVFLLKDRADQQRYGDIIFDFSYFKGPEFWESKLEAKPELQDLDEEFRENNIEIVTRFYLAFQSVHKYIVDLNRYLDDLNEGVYIQQTLETVLLSEDGKQLLCEALYLYGVMLLVIDQKIEGEVRERMLVSYYRYSAARSSADSNMDDICKLLRSTGYS-SQPGAKRPPNYPESYFQRVPINETFISMVIGRLRSDDIYNQVSAYPLPEHRSTALANQAAMLYVILYFEPSILHTHQAKMREIVDKYFPDNWVISIYMGITVNLADAWEPYKAAKTALNNTLDLANVKEQASRYASVSDRVRAQVQQFLKEGYLREEVLLDNIPRLLNCLRDCNVAIRWLMLHTAD-SACDPNNKRLRQIKDQILADSRYNPKILFQLLLDTAQFEFILKEMFKQMLSEKQSKWEHYKKEGSERMTELADVFSGVKPLTRVEKNENLQAWFREISKQILSLNYDDSTAAGRKTVQLIQALEEVQEFHQLESNLQVCQFLADTRKFLHQMIRTINIKEEVLITVQIIGDLSFAWQLIDSFTSIMQESIRVNPSMVTKLRATFLKLASALDLPLLRINQANSPDLLSVSQYYSGELVSYVRKVLQIIPESMFTSLLKIIKLQTHDIMEVPTRLDKDKLRDYAQLGPRYEVAKLTHAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRKELVKRVAFALHRGLIFNPRAKPSELMPKLKELGATMDGFHRSFEYIQDYVSIYGLKIWQEEVSRIINYNVEQECNNFLRTKIQDWQSMYQSTHIPIPKFAPVDESITFIGRLCREILRITDPKMTCYIDQLNTWYDVKTHQEVTSSRLFSEIQTTLGTFGLNGLDRLLCFMIVKELQNFLSMFQKIILKERTVQETLKMLMSAVNPL-KSIVANSSKVYLSAITKTQKIWSAYLEAIMKVGQMQILRQQIANELNSSCRFDSRHLAAALDNLNKALLADIEAHYRDP-SLPYPK-----------------------EDNTLLYEITAYLEAAGIHNPLNKIYITTKRLPYFPIVNFLFLIAQLPKLQYNKNL-GMVCRKPADPVDWPPLVLGLLTLLKQFHSRYTEQFLALIGQFIRSTMEQCTSQK-MPEMPADAVGALLFLEDYVRYTKLPRRVAEAHVPNFIFDEFRT 1157          
BLAST of WASH complex subunit 5 vs. TrEMBL
Match: A0A1S3J3K4 (LOW QUALITY PROTEIN: WASH complex subunit 5-like OS=Lingula unguis OX=7574 GN=LOC106169884 PE=4 SV=1)

HSP 1 Score: 1201.42 bits (3107), Expect = 0.000e+0
Identity = 602/1174 (51.28%), Postives = 822/1174 (70.02%), Query Frame = 2
Query:  140 GPILLPLVARGSAIICEICRLSDYIPSEYKPNAIKNE--YSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVF--KSRTSELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQAN-FKDKKNLDIMDSFLRNVNPISKSVV---FKIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDDIR 3637
            G  +L LV+RG+AII E+ RLSD+IP  +K     ++  Y EI+CDFSYF  SE F+ KI+++ ELQDLDE+FR+NH E+L RF+  FES++++V+DLN FL  L++G ++Q  L SV+ +EDGKQLM E+LYLYG+ML++ID KIEG  RE++LVSYHRYS + +  DSN D+V +LLR TG+S + P  KRP +YPE++F+R+ IN  +++M + +LRSDD Y+Q  AYPLPEHRS A ATQA+M+YV LYFAP  LH+Q A MREIVDKHF DNWV+  Y+G +VNLVD W PYKAAS AL+N  E  NV+   N +   +K +   + + LKEGVL +EFVLD I KLM+ IRECNVTIRW+MLH+  L+ S  +NK+C QLRE V+  + +N  ++F+LL  TSQ E KL +MF+ +L  K+  W   K EG +R+ EL+EVFSGTK L RV KN+ LQ WF ++SKQI +L++ +   AGR + QLIQAL EV EFHQL+SNL VKQF+ DT   L QM+R +N++E VL+ + I  D++YA  IID YT +MQ GI K+P LV KLRA FLKLA++ D+PL+R+NQ SS DL+SV+QYYS ELV YVRKVLQIIPE MF  L +II LQT +IKELPTRL+K+K++ +   ++R E+ARLTH ISVFT+GILMMKTTLVGII++DP +LLEDGIRKEL+  V+ A  + L+F  K++TSEL  KL+ L   MDGFRRSFEYIQDYVNI GLK+W+EE+SRI+N+NVE+ECNSFLR K+ D+QS+YQS  IPIP Y PVD+S++FIGRL +EIL++TDP+T  ++  + +WYD KTK E+ N+KLF KLE    +FGL  +DRL   ++V+ LQ+ L  +Q    KDK  L++  + +  +NP+ +SVV    K Y     +  ++    +D ILK+GQ+QLLR  I  QLN S +F++KFL SAL TFN +LL+++E H  +P + PYPS       ++ P                ++   +  L SAG+++P+S++Y+TT +  +      L + S L KL+Y ++  +++ K+  D +DG     G++TLL+Q H       + ++ QY RS   S  S   V   P E +N +  L+DF + S      L AF+PEY++D+ R
Sbjct:   15 GQTILRLVSRGNAIIAELLRLSDFIPPVFKQETKADQLKYGEILCDFSYFQSSEYFDDKINSKVELQDLDEEFRENHEEILTRFFLAFESVYKYVTDLNRFLEDLDEGVYIQQTLESVLLNEDGKQLMSESLYLYGVMLMIIDYKIEGVVRERMLVSYHRYSARNAT-DSNIDDVCKLLRGTGFSAA-PGAKRPPNYPEAFFSRVPINKTFVNMTIGRLRSDDIYNQISAYPLPEHRSTALATQASMLYVILYFAPEILHNQTAKMREIVDKHFPDNWVISIYMGDVVNLVDAWAPYKAASSALSNSCEAGNVRXQANRFSTKVKTVNTAVLQYLKEGVLEEEFVLDNIPKLMNVIRECNVTIRWMMLHTTALNTSADANKRCRQLREQVIADSKYNPVALFELLLNTSQLEFKLKEMFKQMLAGKQAKWELYKKEGSERVLELSEVFSGTKPLTRVQKNENLQAWFAEMSKQIGSLNYDDAVSAGRKIVQLIQALEEVQEFHQLESNLQVKQFLADTRKFLHQMIRTINIKEEVLITMQIVGDLAYAWVIIDSYTSFMQEGIKKNPSLVTKLRATFLKLASALDLPLLRINQASSPDLMSVSQYYSGELVSYVRKVLQIIPETMFTLLHRIIRLQTGQIKELPTRLEKEKMREFAQLDERYEVARLTHSISVFTEGILMMKTTLVGIIKIDPKQLLEDGIRKELVAQVASALHQGLIFNPKAKTSELIPKLELLGQVMDGFRRSFEYIQDYVNICGLKIWQEEMSRIVNYNVEQECNSFLRTKVADWQSVYQSTAIPIPRYQPVDQSVNFIGRLGREILRITDPRTTSFIHQMRAWYDCKTKQELINIKLFQKLEKGVGNFGLSGLDRLLCFMIVRELQSLLLMVQRTVLKDKAWLELFRTLVTTINPV-RSVVANPHKAYVPLMTKATRLWQPYLDIILKVGQMQLLRTQITYQLNTSCQFDSKFLASALQTFNVALLSEIEKHYQDP-SLPYPS-------EDNP----------------LMYELTSYLESAGMNNPLSKIYVTTKRLPYFEAINFLFVISQLPKLTYVKSVGSMVCKKPGDPIDGPPFIAGMITLLKQFHRETTDSVLAMLGQYTRSYVESATSAK-VPEIPLEALNTLAFLEDFVHYSGIQRKTLDAFVPEYILDEFR 1160          
BLAST of WASH complex subunit 5 vs. TrEMBL
Match: V4B438 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_180993 PE=4 SV=1)

HSP 1 Score: 1199.11 bits (3101), Expect = 0.000e+0
Identity = 605/1191 (50.80%), Postives = 841/1191 (70.61%), Query Frame = 2
Query:  110 MTEFYLDTNW-GPILLPLVARGSAIICEICRLSDYIPSEYKPNAIKN--EYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSN-LDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVF--KSRTSELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQAN-FKDKKNLDIMDSFLRNVNPISKSV--VFKIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPEL----INCILILQDFCYISRRPINVLYAFIPEYLIDDIRTQ 3643
            M +F  + N  G  +L LV+RG+AII E+ RL+D+IP  ++ +   +   YSEII DFSYF  SE F+H+I++R ELQDLDE+F +NH+E+L RFY+ F S+ ++VSDLN +L  L++G ++Q  L SV  ++DGKQLMCEALYLYG+MLLLID K EG  RE++LVSY+RYS ++S   DS+ D+V +LLRSTG+S +LP  KRP +YPES+FNR+ IN +YI++V+ +LRSDD Y+Q  AYPLPEHRS A ATQA+M+Y+ LYF P+ L++Q A MREIVDKHF DNWV+  Y+G IVNL+D W PYKAA  AL N ++  NV+     Y + ++KL P +DK LKEGVL++EFVLD I KLM+ +R+ NVT+RWLMLH+  L  + + NKKC  +R+ V+  + +N   +FQ L  T+Q+E KL ++FR +L+ K+  W   K+EG +RM+EL +VFSGTK L RV K++ LQ WF +++KQI +L ++++T AGR + QLIQA+ EV EFHQL+SNL VKQF+ DT   L QM+R +N++E VL+   I +D+SYA  IID YTGYMQ GI KDP LVIKLRA FLK+A++ D+PL+R+NQ  SKDL+SV+QYYS ELV YVRKVLQIIP+ MF  LA II L TN I+E+PTRL+KDK+K++   ++R ++A+LTH ISVFT+GILMMKTTLVGII++DP +LLEDGIRKEL++ V+ A  K ++F  K++ SEL  KL  L   MDGFRRSFEYIQDYVNIYGLK+W+EE+SRII +NVE+ECNSFLR K+ D+QS+YQS  IPIP +PPVDES++FIGRL +EIL++TD +T IY+  + +WYD+KTK E+AN  LF ++  A  SFGL  +DRL   ++VK LQNF  ++Q    +DK  L+    + + + P+  +V    K+Y+   ++  K+ P  +D IL++GQ+QLLR+ IA +LN S KF++KFL S+L T N +LL D+E H  +P T PYP        +E P                ++   +  L S+G H+P+ ++YITT +  F  ++   L+ S L KL Y+++  +++SK+  + LD     IG++TLL+Q H      ++  + QY RS   ++ S        PEL    +N +L L+D+ + +R P   + +FIP Y+ D+ R+Q
Sbjct:    1 MADFLAENNQCGQNILRLVSRGNAIIAELLRLADFIPPIFRLDNRNDVTRYSEIIADFSYFKSSEFFDHRIESRVELQDLDEEFSENHIEILTRFYQAFASVHKYVSDLNRYLEDLDEGVYIQQTLESVFLNDDGKQLMCEALYLYGVMLLLIDIKFEGIVRERILVSYYRYSAQKSAATDSSIDDVCKLLRSTGFS-NLPGAKRPPNYPESFFNRVPINEEYINIVVGRLRSDDIYNQISAYPLPEHRSTALATQASMLYIILYFEPDILYTQQAKMREIVDKHFPDNWVISIYMGVIVNLMDAWLPYKAAITALNNTLDTNNVREQSVRYAKKLEKLQPVLDKYLKEGVLMEEFVLDNIPKLMNVMRDSNVTLRWLMLHTAALPPTAELNKKCKLIRDQVIVDSKYNALLVFQHLLNTAQYEYKLKELFRQMLDEKQNKWEAYKVEGQERMQELGDVFSGTKPLTRVEKSESLQNWFGEMTKQIASLDYEDSTSAGRKIIQLIQAMEEVQEFHQLESNLQVKQFLADTRKYLHQMLRTINIKEEVLIQTEIVADLSYAWEIIDSYTGYMQQGIKKDPSLVIKLRATFLKMASALDLPLLRVNQAGSKDLMSVSQYYSGELVAYVRKVLQIIPQTMFSLLASIIRLLTNRIQEVPTRLEKDKMKDFAQLDERYQVAKLTHSISVFTEGILMMKTTLVGIIKIDPKRLLEDGIRKELVQQVAYALHKGIMFNPKAKVSELLPKLATLGEQMDGFRRSFEYIQDYVNIYGLKIWQEEISRIIYYNVEQECNSFLRTKVLDWQSVYQSTAIPIPRFPPVDESVNFIGRLAREILRITDSRTTIYIDQMKAWYDVKTKQEVANRTLFQQIHRAVGSFGLSGLDRLLCFMIVKELQNFQLNLQRGVIRDKSWLEFFSLYTKLLQPLQGTVNQPQKVYSQAVSKTVKLWPVYLDIILRVGQMQLLRRQIAYELNTSCKFDSKFLASSLQTVNRALLADIEKHYQDP-TQPYP-------KEENP----------------LMYELTAYLESSGFHNPLDKIYITTMRVPFFPLFNYFLVLSQLPKLVYNKSVSSLVSKKPQEHLDAPSFTIGVLTLLKQFHADNTNFFLAFLGQYIRSCVEAMSSSKS-----PELSQDVLNVLLFLEDYIFYNRLPRKSVESFIPSYIFDEFRSQ 1161          
BLAST of WASH complex subunit 5 vs. TrEMBL
Match: A0A067QIX2 (Strumpellin OS=Zootermopsis nevadensis OX=136037 GN=L798_01325 PE=4 SV=1)

HSP 1 Score: 1191.41 bits (3081), Expect = 0.000e+0
Identity = 595/1189 (50.04%), Postives = 827/1189 (69.55%), Query Frame = 2
Query:  110 MTEFYLDTN-WGPILLPLVARGSAIICEICRLSDYIPSEYKPNAIKNE--YSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVF--KSRTSELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDE-SLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQAN-FKDKKNLDIMDSFLRNVNPISK--SVVFKIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARS---AALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDDIRT 3640
            M EF  + N  G  +L LV+RG+AII E+ RL DYIP  ++    +++  Y EII DFSYF +S+ F+ KID+ P+LQDLDE+FR+N+ E+L RFY +FES+ ++++DLN FL  LE+G F+Q  L SV+  E+GKQLMCEALYLYG+MLL++D  IEG  RE++LVSY+RYS ++S+ +SN D+V +LLRSTG++ +   +KR  +YPE YF RI +N  Y++MVL +LRSDD Y+Q  AYP PEHRS A ATQA M+Y+CL+FAP+ LH+Q A MREIVDK+F DNWV+  Y+G  VNLVD W PYKAA  AL+N ++ +NV  +   Y + ++K+IP+  ++LKEG LI+E VLD +SK+ + +RECNVT+RW+MLH+     + + NK+C Q+R+ V   A  N   +F+LL  T+QFELK+ DMF+ +L  K+  W + K EG++RM EL+EVFSGTK L RV KN+ LQ WF  + KQI++L  ++ T +GR + QLIQAL EV EFHQL+SNL V+QF+ DT   L QM+R +N++E VL+ L I  D+SYA  I+D YT  MQ GI KDP LVIKLRA FLKL+++ +IPL+R+NQ  S DL+SV+QYYS ELV YVRKVL IIPE MF  +A+I+ LQT+ IKELPTRLDKD+++ Y   E R E+ARLTH +SVFT+GILMMK+TLVGII +DP +LLEDGIRKEL+KH++ A    L F  K++TSEL  KL+ L   MDG+RRSFEYIQDYVNIYGLK+W+EEVSRII++NVE+ECNSFLRNK+ D+QS++QSKTIPIP +PP D  S++FIGRL +E++++TDPK  +Y+ H+ +WYD+KT  E+ N+K FSK+  +  + GL  +DRLF  ++V  LQN+L  +Q    +DK  L++     + ++P     S   + Y+ Y +R  ++ P  +D +LK+GQ+QLLRKHI  +LN+S KF++K L SAL   N++LL ++E H   P+  PYP        KE                  ++   S  L   G+ +P +++Y+TT   +F SV   L + S L KL+Y++   ++I++R  D +DG    +G+ TLL+Q HP I  +++  + QY +S   AA+S  S   V   P E++  +  L+ F + S      L A IPE ++D  +T
Sbjct:    1 MAEFLAENNPCGQSILRLVSRGNAIIAELLRLKDYIPPVFRLETKQDQQKYGEIISDFSYFKMSDEFDQKIDSNPQLQDLDEEFRENYTEILTRFYLVFESLHKYITDLNRFLDDLEEGLFIQQTLESVLLSEEGKQLMCEALYLYGVMLLVVDLHIEGVVRERMLVSYYRYSAQRSSTESNIDDVCKLLRSTGFT-NTSASKRAPNYPEVYFKRIPVNVLYVNMVLGRLRSDDIYNQISAYPFPEHRSTALATQAAMLYICLFFAPSVLHTQTAKMREIVDKYFPDNWVISIYMGITVNLVDSWEPYKAARTALSNTLDSSNVLDIAARYAKRMQKMIPHTQQLLKEGALIEENVLDHVSKVTNVVRECNVTLRWIMLHASSPGPAWEGNKRCKQIRDQVTADAKCNPLQVFELLLNTAQFELKIKDMFKHLLMEKQNKWEKYKKEGVERMMELSEVFSGTKPLTRVEKNENLQSWFAAMGKQIDSLKHEDATASGRKIGQLIQALQEVQEFHQLESNLQVRQFLADTRLYLHQMIRTINIKEDVLITLQIVGDLSYAWEIVDSYTSIMQEGIKKDPSLVIKLRATFLKLSSALEIPLLRINQAHSPDLVSVSQYYSGELVGYVRKVLHIIPETMFGLMARIVSLQTSVIKELPTRLDKDRLREYAQLEDRHEVARLTHSVSVFTEGILMMKSTLVGIIRVDPKQLLEDGIRKELVKHIATALHNGLTFNPKAKTSELLGKLEALGKIMDGYRRSFEYIQDYVNIYGLKIWQEEVSRIISYNVEQECNSFLRNKVQDWQSVHQSKTIPIPKFPPTDTTSVNFIGRLARELIRITDPKLTVYIEHMTAWYDLKTHNEVINLKFFSKITKSVGTAGLTGLDRLFSFMIVTELQNYLNALQKGVLQDKAWLEMFAVVSKGLSPCCNIISNPGRFYSQYTSRAQRVWPQILDRVLKVGQMQLLRKHITCELNISCKFDSKHLVSALQVMNDALLAEIEAHYKEPSK-PYP--------KE---------------SNPLLYELSTYLDWTGISNPYTKIYVTTKNLQFFSVLSFLFVVSQLPKLTYAKNVGSLITRRVQDPMDGVPFIVGMQTLLRQFHPEIRNQFLLYLGQYVKSHMEAAIS-SSSGKVSELPNEVVTTLHFLESFAHYSGISRKTLAAHIPEPILDQYQT 1163          
BLAST of WASH complex subunit 5 vs. TrEMBL
Match: A0A2B4S6Q6 (WASH complex subunit strumpellin OS=Stylophora pistillata OX=50429 GN=AWC38_SpisGene9784 PE=4 SV=1)

HSP 1 Score: 1190.25 bits (3078), Expect = 0.000e+0
Identity = 580/1186 (48.90%), Postives = 835/1186 (70.40%), Query Frame = 2
Query:  110 MTEFYLDTN-WGPILLPLVARGSAIICEICRLSDYIPSEYKPNAI--KNEYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVF--KSRTSELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQANFKDKKNLDIMDSFLRNVNPISKSVV--FKIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDDIRTQI 3646
            M +F  + N  G  +L LV+RG+AI+ E+ RLSD+IP  +K      +++Y EI+ DFSYF   + +E++ID++ ELQDLDE+FR+NH+E+L RFY+ FES+ ++++DLN +L  LE+G F+Q  L SV+ +EDGKQLMCE+LYLYGIMLL+ID K EG  RE++LVSYHRY   ++++DSN D+V +LLRSTG+S + P  KRP+ YPE YF RI++   ++ M++ +LRSDD Y+Q  AYPLPEHRS A ATQA+M+YV L+FAP+ L +Q A MREIVDKHF DNWV+  Y+G +VNLV+ W PYKAA  AL N ++L NVK L   Y   ++ L   +   LKEG L++E+ LD I KLM+ IR+CNVT+RWLMLH+CE+    + NK+C  LRE +VT + ++ +++F LL  T+QFELKL +MF+ +L  K+  W + K EG++RM EL+EVFSGTK L R+ KN+ LQ WF+++S QI +L+++++T AGR + QLIQAL EV EFHQL+SNL V+QF+ +T   L QM+R +N++E VL+ + + +D+SYA NIID Y+G+MQ GI  +P LV KLRA FLK+A++ D+PL+R+ Q +S DL+SV+QYYS ELV YVRKVLQIIPE MF  LA+II LQ + +KE+PTRL+KDK++ Y   ++R +IA+LTH ISVFT+GILMMKTTLVGII++DP +LLEDGIRKEL++ V+ A    L F  K++ SEL  +L +L   MDGFRRSFEYIQDY+NIYGLK+W+EEVSRIIN+NVE+ECNSFLR K+ D+QS+YQS TIPIP +PPVDES++FIGRL +EIL++TD KT  Y+  + +WYD +TK E+ N+ +  +L+ A  SFGL  +D+L   ++VK LQ F   ++   KDK  +D + +  + + P+   +   +++Y     +LA++     + I+K+GQ+QL+R+ I+N+LN S KF++K LH+AL TFNN+LL D+E H  +P T PYP+       +E P                ++   +  L  AG+H+P++++YITT K+ + ++   L + + + KL Y ++   ++++R  D +D     +G++T+L+Q H    ++++    QY +S   +  +       P E++N ++ L+DF   S  P  V+ A IP Y+ D  R  +
Sbjct:    1 MVDFLAENNACGQTVLKLVSRGNAIVAELLRLSDFIPPVFKQETKEDRDKYGEILADFSYFKGPDYYENRIDSKAELQDLDEEFRENHIEILTRFYKAFESVHKYITDLNRYLEDLEEGVFIQQTLESVLINEDGKQLMCESLYLYGIMLLVIDMKFEGDIRERMLVSYHRYCAARADVDSNLDDVCKLLRSTGFS-NTPGAKRPLKYPEDYFRRISVPQSFVDMLIGRLRSDDVYNQISAYPLPEHRSTALATQASMLYVMLFFAPDILQNQQAKMREIVDKHFPDNWVISIYMGIVVNLVEAWDPYKAAKTALNNTLDLNNVKPLATRYNTKVRTLNAEVLNYLKEGFLVEEYALDHIPKLMNCIRDCNVTLRWLMLHNCEVF---EMNKRCRALRE-MVTASGYDPKAVFDLLLNTAQFELKLKEMFKQMLAQKQSQWEKHKTEGVERMDELSEVFSGTKPLTRIKKNENLQAWFKEMSNQISSLNYEDSTSAGRKMVQLIQALEEVQEFHQLESNLQVRQFLLETRQFLHQMIRTINIKEEVLITIQLVADLSYAWNIIDSYSGFMQQGIKSNPSLVQKLRATFLKMASAMDLPLVRIGQANSPDLVSVSQYYSGELVAYVRKVLQIIPETMFGLLARIIQLQISSVKEVPTRLEKDKLREYAQLDERYQIAKLTHAISVFTEGILMMKTTLVGIIKIDPKQLLEDGIRKELVRQVASALHIVLTFNPKAKQSELGLRLRELGGRMDGFRRSFEYIQDYINIYGLKIWQEEVSRIINYNVEQECNSFLREKVHDWQSVYQSTTIPIPKFPPVDESVNFIGRLAREILRITDTKTTCYIDQMGAWYDNRTKQEVMNLLILKQLQQAVGSFGLTGLDKLLSFMIVKELQKFQALLRGALKDKLVVDTLVALSKQLTPVKSLIASPYRVYPPVTQKLARLWTQYSEAIMKVGQMQLIRRQISNELNCSCKFDSKVLHNALETFNNALLRDVEAHYQDP-TRPYPN-------EENP----------------LMFELTSYLEWAGIHNPLTKIYITTKKYPYFALLNFLCVIAQMPKLVYVKSVGTMVARRPTDQIDSAPFVVGVITVLKQFHSEYTEQFLSCCGQYVKSLIEATAANVRSQEIPAEVVNLLVFLEDFLAYSELPRKVVEAHIPSYIFDQFRVHL 1157          
BLAST of WASH complex subunit 5 vs. TrEMBL
Match: A0A2J7PBE2 (WASH complex subunit 5 OS=Cryptotermes secundus OX=105785 GN=washc5_4 PE=4 SV=1)

HSP 1 Score: 1186.02 bits (3067), Expect = 0.000e+0
Identity = 592/1184 (50.00%), Postives = 829/1184 (70.02%), Query Frame = 2
Query:  110 MTEFYLDTN-WGPILLPLVARGSAIICEICRLSDYIPSEYKPNAIKNE--YSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVF--KSRTSELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDE-SLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQAN-FKDKKNLDIMDSFLRNVNPISK--SVVFKIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARS-AALSLQSKNGVVT-YPPELINCILILQDFCYISRRPINVLYAFIPEYLID 3628
            M EF  D N  G  +L LV+RG+AII E+ RL DYIP  ++    +++  Y+EII DFSYF +S+ ++ KID+ P+LQDLDE+FR+N+ ++L RFY +FES+ +++ DL+HFL  LE+G F+Q  L SV+ +E+GKQL+CEALYLYG+MLL++D  IEG  RE++LVSY+RYS ++S  +SN D+V +LLRSTG++ +   +KR  +YPE YF RI +N  Y++MVL +LRSDD Y+Q  AYP PEHRS A ATQA M+YVCL+FAP+ LH+  A MREIVDK+F DNWV+  Y+G  VNL+D W PYKAA  AL+N ++ +NV+ + + Y   ++KLIP+  ++LKEG LI+E VLD +SK+ + +RECNVT+RWLMLH+     + + NK+C Q+R+ V+  A ++   +F+LL  T+QFELK+ DMF+ +L  K+  W + K EG++RM EL+EVFSG K L RV KN+ LQ WF  + KQI++L  ++ T +GR + QLIQAL EV EFHQL+S L V+QF+ DT   L QM+R +N++E VL+ L I  D+SYA  I+D YT  MQ GI K+P LVIKLRA FLKL+++ +IPL+R+NQ  S DL+SV+QYYS ELV YVRKVL IIPE MF  LA+I+ LQT+ IKELPTRLDKD+++ Y   E R E+A+LTH +S+FT+GILMMK+TLVGII +DP +LLEDGIRKEL+KH++ A D  L F  K++TSEL  KL+ L   MDG RRSFEYIQDYVNIYGLK+W+EEVSRII++NVE+ECNSFLRNK+ D+QS++QSKTIPIP +PP D  S++FIGRL +E++++TDPKT IY+ H+ +WYD+KT  E+ N+K FSK+ ++  + GL  +DRLF  ++V  LQN+L  +Q    KDK  L+++    + ++P S   S   + Y+ + +R  ++ P  +D +LK+GQ+QLLRKHIA +LN+S KF++K L SAL   N++LL ++E H   P+  PYP        KE                  ++   S  L  AG+ +P  ++Y+TT    + SV   L + S L KL+Y++T  ++IS+R  D +DG    +G+ TLL+Q HP I  +++  + QY +S    ++ S  G  T  P E++  +  L+ F + S      L   IPE ++D
Sbjct:    1 MAEFLADNNPCGQTILRLVSRGNAIIAELLRLKDYIPPVFRLETKQDQAKYAEIISDFSYFKMSDEYDQKIDSNPQLQDLDEEFRENYTDILTRFYLVFESLHKYIMDLSHFLDDLEEGLFIQQTLESVLLNEEGKQLLCEALYLYGVMLLVVDLHIEGVIRERMLVSYYRYSAQRSTAESNIDDVCKLLRSTGFT-NTSASKRASNYPEEYFKRIPVNPLYVNMVLGRLRSDDVYNQISAYPFPEHRSTALATQAAMLYVCLFFAPSILHTHTAKMREIVDKYFPDNWVISIYMGITVNLIDSWEPYKAARTALSNTLDSSNVRDISSRYASRMQKLIPHTQQLLKEGALIEENVLDHVSKVTNVVRECNVTLRWLMLHASMPGPAWEGNKRCKQIRDQVIADAKYSPLQVFELLLNTAQFELKIRDMFKCLLIEKQNKWEKYKKEGVERMMELSEVFSGIKPLTRVEKNENLQSWFGAMGKQIDSLKHEDATVSGRKIVQLIQALQEVQEFHQLESILQVRQFLADTRNYLHQMIRTINIKEDVLITLQIVGDLSYAWEIVDSYTNIMQEGIKKNPSLVIKLRATFLKLSSALEIPLLRINQAHSPDLVSVSQYYSGELVGYVRKVLHIIPETMFGLLARIVSLQTSVIKELPTRLDKDRLREYAQLEDRHEVAKLTHSVSIFTEGILMMKSTLVGIIRVDPKQLLEDGIRKELVKHIATALDNGLTFNPKAKTSELVGKLETLGKIMDGHRRSFEYIQDYVNIYGLKIWQEEVSRIISYNVEQECNSFLRNKVQDWQSVHQSKTIPIPKFPPTDSTSVNFIGRLARELIRITDPKTTIYIEHMTAWYDVKTHNEVINMKFFSKITNSVGTAGLTGLDRLFSFMIVTELQNYLNALQKGVLKDKAWLEMLAVVSKGLSPSSAIISNPGRFYSQHTSRAQRVWPQILDRVLKVGQMQLLRKHIAYELNISCKFDSKHLASALQVMNDALLAEIEAHYKEPSK-PYP--------KE---------------SNPLLYELSTYLDWAGISNPYMKIYVTTKNLEYFSVLSFLFVVSQLPKLTYAKTVGSLISRRVQDQIDGVPFIVGVQTLLRQFHPEIRNQFMLYLGQYVKSYMETAISSGTGKATELPNEVMTTLYFLESFAHYSGITRKTLAVHIPEPILD 1159          
BLAST of WASH complex subunit 5 vs. Ensembl Cavefish
Match: washc5 (WASH complex subunit 5 [Source:NCBI gene;Acc:103044498])

HSP 1 Score: 1151.35 bits (2977), Expect = 0.000e+0
Identity = 586/1185 (49.45%), Postives = 819/1185 (69.11%), Query Frame = 2
Query:  110 MTEFYLDTNW-GPILLPLVARGSAIICEICRLSDYIPSEY--KPNAIKNEYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVF--KSRTSELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQAN-FKDKKNLDIMDSFLRNVNPISKSVVF--KIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDDIRT 3640
            M +F  + N  G  +L +V+RG AII E+ RLS++IP+ +  K    + +Y +IICDFSYF   E +E K++A+P+LQDLDE+FR+N++E+L RFY  FES+ +++ DL  F+  L +G ++Q  L +V+ +EDGKQL+CEALYLYG+MLL+IDQKIEG  RE++LVSY+RYS  +S+ DSN D++ +LLRSTGYS S P  KRP +YPESYF R+ I+  +ISMV+ ++RSDD Y+Q  AYPLPEHRS A ATQA M+YVCLYF P+ LH+Q A MREIVDK+F DNWV+  Y+G  VNLV+ W PYKAA +AL   ++  N+K     Y   ++ L P + ++LKEG L +E VLD I KL++ +R+CNV IRWLMLH+ E S    +NK+  Q+++  +  + +N + +FQLL  T+QFE  L +MF+ +L  K+  W   K EG +RM ELAEVFSG K L RV KN+ LQ WF ++SKQIE+L+++++T AGR   QLIQAL EV EFHQL+SNL V QF+ DT   L QM+R +N++E VL+ + I  D+SYA  +ID +T  MQ  I   P +V KLRA FLKLA++ D+PL+R+NQ +S DLLSV+Q+YS ELV YVRKVLQIIPE MF  LAKII LQ ++I E+PTRLDKDK+K+Y     R E+A+LTH IS+FT+GILMMKTTLVGII++DP +LLEDGIRKEL+K V+ +  K L+F  K++ SEL  KL +++ TMDGF RSFEYIQDYV+IYGLK+W+EEVSRIIN+NVE+ECNSFLR KI D+QSIYQS  IPIP YPPVDES +FIGRL +EIL++TDP+   Y+  +N+WYD++T  E+ N +LF++++    +FGL  +DRL   ++VK LQNFL   Q +  KD+  +DI  + L  VNP+   V    K+YA+   +  KI P  ++ I+K+GQ+Q+LR  IAN+LN S KF++K L +AL   N SLL D+E H  +P + PYP                         D  ++   +  L +AG+H+P++++YITT +  +  +   L L + L KL Y++    +  +R+ D +D   L +GL+TLL+Q H    ++++ L+ Q+ RS      S+  +   P +++  ++ L+D+   ++    V+ A +P ++ D+ RT
Sbjct:    1 MVDFLAENNLCGQAILRIVSRGHAIIAELLRLSEFIPAVFRLKDKTDQQKYGDIICDFSYFKGPEYYESKLEAKPDLQDLDEEFRENNIEILSRFYLAFESVHKYIVDLIRFMDDLNEGVYIQQTLETVLLNEDGKQLLCEALYLYGVMLLVIDQKIEGEVRERMLVSYYRYSAARSSADSNLDDICKLLRSTGYS-SHPGAKRPPNYPESYFQRVPISPTFISMVIGRMRSDDIYNQVSAYPLPEHRSTALATQAAMLYVCLYFTPSILHTQQAKMREIVDKYFPDNWVISIYMGITVNLVEAWEPYKAAKIALNYTLDPANIKEQACRYAASVESLRPQVQQLLKEGFLREEIVLDNIPKLLNCLRDCNVAIRWLMLHTAE-SAYDPNNKRLRQIKDQAINDSKYNPKILFQLLLDTAQFEFILKEMFKQMLTEKQLKWESYKKEGSERMTELAEVFSGVKPLTRVEKNENLQAWFREISKQIESLNYEDSTAAGRKTVQLIQALVEVQEFHQLESNLQVCQFLADTRKFLHQMIRTINIKEEVLITMQIVGDLSYAWQLIDSFTSIMQESIRASPSMVTKLRATFLKLASALDLPLMRINQANSPDLLSVSQFYSGELVAYVRKVLQIIPESMFTSLAKIIKLQIHDIMEVPTRLDKDKLKDYAQLGARYEVAKLTHAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRKELVKRVAYSLHKGLIFNPKAKPSELMPKLKEMAATMDGFYRSFEYIQDYVSIYGLKIWQEEVSRIINYNVEQECNSFLRTKIQDWQSIYQSTHIPIPKYPPVDESATFIGRLCREILRITDPRVTCYIDQMNTWYDMRTHQEVTNNRLFTEIQDTLGTFGLNGLDRLLCFMIVKELQNFLTVFQKSILKDRSVVDIFKALLTAVNPVKGIVATASKVYANAVAKTQKIWPAYLESIMKVGQMQILRLQIANELNYSCKFDSKHLAAALENLNKSLLADIEAHYQDP-SLPYPK-----------------------EDNTLLYEITAYLEAAGIHNPLNKIYITTKRLPYFPIVNLLFLIAHLPKLQYTKN-QGMTCRRAADPVDWVPLVLGLLTLLKQFHSRYTEQFLALIGQFIRSIMEQCTSQK-IPDMPSDVVGALMFLEDYVRYTKLSRKVVEAHVPSFIFDEFRT 1157          
BLAST of WASH complex subunit 5 vs. Ensembl Cavefish
Match: washc5 (WASH complex subunit 5 [Source:NCBI gene;Acc:103044498])

HSP 1 Score: 1096.65 bits (2835), Expect = 0.000e+0
Identity = 569/1185 (48.02%), Postives = 795/1185 (67.09%), Query Frame = 2
Query:  110 MTEFYLDTNW-GPILLPLVARGSAIICEICRLSDYIPSEY--KPNAIKNEYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVF--KSRTSELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQAN-FKDKKNLDIMDSFLRNVNPISKSVVF--KIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDDIRT 3640
            M +F  + N  G  +L +V+RG AII E+ RLS++IP+ +  K    + +Y +IICDFSYF   E +E K++A+P+LQDLDE+FR+N++E+L RFY  FES+ +++ DL  F+  L +G ++Q  L +V+ +EDGKQL+CEALYLYG+MLL+IDQKIEG  RE++LVSY+RYS  +S+ DSN D++ +LLRSTGYS S P  KRP +YPESYF R+ I+  +ISMV+ ++RSDD Y+Q  AYPLPEHRS A ATQA M+YVCLYF P+ LH+Q A MREIVDK+F DNW                                         Y   ++ L P + ++LKEG L +E VLD I KL++ +R+CNV IRWLMLH+ E S    +NK+  Q+++  +  + +N + +FQLL  T+QFE  L +MF+ +L  K+  W   K EG +RM ELAEVFSG K L RV KN+ LQ WF ++SKQIE+L+++++T AGR   QLIQAL EV EFHQL+SNL V QF+ DT   L QM+R +N++E VL+ + I  D+SYA  +ID +T  MQ  I   P +V KLRA FLKLA++ D+PL+R+NQ +S DLLSV+Q+YS ELV YVRKVLQIIPE MF  LAKII LQ ++I E+PTRLDKDK+K+Y     R E+A+LTH IS+FT+GILMMKTTLVGII++DP +LLEDGIRKEL+K V+ +  K L+F  K++ SEL  KL +++ TMDGF RSFEYIQDYV+IYGLK+W+EEVSRIIN+NVE+ECNSFLR KI D+QSIYQS  IPIP YPPVDES +FIGRL +EIL++TDP+   Y+  +N+WYD++T  E+ N +LF++++    +FGL  +DRL   ++VK LQNFL   Q +  KD+  +DI  + L  VNP+   V    K+YA+   +  KI P  ++ I+K+GQ+Q+LR  IAN+LN S KF++K L +AL   N SLL D+E H  +P + PYP                         D  ++   +  L +AG+H+P++++YITT +  +  +   L L + L KL Y++    +  +R+ D +D   L +GL+TLL+Q H    ++++ L+ Q+ RS      S+  +   P +++  ++ L+D+   ++    V+ A +P ++ D+ RT
Sbjct:    1 MVDFLAENNLCGQAILRIVSRGHAIIAELLRLSEFIPAVFRLKDKTDQQKYGDIICDFSYFKGPEYYESKLEAKPDLQDLDEEFRENNIEILSRFYLAFESVHKYIVDLIRFMDDLNEGVYIQQTLETVLLNEDGKQLLCEALYLYGVMLLVIDQKIEGEVRERMLVSYYRYSAARSSADSNLDDICKLLRSTGYS-SHPGAKRPPNYPESYFQRVPISPTFISMVIGRMRSDDIYNQVSAYPLPEHRSTALATQAAMLYVCLYFTPSILHTQQAKMREIVDKYFPDNWAC--------------------------------------RYAASVESLRPQVQQLLKEGFLREEIVLDNIPKLLNCLRDCNVAIRWLMLHTAE-SAYDPNNKRLRQIKDQAINDSKYNPKILFQLLLDTAQFEFILKEMFKQMLTEKQLKWESYKKEGSERMTELAEVFSGVKPLTRVEKNENLQAWFREISKQIESLNYEDSTAAGRKTVQLIQALVEVQEFHQLESNLQVCQFLADTRKFLHQMIRTINIKEEVLITMQIVGDLSYAWQLIDSFTSIMQESIRASPSMVTKLRATFLKLASALDLPLMRINQANSPDLLSVSQFYSGELVAYVRKVLQIIPESMFTSLAKIIKLQIHDIMEVPTRLDKDKLKDYAQLGARYEVAKLTHAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRKELVKRVAYSLHKGLIFNPKAKPSELMPKLKEMAATMDGFYRSFEYIQDYVSIYGLKIWQEEVSRIINYNVEQECNSFLRTKIQDWQSIYQSTHIPIPKYPPVDESATFIGRLCREILRITDPRVTCYIDQMNTWYDMRTHQEVTNNRLFTEIQDTLGTFGLNGLDRLLCFMIVKELQNFLTVFQKSILKDRSVVDIFKALLTAVNPVKGIVATASKVYANAVAKTQKIWPAYLESIMKVGQMQILRLQIANELNYSCKFDSKHLAAALENLNKSLLADIEAHYQDP-SLPYPK-----------------------EDNTLLYEITAYLEAAGIHNPLNKIYITTKRLPYFPIVNLLFLIAHLPKLQYTKN-QGMTCRRAADPVDWVPLVLGLLTLLKQFHSRYTEQFLALIGQFIRSIMEQCTSQK-IPDMPSDVVGALMFLEDYVRYTKLSRKVVEAHVPSFIFDEFRT 1119          
BLAST of WASH complex subunit 5 vs. Ensembl Cavefish
Match: washc5 (WASH complex subunit 5 [Source:NCBI gene;Acc:103044498])

HSP 1 Score: 1095.11 bits (2831), Expect = 0.000e+0
Identity = 565/1183 (47.76%), Postives = 793/1183 (67.03%), Query Frame = 2
Query:  110 MTEFYLDTNW-GPILLPLVARGSAIICEICRLSDYIPSEY--KPNAIKNEYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVF--KSRTSELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQAN-FKDKKNLDIMDSFLRNVNPISKSVVFKIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDDIRT 3640
            M +F  + N  G  +L +V+RG AII E+ RLS++IP+ +  K    + +Y +IICDFSYF   E +E K++A+P+LQDLDE+FR+N++E+L RFY  FES+ +++ DL  F+  L +G ++Q  L +V+ +EDGKQL+CEALYLYG+MLL+IDQKIEG  RE++LVSY+RYS  +S+ DSN D++ +LLRSTGYS S P  KRP +YPESYF R+ I+  +ISMV+ ++RSDD Y+Q  AYPLPEHRS A ATQA M+YVCLYF P+ LH+Q A MREIVDK+F DNWV+  Y+G  VNLV+ W PYKAA +AL   ++  N+K     Y   ++ L P + ++LKEG L +E VLD I KL++ +R+CNV IRWLMLH+ E S    +NK+  Q+++  +  + +N + +FQLL  T+QFE  L +MF+ +L  K+  W   K EG +RM ELAEVFSG K L RV KN+ LQ WF ++SKQIE+L+++++T AGR   QLIQAL EV EFHQL+SNL V QF+ DT   L QM+R +N++E VL+ + I  D+SYA  +ID +T  MQ  I   P +V KLRA FLKLA++ D+PL+R+NQ +S DLLSV+Q+YS ELV YVRKVLQIIPE MF  LAKII LQ ++I E+PTRLDKDK+K+Y     R E+                           DP +LLEDGIRKEL+K V+ +  K L+F  K++ SEL  KL +++ TMDGF RSFEYIQDYV+IYGLK+W+EEVSRIIN+NVE+ECNSFLR KI D+QSIYQS  IPIP YPPVDES +FIGRL +EIL++TDP+   Y+  +N+WYD++T  E+ N +LF++++    +FGL  +DRL   ++VK LQNFL   Q +  KD+  +DI  + L  VNP+   V  K+YA+   +  KI P  ++ I+K+GQ+Q+LR  IAN+LN S KF++K L +AL   N SLL D+E H  +P + PYP                         D  ++   +  L +AG+H+P++++YITT +  +  +   L L + L KL Y++    +  +R+ D +D   L +GL+TLL+Q H    ++++ L+ Q+ RS      S+  +   P +++  ++ L+D+   ++    V+ A +P ++ D+ RT
Sbjct:    1 MVDFLAENNLCGQAILRIVSRGHAIIAELLRLSEFIPAVFRLKDKTDQQKYGDIICDFSYFKGPEYYESKLEAKPDLQDLDEEFRENNIEILSRFYLAFESVHKYIVDLIRFMDDLNEGVYIQQTLETVLLNEDGKQLLCEALYLYGVMLLVIDQKIEGEVRERMLVSYYRYSAARSSADSNLDDICKLLRSTGYS-SHPGAKRPPNYPESYFQRVPISPTFISMVIGRMRSDDIYNQVSAYPLPEHRSTALATQAAMLYVCLYFTPSILHTQQAKMREIVDKYFPDNWVISIYMGITVNLVEAWEPYKAAKIALNYTLDPANIKEQACRYAASVESLRPQVQQLLKEGFLREEIVLDNIPKLLNCLRDCNVAIRWLMLHTAE-SAYDPNNKRLRQIKDQAINDSKYNPKILFQLLLDTAQFEFILKEMFKQMLTEKQLKWESYKKEGSERMTELAEVFSGVKPLTRVEKNENLQAWFREISKQIESLNYEDSTAAGRKTVQLIQALVEVQEFHQLESNLQVCQFLADTRKFLHQMIRTINIKEEVLITMQIVGDLSYAWQLIDSFTSIMQESIRASPSMVTKLRATFLKLASALDLPLMRINQANSPDLLSVSQFYSGELVAYVRKVLQIIPESMFTSLAKIIKLQIHDIMEVPTRLDKDKLKDYAQLGARYEV---------------------------DPKQLLEDGIRKELVKRVAYSLHKGLIFNPKAKPSELMPKLKEMAATMDGFYRSFEYIQDYVSIYGLKIWQEEVSRIINYNVEQECNSFLRTKIQDWQSIYQSTHIPIPKYPPVDESATFIGRLCREILRITDPRVTCYIDQMNTWYDMRTHQEVTNNRLFTEIQDTLGTFGLNGLDRLLCFMIVKELQNFLTVFQKSILKDRSVVDIFKALLTAVNPVKGIVASKVYANAVAKTQKIWPAYLESIMKVGQMQILRLQIANELNYSCKFDSKHLAAALENLNKSLLADIEAHYQDP-SLPYPK-----------------------EDNTLLYEITAYLEAAGIHNPLNKIYITTKRLPYFPIVNLLFLIAHLPKLQYTKN-QGMTCRRAADPVDWVPLVLGLLTLLKQFHSRYTEQFLALIGQFIRSIMEQCTSQK-IPDMPSDVVGALMFLEDYVRYTKLSRKVVEAHVPSFIFDEFRT 1128          
BLAST of WASH complex subunit 5 vs. Ensembl Sea Lamprey
Match: washc5 (WASH complex subunit 5 [Source:NCBI gene;Acc:393152])

HSP 1 Score: 896.345 bits (2315), Expect = 0.000e+0
Identity = 452/955 (47.33%), Postives = 642/955 (67.23%), Query Frame = 2
Query:  791 RSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVF--KSRTSELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQAN-FKDKKNLDIMDSFLRNVNPISK--SVVFKIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNN-SLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDDIR 3637
            R+     Q  AYPLPEHRS A ATQA M+YV LY  P+ LH+Q A MREIVDK+F DNWV+  Y+G  VNL++ W PYKAA  AL N +E  N++     + R +  ++  + + L EGVL++EFVLD I KL+  +R+CNV++RW MLH+ E S    SNK+  Q+RE V+    +  +++FQLL  T+Q E +L +MFR +L  K+  W   + E  +RM E+AEVFSGTK L RV KN+ LQ WF +++KQI +L  ++ T AGR   QLIQAL EV  FHQLD+N+ V QF+ DT   L QM+R +N++E VL+++ I  D+SYA  IID YT  MQ GI KDPF+V +LRA FLKLA++ D+PL+R+NQ +S DL+SV+QYYS ELV YVRKVLQIIPE MF  LA++I LQT+ I E+PTRLDKDK++     E R ++A+ TH ISVFT+GILMMKTTLVGII++DP +LLEDGIRKE++K V+ A    L F  K+++SEL  KL DL+  MDGFRRSFEYIQDYV++YGLK+W+EEVSRIIN+NVE+ECNSFLR K+ D+QSIYQS  IPIP + P DES +FIGRL +EIL++TDPKT  YV  ++ WYD +TK E+ N +LFS+++ +  +FGL  +DRL   ++V+ LQN ++++Q N  KDK  +D   +F++  NPI    +   K+Y+   ++  KI PG +D ILK+GQLQLLR+ +A++L+ S K ++K L  AL+T N  +LL D++ H   P+  PYP        ++ P                ++   +  L +AG+++P++++YITT +     +   L + + L KL YS+ A  ++S+R+ D LD   + +G++TLL+Q H    ++++ L+ Q  RS      +       P +++  ++ L+DF + ++    V+ A +P Y++D+ R
Sbjct:    7 RTSHRCAQVSAYPLPEHRSTALATQAAMLYVLLYLQPSTLHTQQAKMREIVDKYFPDNWVISVYMGMTVNLMEAWEPYKAAKTALNNTLEPGNIREQACRHARKLDGVMKEVRQYLTEGVLMQEFVLDSIPKLLHCLRDCNVSLRWAMLHAAE-SAYDSSNKRSRQVREQVMADCKYRPDTMFQLLN-TAQLEFQLKEMFRLMLAEKQLKWESFRSEAAERMIEMAEVFSGTKPLTRVEKNENLQAWFREMAKQISSLGSEDATAAGRKTVQLIQALEEVQVFHQLDTNMQVCQFLADTRRFLHQMIRTINIKEEVLISMQIIGDLSYAWEIIDSYTRIMQEGIKKDPFMVTRLRATFLKLASALDLPLLRINQANSPDLMSVSQYYSGELVSYVRKVLQIIPETMFGLLAQVIQLQTHNILEVPTRLDKDKLRECAQLEARYQVAKSTHAISVFTEGILMMKTTLVGIIKVDPKQLLEDGIRKEMVKQVAAALHTGLTFNPKAKSSELMPKLHDLAARMDGFRRSFEYIQDYVSVYGLKIWQEEVSRIINYNVEQECNSFLRTKVQDWQSIYQSTHIPIPKFQPTDESATFIGRLCREILRITDPKTTSYVDQLSIWYDGRTKQELTNSRLFSEVQKSLGTFGLTGLDRLLSFMIVRELQNAVEYLQKNVLKDKVLMDSFTAFMKTANPIKGILANASKVYSSATSKSQKIWPGYMDIILKVGQLQLLRRQMAHELSYSCKLDSKTLFGALMTLNKLALLADVQAHYAEPSR-PYPR-------EDNP----------------LLFELTSYLEAAGINNPLNKIYITTKRLPHFPLINFLCVIAHLPKLQYSK-AVGMVSRRAGDGLDWPPMVVGMLTLLKQFHSRNTEQFLALLGQLVRSLLEQCTTSQKSPEMPSDVVGTLVFLEDFVHYTQLTRQVIEAHVPSYILDEFR 934          
BLAST of WASH complex subunit 5 vs. Ensembl Nematostella
Match: EDO30084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1T2])

HSP 1 Score: 665.611 bits (1716), Expect = 0.000e+0
Identity = 330/704 (46.88%), Postives = 486/704 (69.03%), Query Frame = 2
Query: 1541 LSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVF--KSRTSELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQANFKDKKNLDIMDSFLRNVNPISKSVV---FKIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDDIR 3637
            +S QI +LS++++T AGR + QLIQAL EV EFHQLDSNL V+QF+ +T   L QM+R +N++E VL+ + + +D+SYA  IID Y+G+MQ GI  +P LV KLRA FLK+A++ D+PL+R+ Q +S DL+SV+QYYS ELV YVRKVLQIIP+ MF  L KII LQTN IKE+PTRL+KDK++ Y  F++R EIARLTH ISVFT+GILMMKTTLVGII++DP +LLEDGIRKEL++ V+QA    L+F  K++ SEL A+L +L   MDGF+RSFEYIQDY+NIYGLK+W+EE+SRIIN+NVE+ECNSFLR K+ D+QSIYQS  IPIP +P VDES++FIGRL +EIL++TDP+   Y+  + +WYD +TK E+ N+ +  +L+ +  +FGL  +D+L   ++VK LQ F+  +Q++ +DK  +D +    +++ P+ KS+V   +K+Y     +L K+     + I+K+GQ+QL+R+ IAN+LN S KF++K   +AL TFN+SLL D+E H  +P + PYP        ++ P                ++   +  L  AG+H+P++++Y+TT K+ F ++   L + S + KL Y ++A  +++++  D +D     +G++T+L+Q H    +++     QY RS   +  +       P E++N ++ L+D+   S++P  V+ A IP Y+ D  R
Sbjct:    1 MSNQISSLSYEDSTSAGRKMVQLIQALEEVQEFHQLDSNLQVRQFLLETRTFLHQMIRTINIKEEVLITIQLVADLSYAWIIIDSYSGFMQQGIKSNPSLVQKLRATFLKMASAMDLPLVRIGQANSPDLVSVSQYYSGELVSYVRKVLQIIPQTMFGLLDKIIKLQTNNIKEVPTRLEKDKLREYAQFDERYEIARLTHSISVFTEGILMMKTTLVGIIKVDPKQLLEDGIRKELVQQVAQALHFGLIFNPKAKQSELSARLRELGEKMDGFKRSFEYIQDYINIYGLKIWQEEISRIINYNVEQECNSFLREKVHDWQSIYQSTAIPIPKFPRVDESVNFIGRLAREILRITDPRVTCYIDQMGAWYDSRTKQEVMNLLIIRQLQQSVGTFGLTGLDKLLSFMIVKELQKFVLLIQSSLRDKLVMDTLTYLSKSLTPV-KSLVAAPYKVYPAATQKLTKLWTVYTEAIMKVGQMQLIRRQIANELNCSCKFDSKIHENALRTFNSSLLRDIEAHYQDP-SLPYP-------KEDNP----------------LMFELTSYLEWAGIHNPLNKIYVTTKKYPFFAMLNFLCVISQIPKLIYMKSAGTLVARKPTDQVDSAPFVVGMITVLKQFHSEYSEQFFACCGQYVRSLVEAAATNIRTNELPQEIVNLMIFLEDYLSYSQQPRKVVEAHIPTYIFDQFR 679          
BLAST of WASH complex subunit 5 vs. Ensembl Nematostella
Match: EDO41150 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S567])

HSP 1 Score: 460.685 bits (1184), Expect = 5.359e-151
Identity = 225/430 (52.33%), Postives = 313/430 (72.79%), Query Frame = 2
Query:  110 MTEFYLDTN-WGPILLPLVARGSAIICEICRLSDYIPSEYKPNAI--KNEYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSI-SGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDM 1387
            M +F  + N  G  +L LV+RG+AI+ E+ RLS+++P  +K  +   + +Y+EI+ DFSYF   + +EHKID+RPELQDLDE+FR+NH+E+L RFY+ FES+ ++V DLN FL  L++G F+Q  L SV+ + DGKQLMCE+LYLYG+MLL+ID K E   RE++LVSYHRY   ++++DSN D+V +LLRSTG+SV +P  KRP  YPE YF+RI I+  ++ M++ +LRSDD Y+Q   YPLPEHRS A ATQA+M++V LYFAP  LHSQ A MREIVDKHF DNWV+  Y+G +VNLV+ W PYKAA  AL N ++  N+K+L       ++ L   +   LKEG L+ E+VLD I KLM+ +R+CNV +RWLMLH+C+ +I S  S K+C  ++E +VT A ++  ++F+LL  T+QFEL L ++
Sbjct:    1 MVDFLAENNACGQTILKLVSRGNAIVAELLRLSEFVPPVFKLESREEREKYAEILADFSYFKGPDYYEHKIDSRPELQDLDEEFRENHLEILTRFYKAFESVHKYVVDLNRFLEDLDEGVFIQQTLDSVLLNGDGKQLMCESLYLYGVMLLVIDMKFESDVRERMLVSYHRYCAARADVDSNLDDVCKLLRSTGFSV-VPGAKRPAKYPEDYFSRIEISKTFVDMLIGRLRSDDVYNQISGYPLPEHRSTALATQASMLFVILYFAPEILHSQQAKMREIVDKHFPDNWVISIYMGIVVNLVEAWEPYKAARTALNNTLDSNNIKTLATKTNAKVQHLNKEVLNYLKEGFLVDEYVLDNIPKLMNCMRDCNVALRWLMLHTCDGTILSFDSFKRCRAIKE-LVTTAGYSPRAVFELLLNTAQFELNLKEV 428          
BLAST of WASH complex subunit 5 vs. Ensembl Medaka
Match: washc5 (WASH complex subunit 5 [Source:NCBI gene;Acc:101164428])

HSP 1 Score: 1147.11 bits (2966), Expect = 0.000e+0
Identity = 582/1185 (49.11%), Postives = 820/1185 (69.20%), Query Frame = 2
Query:  110 MTEFYLDTNW-GPILLPLVARGSAIICEICRLSDYIPSEY--KPNAIKNEYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVF--KSRTSELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQAN-FKDKKNLDIMDSFLRNVNPISKSV--VFKIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDDIRT 3640
            M +F  + N  G  +L +V+RG+AII E+ RLSD+IP+ +  K  + + +Y +IICDFSYF   E +E K++A+PELQDLDE+FR+N++E+L RFY  FES+ +++ DLN +L  L +G ++Q  L +V+ +EDGKQL+CEALYLYG+MLL+IDQKIEG  RE++LVSY+RYS  +S+ DSN D++ +LLRSTG+S S P  KRP +YPESYF R+ I+  +ISMV+ +LRSDD Y+Q  AYPLPEHRS A A QA M+YVCL+F P+ L +Q A MREIVDK+F DNWV+  Y+G  VNL++ W PYKAA  AL   ++  N+K   + Y   ++ L P + ++LKEG L +E +LD I KL++ +R+CNV IRWLMLHS E S    +NK+  Q+++ V+  + +N +++FQLL  T+QFE  L +MF+ +L  K+  W   K EG +RM ELAEVFSG K L RV KN+ LQ WF ++SKQIE+L+++++T AGR   QLIQAL EV EFHQL+SNL V QF+ DT   L  M+R +N++E VL+ + I  D+SYA  IID +T  MQ  I  +P +V KLRA FLKLA++ D+PL+R+NQ +S DLLSV+Q+YS ELV YVRKVLQIIPE MF  LAKII LQ ++I E+PTRLDKDK+K+Y     R E+A+LTHDIS+FT+GILMMKTTLVGII++DP +LLEDGIRKEL+K V+ A  K L+F  K++ SEL  KL D++ TMDGF RSFEYIQDYV+IYGLK+W+EEVSRIIN+NVE+ECNSFLR KI D+QS++QS  IPIP +P VDES +FIGRL +EIL++TDPK   Y+  +N+WYD+K+  E+ N +LFS++++   +FGL  +DRL   ++V+ LQNFL  +Q +  KDK  +++  + L  VNP+   V    K Y     +  KI    ++ I+K+GQ+Q+LR+ IAN+LN S KF++K L +AL   N SLL D+E H  +P + PYP                         +  ++   +  L +AG+H+P+S++YITT +  +  +   L + + L KL Y++    +  K++ D +D   L +GL+TLL+Q H    + ++ L+ Q+ RS      S+  +   P +++  ++ L+D+   ++    V+ A +P ++ D+ RT
Sbjct:    1 MVDFLAENNLCGQAVLRIVSRGNAIIAELLRLSDFIPTVFRLKDKSDQQKYGDIICDFSYFKGPEYYEGKLEAKPELQDLDEEFRENNIEILSRFYLAFESVHKYIVDLNRYLDDLHEGVYIQQTLETVLLNEDGKQLLCEALYLYGVMLLVIDQKIEGEVRERMLVSYYRYSAARSSGDSNLDDICKLLRSTGFS-SQPGAKRPANYPESYFQRVPISTTFISMVIGRLRSDDIYNQVSAYPLPEHRSTALANQAAMLYVCLFFYPSILQTQQAKMREIVDKYFPDNWVISIYMGITVNLIEAWEPYKAAKTALNYTLDAANIKEQASRYAASMESLRPQVQQLLKEGFLREEIILDNIPKLLNSLRDCNVAIRWLMLHSAE-SAYDPNNKRLRQIKDQVLNDSKYNPKTLFQLLLDTAQFEFTLKEMFKQMLSEKQIKWENYKKEGSERMMELAEVFSGVKPLTRVEKNENLQAWFREISKQIESLNYEDSTAAGRKTVQLIQALIEVQEFHQLESNLQVCQFLADTRKFLHHMIRTINIKEEVLITMQIVGDLSYAWQIIDSFTSIMQESIRVNPSMVTKLRATFLKLASALDLPLLRINQANSADLLSVSQFYSGELVAYVRKVLQIIPESMFTSLAKIIKLQIHDIMEVPTRLDKDKLKDYSQLAARYEVAKLTHDISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRKELVKRVAYALHKGLIFNPKAKPSELMPKLKDMAATMDGFYRSFEYIQDYVSIYGLKIWQEEVSRIINYNVEQECNSFLRTKIQDWQSVHQSTHIPIPKFPSVDESATFIGRLCREILRITDPKVTCYIDQLNTWYDLKSHQEVTNKRLFSEIQNTLGTFGLNGLDRLLCFMIVRELQNFLTMLQKSILKDKALVEVFKTVLAAVNPVQGIVANASKAYTSAVAKSQKIWGPYLEAIMKVGQMQILRQQIANELNFSCKFDSKHLAAALENLNKSLLADIEAHYQDP-SLPYPK-----------------------EENTLLYEITAYLEAAGIHNPLSKIYITTKRLPYFPIINLLFIIAQLPKLQYNKN-QGMTCKKATDPVDWPPLVLGLLTLLKQFHSRYTQHFLALLGQFIRSVMEQCTSQK-IPEMPSDVVGALMFLEDYVKYTKLSRKVVEAHVPSFIFDEFRT 1157          
BLAST of WASH complex subunit 5 vs. Ensembl Medaka
Match: washc5 (WASH complex subunit 5 [Source:NCBI gene;Acc:101164428])

HSP 1 Score: 1084.71 bits (2804), Expect = 0.000e+0
Identity = 560/1185 (47.26%), Postives = 793/1185 (66.92%), Query Frame = 2
Query:  110 MTEFYLDTNW-GPILLPLVARGSAIICEICRLSDYIPSEY--KPNAIKNEYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVF--KSRTSELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQAN-FKDKKNLDIMDSFLRNVNPISKSV--VFKIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDDIRT 3640
            M +F  + N  G  +L +V+RG+AII E+ RLSD+IP+ +  K  + + +Y +IICDFSYF   E +E K++A+PELQDLDE+FR+N++E+L RFY  FES+ +++ DLN +L  L +G ++Q  L +V+ +EDGKQL+CEALYLYG+MLL+IDQKIEG  RE++LVSY+RYS  +S+ DSN D++ +LLRSTG+S S P  KRP +YPESYF R+ I+  +ISMV+ +LRSDD Y+Q  AYPLPEHRS A A QA M+YVCL+F P+ L +Q A MREIVDK+F DNWV+  Y+G  VNL++ W PYKAA  AL   ++  N+K   + Y   ++ L P + ++LKEG L +E +LD I KL++ +R+CNV IRWLMLHS E S    +NK+  Q+++ V+  + +N +++FQLL  T+QFE  L +MF+ +L  K+  W   K EG +RM ELAEVFSG K L RV KN+ LQ WF ++SKQIE+L+++++T AGR   QLIQAL EV EFHQL+SNL V QF+ DT   L  M+R +N++E VL+ + I  D+SYA  IID +T  MQ  I  +P +V KLRA FLKLA++ D+PL+R+NQ +S DLLSV+Q+YS ELV YVRKVLQIIPE MF  LAKII LQ ++I E+PTRLDKDK+K+Y     R E+                           DP +LLEDGIRKEL+K V+ A  K L+F  K++ SEL  KL D++ TMDGF RSFEYIQDYV+IYGLK+W+EEVSRIIN+NVE+ECNSFLR KI D+QS++QS  IPIP +P VDES +FIGRL +EIL++TDPK   Y+  +N+WYD+K+  E+ N +LFS++++   +FGL  +DRL   ++V+ LQNFL  +Q +  KDK  +++  + L  VNP+   V    K Y     +  KI    ++ I+K+GQ+Q+LR+ IAN+LN S KF++K L +AL   N SLL D+E H  +P + PYP                         +  ++   +  L +AG+H+P+S++YITT +  +  +   L + + L KL Y++    +  K++ D +D   L +GL+TLL+Q H    + ++ L+ Q+ RS      S+  +   P +++  ++ L+D+   ++    V+ A +P ++ D+ RT
Sbjct:    1 MVDFLAENNLCGQAVLRIVSRGNAIIAELLRLSDFIPTVFRLKDKSDQQKYGDIICDFSYFKGPEYYEGKLEAKPELQDLDEEFRENNIEILSRFYLAFESVHKYIVDLNRYLDDLHEGVYIQQTLETVLLNEDGKQLLCEALYLYGVMLLVIDQKIEGEVRERMLVSYYRYSAARSSGDSNLDDICKLLRSTGFS-SQPGAKRPANYPESYFQRVPISTTFISMVIGRLRSDDIYNQVSAYPLPEHRSTALANQAAMLYVCLFFYPSILQTQQAKMREIVDKYFPDNWVISIYMGITVNLIEAWEPYKAAKTALNYTLDAANIKEQASRYAASMESLRPQVQQLLKEGFLREEIILDNIPKLLNSLRDCNVAIRWLMLHSAE-SAYDPNNKRLRQIKDQVLNDSKYNPKTLFQLLLDTAQFEFTLKEMFKQMLSEKQIKWENYKKEGSERMMELAEVFSGVKPLTRVEKNENLQAWFREISKQIESLNYEDSTAAGRKTVQLIQALIEVQEFHQLESNLQVCQFLADTRKFLHHMIRTINIKEEVLITMQIVGDLSYAWQIIDSFTSIMQESIRVNPSMVTKLRATFLKLASALDLPLLRINQANSADLLSVSQFYSGELVAYVRKVLQIIPESMFTSLAKIIKLQIHDIMEVPTRLDKDKLKDYSQLAARYEV---------------------------DPKQLLEDGIRKELVKRVAYALHKGLIFNPKAKPSELMPKLKDMAATMDGFYRSFEYIQDYVSIYGLKIWQEEVSRIINYNVEQECNSFLRTKIQDWQSVHQSTHIPIPKFPSVDESATFIGRLCREILRITDPKVTCYIDQLNTWYDLKSHQEVTNKRLFSEIQNTLGTFGLNGLDRLLCFMIVRELQNFLTMLQKSILKDKALVEVFKTVLAAVNPVQGIVANASKAYTSAVAKSQKIWGPYLEAIMKVGQMQILRQQIANELNFSCKFDSKHLAAALENLNKSLLADIEAHYQDP-SLPYPK-----------------------EENTLLYEITAYLEAAGIHNPLSKIYITTKRLPYFPIINLLFIIAQLPKLQYNKN-QGMTCKKATDPVDWPPLVLGLLTLLKQFHSRYTQHFLALLGQFIRSVMEQCTSQK-IPEMPSDVVGALMFLEDYVKYTKLSRKVVEAHVPSFIFDEFRT 1130          
BLAST of WASH complex subunit 5 vs. Planmine SMEST
Match: SMESG000078787.1 (SMESG000078787.1)

HSP 1 Score: 2383.6 bits (6176), Expect = 0.000e+0
Identity = 1179/1183 (99.66%), Postives = 1182/1183 (99.92%), Query Frame = 2
Query:  110 MTEFYLDTNWGPILLPLVARGSAIICEICRLSDYIPSEYKPNAIKNEYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVFKSRTSELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQANFKDKKNLDIMDSFLRNVNPISKSVVFKIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRXXXXXXXXXXXXXXXXHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDDIRTQIRNSE 3658
            MTEFYLDTNWGPILLPLVARGSAIICEICRLSDYIPSEYKPNAIKNEYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLP+NKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVN YCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVFKSRTSELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLK+WREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESL+FIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQANFKDKKNLDIMDSFLRNVNPISKSVVFKIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRDNEGNNIPDPDIDIINHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDDIRTQIRNSE
Sbjct:    1 MTEFYLDTNWGPILLPLVARGSAIICEICRLSDYIPSEYKPNAIKNEYSEIICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIFRFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLIDQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPSNKRPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARATQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVDEWTPYKAASVALANIIELTNVKSLVNRYCRLIKKLIPNIDKILKEGVLIKEFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVTHADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMKELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQLIQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNICSDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLNQCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKELPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELDPHKLLEDGIRKELIKHVSQAFDKKLVFKSRTSELDAKLDDLSNTMDGFRRSFEYIQDYVNIYGLKIWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQSKTIPIPSYPPVDESLTFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKVEIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQANFKDKKNLDIMDSFLRNVNPISKSVVFKIYADYHNRLAKISPGAIDFILKIGQLQLLRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSLGLLQNSKEFPGDRDNEGNNIPDPDIDIINHTSKLLHSAGLHDPISQVYITTHKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLVTLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQDFCYISRRPINVLYAFIPEYLIDDIRTQIRNSE 1183          
The following BLAST results are available for this feature:
BLAST of WASH complex subunit 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
WASHC50.000e+048.65WASH complex subunit 5 [Source:HGNC Symbol;Acc:HGN... [more]
WASHC50.000e+048.94WASH complex subunit 5 [Source:HGNC Symbol;Acc:HGN... [more]
WASHC51.441e-6564.42WASH complex subunit 5 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of WASH complex subunit 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
T05E7.33.378e-4622.36pep chromosome:WBcel235:I:6188157:6192632:1 gene:W... [more]
T05E7.33.378e-4622.36pep chromosome:WBcel235:I:6188159:6192632:1 gene:W... [more]
back to top
BLAST of WASH complex subunit 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Strump0.000e+038.70gene:FBgn0036571 transcript:FBtr0075452[more]
Strump0.000e+038.70gene:FBgn0036571 transcript:FBtr0301912[more]
Strump0.000e+037.88gene:FBgn0036571 transcript:FBtr0333292[more]
back to top
BLAST of WASH complex subunit 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
washc50.000e+050.29WASH complex subunit 5 [Source:NCBI gene;Acc:39315... [more]
back to top
BLAST of WASH complex subunit 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
washc50.000e+048.82WASH complex subunit 5 [Source:NCBI gene;Acc:44839... [more]
washc50.000e+051.06WASH complex subunit 5 [Source:NCBI gene;Acc:44839... [more]
washc50.000e+047.31WASH complex subunit 5 [Source:NCBI gene;Acc:44839... [more]
washc50.000e+046.11WASH complex subunit 5 [Source:NCBI gene;Acc:44839... [more]
washc50.000e+045.42WASH complex subunit 5 [Source:NCBI gene;Acc:44839... [more]
back to top
BLAST of WASH complex subunit 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Washc50.000e+048.23WASH complex subunit 5 [Source:MGI Symbol;Acc:MGI:... [more]
Washc50.000e+046.42WASH complex subunit 5 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of WASH complex subunit 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7ZVM1|WASC5_DANRE0.000e+049.62WASH complex subunit 5 OS=Danio rerio OX=7955 GN=w... [more]
sp|Q6DIP9|WASC5_XENTR0.000e+048.74WASH complex subunit 5 OS=Xenopus tropicalis OX=83... [more]
sp|Q12768|WASC5_HUMAN0.000e+048.65WASH complex subunit 5 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q5R5P0|WASC5_PONAB0.000e+048.57WASH complex subunit 5 OS=Pongo abelii OX=9601 GN=... [more]
sp|Q8C2E7|WASC5_MOUSE0.000e+048.23WASH complex subunit 5 OS=Mus musculus OX=10090 GN... [more]
back to top
BLAST of WASH complex subunit 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3J3K40.000e+051.28LOW QUALITY PROTEIN: WASH complex subunit 5-like O... [more]
V4B4380.000e+050.80Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A067QIX20.000e+050.04Strumpellin OS=Zootermopsis nevadensis OX=136037 G... [more]
A0A2B4S6Q60.000e+048.90WASH complex subunit strumpellin OS=Stylophora pis... [more]
A0A2J7PBE20.000e+050.00WASH complex subunit 5 OS=Cryptotermes secundus OX... [more]
back to top
BLAST of WASH complex subunit 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
washc50.000e+049.45WASH complex subunit 5 [Source:NCBI gene;Acc:10304... [more]
washc50.000e+048.02WASH complex subunit 5 [Source:NCBI gene;Acc:10304... [more]
washc50.000e+047.76WASH complex subunit 5 [Source:NCBI gene;Acc:10304... [more]
back to top
BLAST of WASH complex subunit 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
washc50.000e+047.33WASH complex subunit 5 [Source:NCBI gene;Acc:39315... [more]
back to top
BLAST of WASH complex subunit 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WASH complex subunit 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO300840.000e+046.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411505.359e-15152.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WASH complex subunit 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
washc50.000e+049.11WASH complex subunit 5 [Source:NCBI gene;Acc:10116... [more]
washc50.000e+047.26WASH complex subunit 5 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of WASH complex subunit 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000078787.10.000e+099.66SMESG000078787.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001740 ID=SMED30001740|Name=WASH complex subunit 5|organism=Schmidtea mediterranea sexual|type=transcript|length=3722bp
CTTGAAGAGGCACAATTTTAAAATTCGGAAATTTTACAAAAATATTTGTT
AAATCTTTTATTCAGTATATTAAATTTTAATTGAAATATTAGAAGTTTGT
CATAAAATAATGACTGAATTCTATCTTGATACAAATTGGGGCCCAATTCT
TTTGCCATTGGTGGCCCGTGGTAGTGCAATAATATGTGAAATATGTAGAT
TATCTGATTATATTCCTTCTGAATACAAACCTAATGCCATAAAAAATGAA
TATTCAGAAATTATTTGCGATTTTTCATATTTTAGTTTATCAGAATCTTT
TGAACACAAAATAGATGCCCGGCCGGAATTGCAAGATTTAGATGAAAAAT
TCCGCGATAATCACATGGAATTGTTAGATAGATTTTATAGATTGTTTGAA
AGCATTTTTAGATTCGTTAGCGATCTAAATCATTTTCTTTTGAGCTTGGA
AGATGGACATTTTGTTCAGCACGATTTAGTGTCAGTAATGCAAGATGAAG
ATGGCAAACAATTAATGTGTGAAGCGTTGTATTTGTATGGAATTATGCTA
CTACTAATCGATCAAAAGATAGAAGGAACTACCCGCGAGAAACTGTTAGT
GTCATACCACAGATATAGCGTTAAGCAATCAAATCTTGATTCCAACACTG
ATGAAGTGTATCAATTATTGCGAAGCACCGGTTACAGTGTTAGCTTACCA
AATAATAAAAGACCCGTTGATTATCCTGAGTCATATTTTAATCGGATTAA
CATCAATGCTAAATATATTTCAATGGTGCTTGATAAATTGAGATCTGATG
ATTTTTATCATCAAACTCTAGCTTATCCACTGCCAGAACACAGAAGTGTT
GCCAGAGCAACTCAAGCGAATATGATTTATGTTTGTCTATATTTTGCTCC
GAATTATTTGCATAGCCAACCGGCAGTGATGAGAGAAATAGTTGATAAAC
ATTTTTCTGATAATTGGGTTTTGGGTGGATATCTTGGTCACATTGTAAAC
TTAGTCGATGAATGGACCCCATATAAAGCTGCTAGTGTTGCTTTAGCAAA
TATAATCGAGCTAACAAATGTTAAAAGTCTTGTTAATCATTATTGTCGGT
TGATAAAAAAGTTGATTCCTAATATTGACAAAATTTTGAAAGAAGGAGTG
CTGATAAAAGAATTTGTGTTAGATAAAATTAGCAAATTAATGGATAAAAT
TAGAGAATGCAACGTTACAATTAGATGGTTAATGTTACATTCTTGTGAAT
TATCAATCAGTGGCAAGAGCAACAAAAAATGTTTTCAACTACGCGAGGCT
GTGGTCACTCATGCAGATTTTAATGAGGAATCTATTTTCCAGCTCCTCGG
CTTGACTTCTCAATTTGAATTAAAATTAGGTGATATGTTTCGATTTATTC
TTGAACACAAAGAAGAAAGCTGGAGTCAAATCAAAATGGAAGGTATTGAT
CGAATGAAAGAATTAGCCGAGGTTTTTTCAGGTACTAAGGCATTGGCTAG
GGTATCAAAAAATGACAAATTGCAGATCTGGTTTGAAAAACTTTCAAAAC
AAATAGAAAATCTTTCCTTTCAAAATACAACTTTTGCCGGTAGAACTCTG
GATCAGTTGATACAAGCTTTACATGAAGTTTTAGAATTTCATCAACTCGA
TTCAAATTTAATGGTTAAACAGTTTATCAACGATACTTGTGCTAGTTTGA
AACAAATGATGCGCTTGCTAAATCTTCAGGAACGCGTTCTTGTTAACCTA
AATATTTGTTCCGATGTCAGCTACGCTCTTAACATAATCGACAAGTACAC
TGGGTATATGCAAAGCGGCATCACTAAAGATCCATTTTTGGTTATTAAAC
TGAGAGCCGTTTTCTTAAAACTGGCCGCAAGTCATGATATACCTCTAATA
CGATTGAATCAATGTTCCAGCAAAGACTTGCTTAGTGTTACTCAGTATTA
CTCTTCGGAACTTGTTCAATATGTTCGCAAGGTCTTACAAATTATTCCAG
AAATGATGTTCATGAAATTGGCTAAAATTATAGACCTTCAGACCAACGAA
ATTAAAGAACTCCCAACTAGATTAGACAAAGACAAAGTTAAAAATTATTT
ACATTTCGAAAAAAGAAGTGAAATCGCTAGATTGACTCACGACATTTCAG
TTTTTACTCAGGGAATTTTGATGATGAAAACGACTCTCGTTGGAATTATT
GAATTAGATCCGCATAAATTATTGGAAGATGGAATTCGTAAAGAACTAAT
AAAACACGTGTCACAGGCTTTTGATAAAAAACTGGTGTTTAAATCTCGCA
CTTCGGAACTTGATGCAAAACTCGACGATTTGTCAAATACAATGGATGGA
TTTCGCAGATCTTTCGAATATATACAAGATTATGTTAATATTTATGGATT
AAAAATGTGGCGTGAAGAAGTATCAAGAATTATCAATTTTAATGTTGAAA
AAGAATGCAATTCATTTTTAAGAAATAAAATTCCAGATTATCAGAGTATT
TATCAGTCGAAAACTATTCCAATCCCTTCATATCCCCCAGTTGATGAATC
TTTGTCATTTATTGGTCGACTAATTAAAGAAATATTGAAGGTTACAGATC
CTAAAACATGTATTTATGTTTCTCATGTTAATTCGTGGTATGACATCAAA
ACAAAAGTTGAAATAGCTAATGTTAAATTATTCAGCAAGCTTGAAAGTGC
TTTCAATAGTTTTGGTTTATGTAGTATAGACAGATTATTCGGTCTATTGT
TAGTGAAAACTTTGCAAAATTTTTTACAACACATGCAGGCTAATTTCAAA
GACAAAAAAAATCTTGATATAATGGATAGTTTTCTACGAAATGTAAACCC
GATATCAAAAAGTGTTGTTTTTAAGATTTATGCTGATTATCACAATCGAT
TAGCCAAGATTTCTCCAGGAGCTATTGACTTCATTTTGAAAATAGGTCAG
CTTCAATTGTTGAGGAAGCACATTGCTAACCAATTGAATTTGTCCAGTAA
ATTTGAAGCTAAGTTTCTGCATTCGGCATTAATAACTTTCAATAATTCTT
TATTGAATGATCTAGAAAACCATGTCATTAATCCTAATACCTGCCCTTAT
CCATCTTTGGGTCTATTGCAAAATTCAAAGGAATTTCCAGGGGATAGAGA
CAATGAAGGAAACAATATCCCTGATCCAGATATTGATATAATCAATCACA
CTAGCAAGTTACTTCATTCAGCTGGTCTCCACGATCCAATCAGTCAAGTC
TACATAACAACTCATAAATTCCGTTTCGCGTCGGTCTATCCATGTCTTTT
GCTTACATCTGTTCTAAATAAATTATCTTATTCAAGAACTGCGGATAATA
TTATTAGTAAACGTTCAAACGATGCATTAGATGGGCACGTTTTAGCTATT
GGACTTGTCACTCTTCTTCAGCAAATGCATCCAATCATAATCAAAGAATG
GATTGGTTTAGTTAGTCAATATGCTAGATCAGCAGCTTTATCCTTACAAA
GTAAAAATGGCGTCGTTACATATCCACCAGAATTGATCAACTGTATTCTA
ATTCTCCAAGATTTCTGCTACATTTCTCGCAGACCAATAAATGTTCTATA
TGCCTTTATTCCGGAATATCTTATTGATGACATTCGGACTCAAATCAGAA
ATAGTGAATAACTTGATTTTTCTATTAGTTTTCAACAATTTATAATGATT
GTTTAATAAATTTAGTTTCGTC
back to top

protein sequence of SMED30001740-orf-1

>SMED30001740-orf-1 ID=SMED30001740-orf-1|Name=SMED30001740-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1184bp
MTEFYLDTNWGPILLPLVARGSAIICEICRLSDYIPSEYKPNAIKNEYSE
IICDFSYFSLSESFEHKIDARPELQDLDEKFRDNHMELLDRFYRLFESIF
RFVSDLNHFLLSLEDGHFVQHDLVSVMQDEDGKQLMCEALYLYGIMLLLI
DQKIEGTTREKLLVSYHRYSVKQSNLDSNTDEVYQLLRSTGYSVSLPNNK
RPVDYPESYFNRININAKYISMVLDKLRSDDFYHQTLAYPLPEHRSVARA
TQANMIYVCLYFAPNYLHSQPAVMREIVDKHFSDNWVLGGYLGHIVNLVD
EWTPYKAASVALANIIELTNVKSLVNHYCRLIKKLIPNIDKILKEGVLIK
EFVLDKISKLMDKIRECNVTIRWLMLHSCELSISGKSNKKCFQLREAVVT
HADFNEESIFQLLGLTSQFELKLGDMFRFILEHKEESWSQIKMEGIDRMK
ELAEVFSGTKALARVSKNDKLQIWFEKLSKQIENLSFQNTTFAGRTLDQL
IQALHEVLEFHQLDSNLMVKQFINDTCASLKQMMRLLNLQERVLVNLNIC
SDVSYALNIIDKYTGYMQSGITKDPFLVIKLRAVFLKLAASHDIPLIRLN
QCSSKDLLSVTQYYSSELVQYVRKVLQIIPEMMFMKLAKIIDLQTNEIKE
LPTRLDKDKVKNYLHFEKRSEIARLTHDISVFTQGILMMKTTLVGIIELD
PHKLLEDGIRKELIKHVSQAFDKKLVFKSRTSELDAKLDDLSNTMDGFRR
SFEYIQDYVNIYGLKMWREEVSRIINFNVEKECNSFLRNKIPDYQSIYQS
KTIPIPSYPPVDESLSFIGRLIKEILKVTDPKTCIYVSHVNSWYDIKTKV
EIANVKLFSKLESAFNSFGLCSIDRLFGLLLVKTLQNFLQHMQANFKDKK
NLDIMDSFLRNVNPISKSVVFKIYADYHNRLAKISPGAIDFILKIGQLQL
LRKHIANQLNLSSKFEAKFLHSALITFNNSLLNDLENHVINPNTCPYPSL
GLLQNSKEFPGDRDNEGNNIPDPDIDIINHTSKLLHSAGLHDPISQVYIT
THKFRFASVYPCLLLTSVLNKLSYSRTADNIISKRSNDALDGHVLAIGLV
TLLQQMHPIIIKEWIGLVSQYARSAALSLQSKNGVVTYPPELINCILILQ
DFCYISRRPINVLYAFIPEYLIDDIRTQIRNSE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR019393WASH_strumpellin
Vocabulary: cellular component
TermDefinition
GO:0071203WASH complex
GO:0005768endosome
GO:0005769early endosome
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0007409axonogenesis
GO:0015031protein transport
GO:0048666neuron development
GO:0060047heart contraction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019393WASH complex, subunit strumpellinPFAMPF10266Strumpellincoord: 22..1121
e-value: 0.0
score: 1402.0
IPR019393WASH complex, subunit strumpellinPANTHERPTHR15691PROTEIN KIAA0196coord: 11..1175