HTH CENPB-type domain-containing protein

Overview
NameHTH CENPB-type domain-containing protein
Smed IDSMED30001723
Length (bp)3119
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of HTH CENPB-type domain-containing protein (SMED30001723) t-SNE clustered cells

Violin plots show distribution of expression levels for HTH CENPB-type domain-containing protein (SMED30001723) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of HTH CENPB-type domain-containing protein (SMED30001723) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for HTH CENPB-type domain-containing protein (SMED30001723) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Match: POGK (pogo transposable element derived with KRAB domain [Source:HGNC Symbol;Acc:HGNC:18800])

HSP 1 Score: 159.844 bits (403), Expect = 5.640e-58
Identity = 70/190 (36.84%), Postives = 117/190 (61.58%), Query Frame = 1
Query:  265 TVMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNEWFFSGAPSFTASGNRRKVGLETICKWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQ 834
            T MLG   DG+K+PPY+I +   +P    +P+GM ++    GWM E+L +DW++ +W   R       R +L+L+ FR H    VK  +    TD+VIIPGG+T QLQV+DVV  +P    +R +++ W  +G  + + +GN +K  L    +W+ ++W+++S   I++GFKKC +S+ ++  EDD++W+
Sbjct:  399 TAMLGVLADGRKLPPYIILRGTYIPPG-KFPSGMEIRCHRYGWMTEDLMQDWLEVVW-RRRTGAVPKQRGMLILNGFRGHATDSVKNSMESMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAKKPPLGLFLEWVMVAWNSISSESIVQGFKKCHISSNLE-EEDDVLWE 585          

HSP 2 Score: 87.0409 bits (214), Expect = 5.640e-58
Identity = 36/88 (40.91%), Postives = 59/88 (67.05%), Query Frame = 2
Query:    2 PGSIFKASARWCQLFMKRNDISIRRRTSIAQRLPDDVENKLLDYQKYIINLRKRHEYPISCIGNGDQTPLSFDIPSFQTLDFKGVKSV 265
            P   FKAS  WC+  M+R D+S+R +  + Q LP+D+  KL+ YQ+ ++ LR+ H+Y ++ +GN D+TP+  ++PS  T+D +G K V
Sbjct:  299 PEKGFKASLGWCRRMMRRYDLSLRHKVPVPQHLPEDLTEKLVTYQRSVLALRRAHDYEVAQMGNADETPICLEVPSRVTVDNQGEKPV 386          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Match: POGK (pogo transposable element derived with KRAB domain [Source:HGNC Symbol;Acc:HGNC:18800])

HSP 1 Score: 159.844 bits (403), Expect = 5.640e-58
Identity = 70/190 (36.84%), Postives = 117/190 (61.58%), Query Frame = 1
Query:  265 TVMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNEWFFSGAPSFTASGNRRKVGLETICKWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQ 834
            T MLG   DG+K+PPY+I +   +P    +P+GM ++    GWM E+L +DW++ +W   R       R +L+L+ FR H    VK  +    TD+VIIPGG+T QLQV+DVV  +P    +R +++ W  +G  + + +GN +K  L    +W+ ++W+++S   I++GFKKC +S+ ++  EDD++W+
Sbjct:  399 TAMLGVLADGRKLPPYIILRGTYIPPG-KFPSGMEIRCHRYGWMTEDLMQDWLEVVW-RRRTGAVPKQRGMLILNGFRGHATDSVKNSMESMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAKKPPLGLFLEWVMVAWNSISSESIVQGFKKCHISSNLE-EEDDVLWE 585          

HSP 2 Score: 87.0409 bits (214), Expect = 5.640e-58
Identity = 36/88 (40.91%), Postives = 59/88 (67.05%), Query Frame = 2
Query:    2 PGSIFKASARWCQLFMKRNDISIRRRTSIAQRLPDDVENKLLDYQKYIINLRKRHEYPISCIGNGDQTPLSFDIPSFQTLDFKGVKSV 265
            P   FKAS  WC+  M+R D+S+R +  + Q LP+D+  KL+ YQ+ ++ LR+ H+Y ++ +GN D+TP+  ++PS  T+D +G K V
Sbjct:  299 PEKGFKASLGWCRRMMRRYDLSLRHKVPVPQHLPEDLTEKLVTYQRSVLALRRAHDYEVAQMGNADETPICLEVPSRVTVDNQGEKPV 386          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Match: POGZ (pogo transposable element derived with ZNF domain [Source:HGNC Symbol;Acc:HGNC:18801])

HSP 1 Score: 69.3218 bits (168), Expect = 4.427e-15
Identity = 34/129 (26.36%), Postives = 69/129 (53.49%), Query Frame = 1
Query:  262 CTVMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNE 648
            C V+L    DG  +P  ++F R  + +  + P  ++++A+E+G+ ++E+ + W   +W   +    + S+ +LV+D  R H    V  +L+ + T   ++P G + ++Q +DV   R  K  + K+W E
Sbjct: 1148 CDVVLAILADGTVLPT-LVFYRGQMDQPANMPDSILLEAKESGYSDDEIMELWSTRVW--QKHTACQRSKGMLVMDCHRTHLSEEVLAMLSASSTLPAVVPAGCSSKIQPLDVCIKRTVKNFLHKKWKE 1273          

HSP 2 Score: 33.113 bits (74), Expect = 4.427e-15
Identity = 21/79 (26.58%), Postives = 33/79 (41.77%), Query Frame = 2
Query:   14 FKASARWCQLFMKRNDISIRRRTSIAQRLPDDVENKLLDYQKYIINLRKRHEYPISCIGNGDQTPLSFDIPSFQTLDFK 250
            FK S  W   FM R+ ++   R ++A  LP DV      +  ++       + P+S I   D+  L  D     + D K
Sbjct: 1056 FKISYEWAVRFMLRHHLTPHARRAVAHTLPKDVAENAGLFIDFVQRQIHNQDLPLSMIVAIDEISLFLDTEVLSSDDRK 1134          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Match: POGZ (pogo transposable element derived with ZNF domain [Source:HGNC Symbol;Acc:HGNC:18801])

HSP 1 Score: 69.3218 bits (168), Expect = 4.540e-15
Identity = 34/129 (26.36%), Postives = 69/129 (53.49%), Query Frame = 1
Query:  262 CTVMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNE 648
            C V+L    DG  +P  ++F R  + +  + P  ++++A+E+G+ ++E+ + W   +W   +    + S+ +LV+D  R H    V  +L+ + T   ++P G + ++Q +DV   R  K  + K+W E
Sbjct: 1113 CDVVLAILADGTVLPT-LVFYRGQMDQPANMPDSILLEAKESGYSDDEIMELWSTRVW--QKHTACQRSKGMLVMDCHRTHLSEEVLAMLSASSTLPAVVPAGCSSKIQPLDVCIKRTVKNFLHKKWKE 1238          

HSP 2 Score: 33.113 bits (74), Expect = 4.540e-15
Identity = 21/79 (26.58%), Postives = 33/79 (41.77%), Query Frame = 2
Query:   14 FKASARWCQLFMKRNDISIRRRTSIAQRLPDDVENKLLDYQKYIINLRKRHEYPISCIGNGDQTPLSFDIPSFQTLDFK 250
            FK S  W   FM R+ ++   R ++A  LP DV      +  ++       + P+S I   D+  L  D     + D K
Sbjct: 1021 FKISYEWAVRFMLRHHLTPHARRAVAHTLPKDVAENAGLFIDFVQRQIHNQDLPLSMIVAIDEISLFLDTEVLSSDDRK 1099          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Match: POGZ (pogo transposable element derived with ZNF domain [Source:HGNC Symbol;Acc:HGNC:18801])

HSP 1 Score: 69.3218 bits (168), Expect = 4.540e-15
Identity = 34/129 (26.36%), Postives = 69/129 (53.49%), Query Frame = 1
Query:  262 CTVMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNE 648
            C V+L    DG  +P  ++F R  + +  + P  ++++A+E+G+ ++E+ + W   +W   +    + S+ +LV+D  R H    V  +L+ + T   ++P G + ++Q +DV   R  K  + K+W E
Sbjct: 1104 CDVVLAILADGTVLPT-LVFYRGQMDQPANMPDSILLEAKESGYSDDEIMELWSTRVW--QKHTACQRSKGMLVMDCHRTHLSEEVLAMLSASSTLPAVVPAGCSSKIQPLDVCIKRTVKNFLHKKWKE 1229          

HSP 2 Score: 33.113 bits (74), Expect = 4.540e-15
Identity = 21/79 (26.58%), Postives = 33/79 (41.77%), Query Frame = 2
Query:   14 FKASARWCQLFMKRNDISIRRRTSIAQRLPDDVENKLLDYQKYIINLRKRHEYPISCIGNGDQTPLSFDIPSFQTLDFK 250
            FK S  W   FM R+ ++   R ++A  LP DV      +  ++       + P+S I   D+  L  D     + D K
Sbjct: 1012 FKISYEWAVRFMLRHHLTPHARRAVAHTLPKDVAENAGLFIDFVQRQIHNQDLPLSMIVAIDEISLFLDTEVLSSDDRK 1090          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Zebrafish
Match: CR352209.1 (pep chromosome:GRCz11:24:26088143:26089609:1 gene:ENSDARG00000103972.2 transcript:ENSDART00000171129.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR352209.1)

HSP 1 Score: 161.77 bits (408), Expect = 1.404e-42
Identity = 77/199 (38.69%), Postives = 121/199 (60.80%), Query Frame = 1
Query:  229 ISDIGFQRSQVCTVMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNEWFFSGAPSFTASGNRRKVGLETICKWIQLSWDAVSEAIIIKGFKKC-CLSNAMDGSEDD 822
            I   G ++S   TV+LG +GDG+K+PP VIFKRK+LPK   +PAG+I+KA + GWM+EE   +W++ ++       F  S  LL+ D+ R H +  VK  + +  ++L +IPGG+T +LQ +D+  NR FK ++R  W +W   G  +FT +G +R+    TIC+WI  +W  VS   +++ F K   ++    G+E D
Sbjct:  194 IRTTGHEKS-AFTVVLGCHGDGQKLPPMVIFKRKTLPKE-KFPAGIIIKANQKGWMDEEKMNEWLREVYVKRPDGFFHTSPSLLICDSMRAHLIATVKNQVKQMNSELAVIPGGLTKELQPLDIGVNRAFKVKLRAAWEQWMTDGEHTFTKTGRQRRASYATICEWIVDAWAKVSALTVVRAFAKAGIIAEQPPGNETD 390          

HSP 2 Score: 66.6254 bits (161), Expect = 7.188e-11
Identity = 34/86 (39.53%), Postives = 49/86 (56.98%), Query Frame = 2
Query:   14 FKASARWCQLFMKRNDISIRRRTSIAQRLPDDVENKLLDYQKYIINLRKRHEYPISCIGNGDQTPLSFDIPSFQTLDFKGVKSVQL 271
            F+    WC  FMKR  +SIR RT++AQ+LP D + KL  ++ Y  N     +     I N D+ PL+FDIP   T++ KG  +V +
Sbjct:  109 FQGGPSWCFRFMKRRHLSIRARTTVAQQLPADYKEKLDIFRTYCSNKITDKKIQPKHITNMDEVPLTFDIPVNHTVEKKGASTVSI 194          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Zebrafish
Match: BX914205.2 (pep chromosome:GRCz11:4:64121772:64123545:-1 gene:ENSDARG00000099590.2 transcript:ENSDART00000170040.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX914205.2)

HSP 1 Score: 160.999 bits (406), Expect = 2.549e-42
Identity = 77/199 (38.69%), Postives = 120/199 (60.30%), Query Frame = 1
Query:  229 ISDIGFQRSQVCTVMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNEWFFSGAPSFTASGNRRKVGLETICKWIQLSWDAVSEAIIIKGFKKC-CLSNAMDGSEDD 822
            I   G ++S   TV+LG +GDG+K+PP VIFKRK+LPK   +PAG+I+KA + GWM+EE   +W++ ++       F  S  LL+ D+ R H    VK  + +  ++L +IPGG+T +LQ +D+  NR FK ++R  W +W   G  +FT +G +R+    TIC+WI  +W  VS   +++ F K   ++    G+E D
Sbjct:  194 IRTTGHEKS-AFTVVLGCHGDGQKLPPMVIFKRKTLPKE-KFPAGVIIKANQKGWMDEEKMNEWLREVYVKRPDGFFHTSPSLLICDSMRAHLTATVKNQVKQMNSELAVIPGGLTKELQPLDIGVNRAFKVKLRAAWEQWMTDGEHTFTKTGRQRRASYATICEWIVDAWAKVSALTVVRAFAKAGIIAEQPPGNETD 390          

HSP 2 Score: 66.6254 bits (161), Expect = 6.916e-11
Identity = 34/86 (39.53%), Postives = 49/86 (56.98%), Query Frame = 2
Query:   14 FKASARWCQLFMKRNDISIRRRTSIAQRLPDDVENKLLDYQKYIINLRKRHEYPISCIGNGDQTPLSFDIPSFQTLDFKGVKSVQL 271
            F+    WC  FMKR  +SIR RT++AQ+LP D + KL  ++ Y  N     +     I N D+ PL+FDIP   T++ KG  +V +
Sbjct:  109 FQGGPSWCFRFMKRRHLSIRARTTVAQQLPADYKEKLDIFRTYCSNKITDKKIQPKHITNMDEVPLTFDIPVNHTVEKKGASTVSI 194          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Zebrafish
Match: CR354398.1 (pep chromosome:GRCz11:7:64150332:64152087:-1 gene:ENSDARG00000101994.2 transcript:ENSDART00000165234.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR354398.1)

HSP 1 Score: 160.999 bits (406), Expect = 4.156e-42
Identity = 77/199 (38.69%), Postives = 120/199 (60.30%), Query Frame = 1
Query:  229 ISDIGFQRSQVCTVMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNEWFFSGAPSFTASGNRRKVGLETICKWIQLSWDAVSEAIIIKGFKKC-CLSNAMDGSEDD 822
            I   G ++S   TV+LG +GDG+K+PP VIFKRK+LPK   +PAG+I+KA + GWM+EE   +W++ ++       F  S  LL+ D+ R H    VK  + +  ++L +IPGG+T +LQ +D+  NR FK ++R  W +W   G  +FT +G +R+    TIC+WI  +W  VS   +++ F K   ++    G+E D
Sbjct:  194 IRTTGHEKS-AFTVVLGCHGDGQKLPPMVIFKRKTLPKE-KFPAGVIIKANQKGWMDEEKMNEWLREVYVKRPDGFFHTSPSLLICDSMRAHLTATVKNQVKQMNSELAVIPGGLTKELQPLDIGVNRAFKVKLRAAWEQWMTDGEHTFTKTGRQRRASYATICEWIVDAWAKVSALTVVRAFAKAGIIAEQPPGNETD 390          

HSP 2 Score: 66.2402 bits (160), Expect = 8.382e-11
Identity = 34/86 (39.53%), Postives = 49/86 (56.98%), Query Frame = 2
Query:   14 FKASARWCQLFMKRNDISIRRRTSIAQRLPDDVENKLLDYQKYIINLRKRHEYPISCIGNGDQTPLSFDIPSFQTLDFKGVKSVQL 271
            F+    WC  FMKR  +SIR RT++AQ+LP D + KL  ++ Y  N     +     I N D+ PL+FDIP   T++ KG  +V +
Sbjct:  109 FQGGPSWCFRFMKRRHLSIRARTTVAQQLPADYKEKLDIFRTYCSNKITDKKIQPKHITNMDEVPLTFDIPVNHTVEKKGASTVSI 194          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Xenopus
Match: celf3 (CUGBP, Elav-like family member 3 [Source:Xenbase;Acc:XB-GENE-5796618])

HSP 1 Score: 66.6254 bits (161), Expect = 2.452e-10
Identity = 36/129 (27.91%), Postives = 67/129 (51.94%), Query Frame = 1
Query:  262 CTVMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNE 648
            C V++    DG  +P  ++F R S    +  P  +I++A+E+G+ ++E+ + W   +W   +  E  N++ + V+D  R H    V  I++   T   I+P G + ++Q +DV   R  K  + K+W E
Sbjct: 1120 CDVVVTILADGSLLPT-LVFTRSSSSGEV--PESIILEAREDGYTDDEIVELWSSRVW--QKHAECPNNKGMAVVDCHRTHLSEEVLSIMSSTCTLPAIVPSGCSSKIQPLDVCIKRAVKNFLHKKWRE 1243          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Xenopus
Match: celf3 (CUGBP, Elav-like family member 3 [Source:Xenbase;Acc:XB-GENE-5796618])

HSP 1 Score: 66.6254 bits (161), Expect = 2.520e-10
Identity = 36/129 (27.91%), Postives = 67/129 (51.94%), Query Frame = 1
Query:  262 CTVMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNE 648
            C V++    DG  +P  ++F R S    +  P  +I++A+E+G+ ++E+ + W   +W   +  E  N++ + V+D  R H    V  I++   T   I+P G + ++Q +DV   R  K  + K+W E
Sbjct: 1086 CDVVVTILADGSLLPT-LVFTRSSSSGEV--PESIILEAREDGYTDDEIVELWSSRVW--QKHAECPNNKGMAVVDCHRTHLSEEVLSIMSSTCTLPAIVPSGCSSKIQPLDVCIKRAVKNFLHKKWRE 1209          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Match: Pogk (pogo transposable element with KRAB domain [Source:MGI Symbol;Acc:MGI:1918842])

HSP 1 Score: 160.614 bits (405), Expect = 4.320e-57
Identity = 70/190 (36.84%), Postives = 117/190 (61.58%), Query Frame = 1
Query:  265 TVMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNEWFFSGAPSFTASGNRRKVGLETICKWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQ 834
            T MLG   DG+K+PPY+I +   +P    +P+GM ++    GWM E+L +DW++ +W   R       R +L+L+ FRCH    VK  +    TD+VIIPGG+T QLQV+DVV  +P    +R +++ W  +G  + + +GN +K  L    +WI ++W+++S   I++GF+KC +S+ ++  E D++W+
Sbjct:  418 TAMLGVLADGRKLPPYIILRGTYIPPG-KFPSGMEIRCHRYGWMTEDLMQDWLEVVW-RRRTGAVPRQRGMLILNGFRCHATDSVKSSMENMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAKKPPLGLFLEWIMVAWNSISSESIVQGFRKCHISSNLE-DEGDVLWE 604          

HSP 2 Score: 82.8037 bits (203), Expect = 4.320e-57
Identity = 34/88 (38.64%), Postives = 58/88 (65.91%), Query Frame = 2
Query:    2 PGSIFKASARWCQLFMKRNDISIRRRTSIAQRLPDDVENKLLDYQKYIINLRKRHEYPISCIGNGDQTPLSFDIPSFQTLDFKGVKSV 265
            P   FKAS  WC+  M+R D+S+R +  + Q L +D+  KL+ YQ+ ++ LR+ H+Y ++ +GN D+TP+  ++PS  T+D +G K +
Sbjct:  318 PEKGFKASLGWCRRMMRRYDLSLRHKVPVPQHLAEDLTEKLVTYQQSVLALRRTHDYEVAQMGNADETPICLEVPSRVTVDNQGEKPI 405          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Match: Pogk (pogo transposable element with KRAB domain [Source:MGI Symbol;Acc:MGI:1918842])

HSP 1 Score: 160.614 bits (405), Expect = 4.320e-57
Identity = 70/190 (36.84%), Postives = 117/190 (61.58%), Query Frame = 1
Query:  265 TVMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNEWFFSGAPSFTASGNRRKVGLETICKWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQ 834
            T MLG   DG+K+PPY+I +   +P    +P+GM ++    GWM E+L +DW++ +W   R       R +L+L+ FRCH    VK  +    TD+VIIPGG+T QLQV+DVV  +P    +R +++ W  +G  + + +GN +K  L    +WI ++W+++S   I++GF+KC +S+ ++  E D++W+
Sbjct:  418 TAMLGVLADGRKLPPYIILRGTYIPPG-KFPSGMEIRCHRYGWMTEDLMQDWLEVVW-RRRTGAVPRQRGMLILNGFRCHATDSVKSSMENMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAKKPPLGLFLEWIMVAWNSISSESIVQGFRKCHISSNLE-DEGDVLWE 604          

HSP 2 Score: 82.8037 bits (203), Expect = 4.320e-57
Identity = 34/88 (38.64%), Postives = 58/88 (65.91%), Query Frame = 2
Query:    2 PGSIFKASARWCQLFMKRNDISIRRRTSIAQRLPDDVENKLLDYQKYIINLRKRHEYPISCIGNGDQTPLSFDIPSFQTLDFKGVKSV 265
            P   FKAS  WC+  M+R D+S+R +  + Q L +D+  KL+ YQ+ ++ LR+ H+Y ++ +GN D+TP+  ++PS  T+D +G K +
Sbjct:  318 PEKGFKASLGWCRRMMRRYDLSLRHKVPVPQHLAEDLTEKLVTYQQSVLALRRTHDYEVAQMGNADETPICLEVPSRVTVDNQGEKPI 405          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Match: Pogk (pogo transposable element with KRAB domain [Source:MGI Symbol;Acc:MGI:1918842])

HSP 1 Score: 160.229 bits (404), Expect = 4.772e-57
Identity = 70/190 (36.84%), Postives = 117/190 (61.58%), Query Frame = 1
Query:  265 TVMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNEWFFSGAPSFTASGNRRKVGLETICKWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQ 834
            T MLG   DG+K+PPY+I +   +P    +P+GM ++    GWM E+L +DW++ +W   R       R +L+L+ FRCH    VK  +    TD+VIIPGG+T QLQV+DVV  +P    +R +++ W  +G  + + +GN +K  L    +WI ++W+++S   I++GF+KC +S+ ++  E D++W+
Sbjct:  406 TAMLGVLADGRKLPPYIILRGTYIPPG-KFPSGMEIRCHRYGWMTEDLMQDWLEVVW-RRRTGAVPRQRGMLILNGFRCHATDSVKSSMENMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAKKPPLGLFLEWIMVAWNSISSESIVQGFRKCHISSNLE-DEGDVLWE 592          

HSP 2 Score: 82.8037 bits (203), Expect = 4.772e-57
Identity = 34/88 (38.64%), Postives = 58/88 (65.91%), Query Frame = 2
Query:    2 PGSIFKASARWCQLFMKRNDISIRRRTSIAQRLPDDVENKLLDYQKYIINLRKRHEYPISCIGNGDQTPLSFDIPSFQTLDFKGVKSV 265
            P   FKAS  WC+  M+R D+S+R +  + Q L +D+  KL+ YQ+ ++ LR+ H+Y ++ +GN D+TP+  ++PS  T+D +G K +
Sbjct:  306 PEKGFKASLGWCRRMMRRYDLSLRHKVPVPQHLAEDLTEKLVTYQQSVLALRRTHDYEVAQMGNADETPICLEVPSRVTVDNQGEKPI 393          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Match: Pogk (pogo transposable element with KRAB domain [Source:MGI Symbol;Acc:MGI:1918842])

HSP 1 Score: 160.229 bits (404), Expect = 4.772e-57
Identity = 70/190 (36.84%), Postives = 117/190 (61.58%), Query Frame = 1
Query:  265 TVMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNEWFFSGAPSFTASGNRRKVGLETICKWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQ 834
            T MLG   DG+K+PPY+I +   +P    +P+GM ++    GWM E+L +DW++ +W   R       R +L+L+ FRCH    VK  +    TD+VIIPGG+T QLQV+DVV  +P    +R +++ W  +G  + + +GN +K  L    +WI ++W+++S   I++GF+KC +S+ ++  E D++W+
Sbjct:  406 TAMLGVLADGRKLPPYIILRGTYIPPG-KFPSGMEIRCHRYGWMTEDLMQDWLEVVW-RRRTGAVPRQRGMLILNGFRCHATDSVKSSMENMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAKKPPLGLFLEWIMVAWNSISSESIVQGFRKCHISSNLE-DEGDVLWE 592          

HSP 2 Score: 82.8037 bits (203), Expect = 4.772e-57
Identity = 34/88 (38.64%), Postives = 58/88 (65.91%), Query Frame = 2
Query:    2 PGSIFKASARWCQLFMKRNDISIRRRTSIAQRLPDDVENKLLDYQKYIINLRKRHEYPISCIGNGDQTPLSFDIPSFQTLDFKGVKSV 265
            P   FKAS  WC+  M+R D+S+R +  + Q L +D+  KL+ YQ+ ++ LR+ H+Y ++ +GN D+TP+  ++PS  T+D +G K +
Sbjct:  306 PEKGFKASLGWCRRMMRRYDLSLRHKVPVPQHLAEDLTEKLVTYQQSVLALRRTHDYEVAQMGNADETPICLEVPSRVTVDNQGEKPI 393          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Match: Pogz (pogo transposable element with ZNF domain [Source:MGI Symbol;Acc:MGI:2442117])

HSP 1 Score: 67.0106 bits (162), Expect = 1.153e-10
Identity = 34/129 (26.36%), Postives = 68/129 (52.71%), Query Frame = 1
Query:  262 CTVMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNE 648
            C V+L    DG  +P  V F R    +  + P  ++++A+++G+ ++E+ + W   +W   +    ++S+ +LV+D  R H    V  +L+ + T   ++P G + ++Q +DV   R  K  + K+W E
Sbjct: 1058 CDVVLAILADGTVLPTLVFF-RGQANRFANVPDSILLEAKDSGYSDDEIMELWSTRVW--KKHTACQHSKSMLVMDCHRTHLSEEVLALLSASSTLPAVVPAGCSSKIQPLDVCIKRTVKNFLHKKWKE 1183          
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9P215|POGK_HUMAN (Pogo transposable element with KRAB domain OS=Homo sapiens OX=9606 GN=POGK PE=1 SV=2)

HSP 1 Score: 159.844 bits (403), Expect = 2.506e-57
Identity = 70/190 (36.84%), Postives = 117/190 (61.58%), Query Frame = 1
Query:  265 TVMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNEWFFSGAPSFTASGNRRKVGLETICKWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQ 834
            T MLG   DG+K+PPY+I +   +P    +P+GM ++    GWM E+L +DW++ +W   R       R +L+L+ FR H    VK  +    TD+VIIPGG+T QLQV+DVV  +P    +R +++ W  +G  + + +GN +K  L    +W+ ++W+++S   I++GFKKC +S+ ++  EDD++W+
Sbjct:  399 TAMLGVLADGRKLPPYIILRGTYIPPG-KFPSGMEIRCHRYGWMTEDLMQDWLEVVW-RRRTGAVPKQRGMLILNGFRGHATDSVKNSMESMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAKKPPLGLFLEWVMVAWNSISSESIVQGFKKCHISSNLE-EEDDVLWE 585          

HSP 2 Score: 87.0409 bits (214), Expect = 2.506e-57
Identity = 36/88 (40.91%), Postives = 59/88 (67.05%), Query Frame = 2
Query:    2 PGSIFKASARWCQLFMKRNDISIRRRTSIAQRLPDDVENKLLDYQKYIINLRKRHEYPISCIGNGDQTPLSFDIPSFQTLDFKGVKSV 265
            P   FKAS  WC+  M+R D+S+R +  + Q LP+D+  KL+ YQ+ ++ LR+ H+Y ++ +GN D+TP+  ++PS  T+D +G K V
Sbjct:  299 PEKGFKASLGWCRRMMRRYDLSLRHKVPVPQHLPEDLTEKLVTYQRSVLALRRAHDYEVAQMGNADETPICLEVPSRVTVDNQGEKPV 386          
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q80TC5|POGK_MOUSE (Pogo transposable element with KRAB domain OS=Mus musculus OX=10090 GN=Pogk PE=2 SV=2)

HSP 1 Score: 160.229 bits (404), Expect = 2.749e-56
Identity = 70/190 (36.84%), Postives = 117/190 (61.58%), Query Frame = 1
Query:  265 TVMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNEWFFSGAPSFTASGNRRKVGLETICKWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQ 834
            T MLG   DG+K+PPY+I +   +P    +P+GM ++    GWM E+L +DW++ +W   R       R +L+L+ FRCH    VK  +    TD+VIIPGG+T QLQV+DVV  +P    +R +++ W  +G  + + +GN +K  L    +WI ++W+++S   I++GF+KC +S+ ++  E D++W+
Sbjct:  399 TAMLGVLADGRKLPPYIILRGTYIPPG-KFPSGMEIRCHRYGWMTEDLMQDWLEVVW-RRRTGAVPRQRGMLILNGFRCHATDSVKSSMENMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAKKPPLGLFLEWIMVAWNSISSESIVQGFRKCHISSNLE-DEGDVLWE 585          

HSP 2 Score: 82.8037 bits (203), Expect = 2.749e-56
Identity = 34/88 (38.64%), Postives = 58/88 (65.91%), Query Frame = 2
Query:    2 PGSIFKASARWCQLFMKRNDISIRRRTSIAQRLPDDVENKLLDYQKYIINLRKRHEYPISCIGNGDQTPLSFDIPSFQTLDFKGVKSV 265
            P   FKAS  WC+  M+R D+S+R +  + Q L +D+  KL+ YQ+ ++ LR+ H+Y ++ +GN D+TP+  ++PS  T+D +G K +
Sbjct:  299 PEKGFKASLGWCRRMMRRYDLSLRHKVPVPQHLAEDLTEKLVTYQQSVLALRRTHDYEVAQMGNADETPICLEVPSRVTVDNQGEKPI 386          
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7Z3K3|POGZ_HUMAN (Pogo transposable element with ZNF domain OS=Homo sapiens OX=9606 GN=POGZ PE=1 SV=2)

HSP 1 Score: 69.3218 bits (168), Expect = 2.049e-14
Identity = 34/129 (26.36%), Postives = 69/129 (53.49%), Query Frame = 1
Query:  262 CTVMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNE 648
            C V+L    DG  +P  ++F R  + +  + P  ++++A+E+G+ ++E+ + W   +W   +    + S+ +LV+D  R H    V  +L+ + T   ++P G + ++Q +DV   R  K  + K+W E
Sbjct: 1157 CDVVLAILADGTVLPT-LVFYRGQMDQPANMPDSILLEAKESGYSDDEIMELWSTRVW--QKHTACQRSKGMLVMDCHRTHLSEEVLAMLSASSTLPAVVPAGCSSKIQPLDVCIKRTVKNFLHKKWKE 1282          

HSP 2 Score: 33.113 bits (74), Expect = 2.049e-14
Identity = 21/79 (26.58%), Postives = 33/79 (41.77%), Query Frame = 2
Query:   14 FKASARWCQLFMKRNDISIRRRTSIAQRLPDDVENKLLDYQKYIINLRKRHEYPISCIGNGDQTPLSFDIPSFQTLDFK 250
            FK S  W   FM R+ ++   R ++A  LP DV      +  ++       + P+S I   D+  L  D     + D K
Sbjct: 1065 FKISYEWAVRFMLRHHLTPHARRAVAHTLPKDVAENAGLFIDFVQRQIHNQDLPLSMIVAIDEISLFLDTEVLSSDDRK 1143          
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BZH4|POGZ_MOUSE (Pogo transposable element with ZNF domain OS=Mus musculus OX=10090 GN=Pogz PE=1 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 8.206e-10
Identity = 34/129 (26.36%), Postives = 68/129 (52.71%), Query Frame = 1
Query:  262 CTVMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNE 648
            C V+L    DG  +P  V F R    +  + P  ++++A+++G+ ++E+ + W   +W   +    ++S+ +LV+D  R H    V  +L+ + T   ++P G + ++Q +DV   R  K  + K+W E
Sbjct: 1153 CDVVLAILADGTVLPTLVFF-RGQANRFANVPDSILLEAKDSGYSDDEIMELWSTRVW--KKHTACQHSKSMLVMDCHRTHLSEEVLALLSASSTLPAVVPAGCSSKIQPLDVCIKRTVKNFLHKKWKE 1278          
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Match: A0A3P8SR85 (HTH CENPB-type domain-containing protein OS=Amphiprion percula OX=161767 PE=4 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 2.300e-76
Identity = 104/199 (52.26%), Postives = 137/199 (68.84%), Query Frame = 1
Query:  241 GFQRSQVCTVMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNEWFFSGAPSFTASGNRRKVGLETICKWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQD 837
            G ++S+V TVML    DG K+PPYV+ KRK++PK    PAG+IV+AQE GWM  EL  DW+K +W   R    R  R +L+LDAFR H    VK+ +     DLVIIPGGMT QLQV+DVV N+PFK  +RK++ EW  SG  + T +G  +K  +  +C+WI  +WDAVS   II GFKKCC+SNA+DGSEDD++W++
Sbjct:  228 GNEKSRV-TVMLACLADGTKLPPYVVLKRKTVPKEA-MPAGIIVRAQEKGWMETELVVDWLKVVWGRRRGGL-RKKRNMLILDAFRGHLSDPVKKQVKAMNGDLVIIPGGMTSQLQVLDVVVNKPFKDNLRKKYTEWLLSGDHALTPTGKIQKPSVRLLCEWILHAWDAVSPKSIIHGFKKCCISNALDGSEDDVLWEE 423          

HSP 2 Score: 110.153 bits (274), Expect = 2.300e-76
Identity = 50/88 (56.82%), Postives = 66/88 (75.00%), Query Frame = 2
Query:    2 PGSIFKASARWCQLFMKRNDISIRRRTSIAQRLPDDVENKLLDYQKYIINLRKRHEYPISCIGNGDQTPLSFDIPSFQTLDFKGVKSV 265
            P + FKAS  WC+  M+RN +++RRRTS+AQRLP D   KLL +Q+Y+INLRK+H YP+  IGN DQTP+ FD+P+  T+  KG KSV
Sbjct:  135 PTADFKASLGWCKRTMRRNGLTLRRRTSLAQRLPSDFGEKLLSFQRYVINLRKKHSYPLDQIGNADQTPVFFDMPTPVTVHKKGEKSV 222          
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Match: W4YGY2 (HTH CENPB-type domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 2.290e-72
Identity = 91/190 (47.89%), Postives = 126/190 (66.32%), Query Frame = 1
Query:  265 TVMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNEWFFSGAPSFTASGNRRKVGLETICKWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQ 834
            TVML    DG K+PPY++FKRK++PK + +P G+IV+ Q  GW +EE+TKDW++T+W   R       R LLVLDAFRCH+    K +L  + TD+ IIPGGMT  LQ +DV  N+PFK  +++RW  W   G  + T SG  RKV L TIC+WI   WD++   ++ + F K  +SN +DG+EDD+IW+
Sbjct:  203 TVMLCCTADGGKLPPYIVFKRKTMPK-VTFPKGVIVRVQAKGWFDEEITKDWVRTVWAR-RDGGISRKRSLLVLDAFRCHKSEPTKNVLRHHNTDIAIIPGGMTSLLQPLDVSINKPFKSGLQQRWTSWMMEGEKTHTKSGRTRKVDLPTICQWIADVWDSIPTEMVRRSFLKTSISNNLDGTEDDLIWE 390          

HSP 2 Score: 103.99 bits (258), Expect = 2.290e-72
Identity = 45/86 (52.33%), Postives = 65/86 (75.58%), Query Frame = 2
Query:   14 FKASARWCQLFMKRNDISIRRRTSIAQRLPDDVENKLLDYQKYIINLRKRHEYPISCIGNGDQTPLSFDIPSFQTLDFKGVKSVQL 271
            F +S  W   FM R+D+SIRRRT IAQ+LPDD++ K+ ++Q++II  R+ H+YP+S IGN DQTPL+FD+P  +T+  KG K+V +
Sbjct:  107 FPSSRMWAHRFMSRHDLSIRRRTHIAQKLPDDLDEKITNFQRFIIRQRREHQYPLSRIGNADQTPLTFDLPRARTVSKKGEKTVTV 192          
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Match: A0A3P8S5C8 (HTH CENPB-type domain-containing protein OS=Amphiprion percula OX=161767 PE=4 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 1.850e-71
Identity = 97/184 (52.72%), Postives = 127/184 (69.02%), Query Frame = 1
Query:  286 GDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNEWFFSGAPSFTASGNRRKVGLETICKWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQD 837
             DG K+PPYV+ KRK++PK    PAG+IV+AQE GWM  EL  DW+K +W   R    R  R +L+LDAFR H    VK+ +     DLVIIPGGMT QLQV+DVV N+PFK  +RK++ EW  SG  + T +G  +K  +  +C+WI  +WDAVS   II GFKKCC+SNA+DGSEDD++W++
Sbjct:  337 ADGTKLPPYVVLKRKTVPKEA-MPAGIIVRAQEKGWMETELVVDWLKVVWGRRRGGL-RKKRNMLILDAFRGHLSDPVKKQVKAMNGDLVIIPGGMTSQLQVLDVVVNKPFKDNLRKKYTEWLLSGDHALTPTGEIQKPSVRLLCEWILHAWDAVSPKSIIHGFKKCCISNALDGSEDDVLWEE 518          

HSP 2 Score: 101.293 bits (251), Expect = 1.850e-71
Identity = 45/84 (53.57%), Postives = 61/84 (72.62%), Query Frame = 2
Query:    2 PGSIFKASARWCQLFMKRNDISIRRRTSIAQRLPDDVENKLLDYQKYIINLRKRHEYPISCIGNGDQTPLSFDIPSFQTLDFKG 253
            P + FKAS  WC+  M+RN +++RRRTS+AQRLP D   KLL +Q+Y+INLRK+H YP+  IGN DQT + FD+P+  T+  K 
Sbjct:  251 PTADFKASLGWCKRMMRRNGLTLRRRTSLAQRLPSDFGEKLLSFQRYVINLRKKHSYPLDQIGNADQTSVFFDMPTPVTVHKKA 334          
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Match: A0A3Q3KXW9 (HTH CENPB-type domain-containing protein OS=Labrus bergylta OX=56723 PE=4 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 2.462e-69
Identity = 97/195 (49.74%), Postives = 125/195 (64.10%), Query Frame = 1
Query:  265 TVMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNEWFFSGAPSFTASGNRRKVGLETICKWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQDDISD 849
            TVML    DG K+PPYVI  ++ +P      AG+IV+AQE GWM   L  DW+K +W   R    R  R +LVLDAFR H    VK  +     DLVIIPGG+T QLQV+D V N+PFK  +RKR+ EW  SG  + T +   +K+ +  +C+WI  +WDAVS   II GFKKCC+SNA+DGSEDD +W++  SD
Sbjct:  190 TVMLTCLADGNKLPPYVIVPKEPMP------AGIIVRAQEKGWMETGLVVDWLKVVW-GGRYGGLRKKRYMLVLDAFRGHLTEPVKSQVRAMNGDLVIIPGGVTSQLQVLDAVVNKPFKDNLRKRYTEWLLSGNHALTRTWKIQKLSVRLLCEWILQAWDAVSSQSIIHGFKKCCISNALDGSEDDALWEEQGSD 377          

HSP 2 Score: 97.8265 bits (242), Expect = 2.462e-69
Identity = 42/74 (56.76%), Postives = 57/74 (77.03%), Query Frame = 2
Query:    8 SIFKASARWCQLFMKRNDISIRRRTSIAQRLPDDVENKLLDYQKYIINLRKRHEYPISCIGNGDQTPLSFDIPS 229
            S FKAS  WC+  M+RN +++RRRTS+AQ LP D   KLL +Q+++INLRK+H YP+  IGN DQTP+ FD+P+
Sbjct:  113 SEFKASLGWCRRMMRRNGLALRRRTSLAQHLPLDFGEKLLSFQRFVINLRKKHSYPLDQIGNADQTPVYFDMPT 186          
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Match: A0A2R5LGC0 (Putative tigger transposase (Fragment) OS=Ornithodoros turicata OX=34597 PE=4 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 7.265e-68
Identity = 85/194 (43.81%), Postives = 124/194 (63.92%), Query Frame = 1
Query:  256 QVCTVMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNEWFFSGAPSFTASGNRRKVGLETICKWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQD 837
            Q  TVML    DGK++PPYV+F RK+LPKN  +PAGMIV+  + GWM  ++  +W++ +W   R     + R +LV+D+FR H     K +LA N +DLV+IPGGMT QLQ +DV  N+P K  +RK + EW   G    T +G  ++  L  + +W+  +W  V + I+++ FKKC +SNA+DGSED+ +W D
Sbjct:  220 QRITVMLACTADGKRLPPYVVFNRKTLPKNERFPAGMIVRCNDKGWMTADMFNEWLRLVWFR-RPGALLSPRSMLVVDSFRGHTTDTSKALLAANNSDLVVIPGGMTSQLQPLDVCINKPVKDRIRKAYMEWMAEGDHELTPTGRLKRAPLSLLAQWVMDAWRDVPDDIVVRAFKKCAISNALDGSEDEFLWGD 412          

HSP 2 Score: 98.5969 bits (244), Expect = 7.265e-68
Identity = 45/86 (52.33%), Postives = 60/86 (69.77%), Query Frame = 2
Query:   14 FKASARWCQLFMKRNDISIRRRTSIAQRLPDDVENKLLDYQKYIINLRKRHEYPISCIGNGDQTPLSFDIPSFQTLDFKGVKSVQL 271
            FKAS  W + FMKR   S+RRRTS+ QRLP D E KL+ +Q+Y+I LR++H Y +  IGN DQTP+ FD+P   T+D  G K V++
Sbjct:  127 FKASRGWAERFMKRAGFSLRRRTSVCQRLPADFEEKLVAFQRYVIKLRQQHGYVLGQIGNADQTPVYFDMPMSTTVDSVGAKEVKV 212          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Cavefish
Match: pogzb (pogo transposable element derived with ZNF domain b [Source:ZFIN;Acc:ZDB-GENE-100609-3])

HSP 1 Score: 55.4546 bits (132), Expect = 3.648e-7
Identity = 31/128 (24.22%), Postives = 61/128 (47.66%), Query Frame = 1
Query:  268 VMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNEW 651
            + L +  DG  +P ++  K     K++  P  ++++++  G+   E  + W   +W      +   S+ +L +D    H        ++  KT  VIIP G TGQLQ +++  N   K+ +  RW+++
Sbjct: 1045 IYLSSMADGTMLPTFLFLKGTPFSKSL--PDSLLLESRVYGFSENEELEIWNSRVWQQHLNSQ-NGSKTILAMDGHHSHMSEGFVSTMSGTKTLPVIIPPGCTGQLQPLEMCVNPVLKKFLLARWSQF 1169          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Cavefish
Match: pogzb (pogo transposable element derived with ZNF domain b [Source:ZFIN;Acc:ZDB-GENE-100609-3])

HSP 1 Score: 55.0694 bits (131), Expect = 5.442e-7
Identity = 31/128 (24.22%), Postives = 61/128 (47.66%), Query Frame = 1
Query:  268 VMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNEW 651
            + L +  DG  +P ++  K     K++  P  ++++++  G+   E  + W   +W      +   S+ +L +D    H        ++  KT  VIIP G TGQLQ +++  N   K+ +  RW+++
Sbjct: 1595 IYLSSMADGTMLPTFLFLKGTPFSKSL--PDSLLLESRVYGFSENEELEIWNSRVWQQHLNSQ-NGSKTILAMDGHHSHMSEGFVSTMSGTKTLPVIIPPGCTGQLQPLEMCVNPVLKKFLLARWSQF 1719          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Cavefish
Match: pogzb (pogo transposable element derived with ZNF domain b [Source:ZFIN;Acc:ZDB-GENE-100609-3])

HSP 1 Score: 55.0694 bits (131), Expect = 5.442e-7
Identity = 31/128 (24.22%), Postives = 61/128 (47.66%), Query Frame = 1
Query:  268 VMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNEW 651
            + L +  DG  +P ++  K     K++  P  ++++++  G+   E  + W   +W      +   S+ +L +D    H        ++  KT  VIIP G TGQLQ +++  N   K+ +  RW+++
Sbjct: 1595 IYLSSMADGTMLPTFLFLKGTPFSKSL--PDSLLLESRVYGFSENEELEIWNSRVWQQHLNSQ-NGSKTILAMDGHHSHMSEGFVSTMSGTKTLPVIIPPGCTGQLQPLEMCVNPVLKKFLLARWSQF 1719          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000030675.1 (zinc finger protein 37 [Source:NCBI gene;Acc:101161026])

HSP 1 Score: 98.2117 bits (243), Expect = 1.481e-28
Identity = 65/198 (32.83%), Postives = 96/198 (48.48%), Query Frame = 1
Query:  241 GFQRSQVCTVMLGAYGDGKKMPPYVIFK-RKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNEWFFSGA-PSFTASGNRRKVGLETICKWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDII 828
            G ++S   TV L A  +G K+ P ++F+  K     +       V    NGWMN+ELT+     +WC      F   + LLV DA  CH     KE L K    + +IP G T  +Q  D+   +PFK ++R+ + +W        +T+ GN +   L  +  WI  +W  +    I K FK C ++NA DGSED +I
Sbjct:  208 GHEKSHF-TVTLAAKANGAKLKPLIVFRDAKREVARLQDVQEAAVATSINGWMNQELTE-----MWCQKVCSGFGLRKSLLVWDADHCHISKETKEELKKYNVSMTVIPNGCTKYVQPADIW-GKPFKDKLRELYAKWMVGDEDKEWTSGGNLKAPALRLLVTWIISAWQDIPPETIRKSFKDCGITNACDGSEDHLI 398          

HSP 2 Score: 49.2914 bits (116), Expect = 1.481e-28
Identity = 28/84 (33.33%), Postives = 44/84 (52.38%), Query Frame = 2
Query:   11 IFKASARWCQLFMKRNDISIRRRTSIAQRLPDDVENKLLDYQKYIINLRKRHEYPISCIGNGDQTPLSFDIPSFQTLDFKGVKS 262
             F AS+ W   FMKR+ + +RR+T+ AQ+ PD V ++L+ +   + N R         I   D+T   FD+P   T +  G +S
Sbjct:  118 TFTASSGWLDKFMKRHQLLLRRKTAPAQKDPDQVVHRLVSFVTSVANKRTADGIEDGEIIAMDETSAWFDMPGPTTAEPAGSRS 201          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Medaka
Match: pogza (pogo transposable element derived with ZNF domain [Source:NCBI gene;Acc:101162766])

HSP 1 Score: 64.6994 bits (156), Expect = 4.658e-10
Identity = 32/142 (22.54%), Postives = 68/142 (47.89%), Query Frame = 1
Query:  241 GFQRSQVCTVMLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDWIKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGGMTGQLQVMDVVCNRPFKQEMRKRWNEWFFSGA 666
              Q   V  ++L    DG  +PP + +   +L     +P  +++++++ G+  EE    W++ +WC +   +++ +  +L++D  R H     +  L+  +T   +IP G   +LQ +DV   +  +  +  RWN+    G 
Sbjct: 1001 SHQEKPVIDIVLCGLSDGSFLPPMLFYTGAALHVPEGFPDNVLLESRQQGFTEEERLALWVQKVWCPNVASKYKQA-SILLMDVHRGHLSTEFQGNLSSCQTQTAVIPAGCCCRLQPLDVCVAQVLRDHLMARWNQLVAEGG 1141          
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000024543.1 (SMESG000024543.1)

HSP 1 Score: 169.474 bits (428), Expect = 1.644e-45
Identity = 93/100 (93.00%), Postives = 95/100 (95.00%), Query Frame = 1
Query:  667 PSFTASGNRRKVGLETICKWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQDDISDVGXXXXXXXXXXXXLMFGEVDESIEIENLMESEDENNGL 966
            PSFTASGNRRKVGLETICKWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQDDISDVG   ++ DDMENELMFGEVDESIEIENLME EDENNGL
Sbjct:   46 PSFTASGNRRKVGLETICKWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQDDISDVG---NEEDDMENELMFGEVDESIEIENLMEIEDENNGL 142          
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000002434.1 (SMESG000002434.1)

HSP 1 Score: 159.844 bits (403), Expect = 1.168e-41
Identity = 92/95 (96.84%), Postives = 93/95 (97.89%), Query Frame = 1
Query:  691 RRKVGLETICKWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQDDISDVGXXXXXXXXXXXXLMFGEVDESIEIENLMESEDENNGLCNE 975
            +RKV LETI KWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQDDISDVGNEEDDIDDMENELMFGEVDESIEIENLMESEDENNGLCNE
Sbjct:  358 KRKVDLETIYKWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQDDISDVGNEEDDIDDMENELMFGEVDESIEIENLMESEDENNGLCNE 452          
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000048378.1 (SMESG000048378.1)

HSP 1 Score: 155.606 bits (392), Expect = 4.828e-38
Identity = 94/123 (76.42%), Postives = 100/123 (81.30%), Query Frame = 1
Query:  625 EMRKRWNEWFFSGAPSFTASGNR------RKVGLETICKWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQDDISDVGXXXXXXXXXXXXLMFGEVDESIEIENLMESEDENNGLCNE 975
            E+ K + E F  G P       +      R +  +TICKWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQD+ISDVGNEEDDIDDMENELMFGEVDESIEIENLMESEDENNGLCNE
Sbjct: 1077 ELAKEYREKF-RGEPLTKCKQTKYVHKEFRNIYRKTICKWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQDNISDVGNEEDDIDDMENELMFGEVDESIEIENLMESEDENNGLCNE 1198          
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000048378.1 (SMESG000048378.1)

HSP 1 Score: 155.221 bits (391), Expect = 5.460e-38
Identity = 94/123 (76.42%), Postives = 100/123 (81.30%), Query Frame = 1
Query:  625 EMRKRWNEWFFSGAPSFTASGNR------RKVGLETICKWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQDDISDVGXXXXXXXXXXXXLMFGEVDESIEIENLMESEDENNGLCNE 975
            E+ K + E F  G P       +      R +  +TICKWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQD+ISDVGNEEDDIDDMENELMFGEVDESIEIENLMESEDENNGLCNE
Sbjct: 1058 ELAKEYREKF-RGEPLTKCKQTKYVHKEFRNIYRKTICKWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQDNISDVGNEEDDIDDMENELMFGEVDESIEIENLMESEDENNGLCNE 1179          
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000049778.1 (SMESG000049778.1)

HSP 1 Score: 125.561 bits (314), Expect = 2.298e-29
Identity = 75/78 (96.15%), Postives = 77/78 (98.72%), Query Frame = 1
Query:  742 DAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQDDISDVGXXXXXXXXXXXXLMFGEVDESIEIENLMESEDENNGLCNE 975
            +AVSEAIIIKGFKKCCLSNAMDGSEDD IWQDDISDVGNEEDDIDDMENELMFGEVDESIEIENLMESEDENNGLCN+
Sbjct:  542 NAVSEAIIIKGFKKCCLSNAMDGSEDDFIWQDDISDVGNEEDDIDDMENELMFGEVDESIEIENLMESEDENNGLCND 619          
The following BLAST results are available for this feature:
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POGK5.640e-5836.84pogo transposable element derived with KRAB domain... [more]
POGK5.640e-5836.84pogo transposable element derived with KRAB domain... [more]
POGZ4.427e-1526.36pogo transposable element derived with ZNF domain ... [more]
POGZ4.540e-1526.36pogo transposable element derived with ZNF domain ... [more]
POGZ4.540e-1526.36pogo transposable element derived with ZNF domain ... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CR352209.11.404e-4238.69pep chromosome:GRCz11:24:26088143:26089609:1 gene:... [more]
BX914205.22.549e-4238.69pep chromosome:GRCz11:4:64121772:64123545:-1 gene:... [more]
CR354398.14.156e-4238.69pep chromosome:GRCz11:7:64150332:64152087:-1 gene:... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
celf32.452e-1027.91CUGBP, Elav-like family member 3 [Source:Xenbase;A... [more]
celf32.520e-1027.91CUGBP, Elav-like family member 3 [Source:Xenbase;A... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pogk4.320e-5736.84pogo transposable element with KRAB domain [Source... [more]
Pogk4.320e-5736.84pogo transposable element with KRAB domain [Source... [more]
Pogk4.772e-5736.84pogo transposable element with KRAB domain [Source... [more]
Pogk4.772e-5736.84pogo transposable element with KRAB domain [Source... [more]
Pogz1.153e-1026.36pogo transposable element with ZNF domain [Source:... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q9P215|POGK_HUMAN2.506e-5736.84Pogo transposable element with KRAB domain OS=Homo... [more]
sp|Q80TC5|POGK_MOUSE2.749e-5636.84Pogo transposable element with KRAB domain OS=Mus ... [more]
sp|Q7Z3K3|POGZ_HUMAN2.049e-1426.36Pogo transposable element with ZNF domain OS=Homo ... [more]
sp|Q8BZH4|POGZ_MOUSE8.206e-1026.36Pogo transposable element with ZNF domain OS=Mus m... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P8SR852.300e-7652.26HTH CENPB-type domain-containing protein OS=Amphip... [more]
W4YGY22.290e-7247.89HTH CENPB-type domain-containing protein OS=Strong... [more]
A0A3P8S5C81.850e-7152.72HTH CENPB-type domain-containing protein OS=Amphip... [more]
A0A3Q3KXW92.462e-6949.74HTH CENPB-type domain-containing protein OS=Labrus... [more]
A0A2R5LGC07.265e-6843.81Putative tigger transposase (Fragment) OS=Ornithod... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pogzb3.648e-724.22pogo transposable element derived with ZNF domain ... [more]
pogzb5.442e-724.22pogo transposable element derived with ZNF domain ... [more]
pogzb5.442e-724.22pogo transposable element derived with ZNF domain ... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000030675.11.481e-2832.83zinc finger protein 37 [Source:NCBI gene;Acc:10116... [more]
pogza4.658e-1022.54pogo transposable element derived with ZNF domain ... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024543.11.644e-4593.00SMESG000024543.1[more]
SMESG000002434.11.168e-4196.84SMESG000002434.1[more]
SMESG000048378.14.828e-3876.42SMESG000048378.1[more]
SMESG000048378.15.460e-3876.42SMESG000048378.1[more]
SMESG000049778.12.298e-2996.15SMESG000049778.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001723 ID=SMED30001723|Name=HTH CENPB-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3119bp
TCCTGGTTCAATATTTAAAGCCTCAGCGCGCTGGTGCCAGCTTTTCATGA
AAAGGAATGATATTTCTATAAGAAGAAGGACTTCAATTGCACAGCGACTG
CCGGATGATGTAGAAAATAAGCTGCTCGACTATCAGAAATATATAATAAA
TTTAAGGAAAAGGCATGAATATCCAATTAGTTGCATAGGGAATGGGGATC
AGACCCCACTAAGTTTTGATATACCTTCATTTCAGACATTGGATTTCAAA
GGAGTCAAGTCTGTACAGTTATGTTGGGAGCTTATGGGGATGGCAAGAAG
ATGCCACCTTATGTAATTTTTAAAAGAAAGTCTTTACCAAAGAACATTCA
TTGGCCAGCTGGTATGATTGTTAAAGCACAAGAAAATGGATGGATGAATG
AGGAGTTGACTAAGGATTGGATTAAGACTATTTGGTGTAATGATAGAAAA
GATGAATTTCGAAATTCAAGGAGGTTACTGGTATTAGACGCATTTAGATG
CCACCGTATGCCATGCGTAAAGGAAATTTTGGCAAAAAACAAAACAGATC
TTGTGATTATTCCTGGAGGGATGACCGGGCAACTTCAAGTTATGGATGTA
GTTTGCAATAGGCCATTTAAGCAAGAGATGCGAAAGAGATGGAATGAGTG
GTTTTTTTCTGGTGCTCCATCATTTACTGCTTCTGGAAACAGAAGAAAGG
TTGGTTTAGAAACTATTTGCAAATGGATTCAACTATCATGGGATGCAGTT
AGTGAGGCAATTATTATCAAAGGGTTCAAGAAATGTTGTTTGAGTAATGC
TATGGATGGATCAGAAGACGATATTATTTGGCAGGACGATATATCTGATG
TAGGGAATGAGGAAGATGATATTGATGATATGGAAAATGAATTAATGTTT
GGAGAAGTGGACGAGTCCATTGAGATTGAGAATTTGATGGAAAGTGAAGA
TGAAAATAATGGTCTCTGTAATGAAAAAAACATTCTGTAACTAAAAATAA
ACATTTTGTATTAATTTATACTTTATTTCCTTTGCCCATACCGGTTTTTA
AGAAAATTGTCTGAGTAGGAAAAAATATTTCCTGTTATACGCACCACGAT
TATCATCCCCAAAAGTGATGAAAAAAAAGCGTTTGTTTACAATTTTGGCA
CTTAAATTGTAATGATGAAACGCAAATTACGATGATTATATCGTGTTATA
CTGCTTTCTATGTAAAGTCTAATTATAAAATATAAATGTCGCTAATCGTT
TTTTAAAGATCTAGCAACATAACTGTGTTAATTGTGATAGACAAAAATGA
CCGGAAAACCAAATCAACTCAACTCAATTGTAATACATGTATTTATCAAG
AACAAATACGTGATGTATATGGTTTCTATTTTTAGTCTTGATTTGTCATT
ACTCTTTCAACTGTCAAATCAGTACTCGGTAAACACATCGCTAATTTAAC
AAGTAATTTCAAATTTTTCATAGATATAAGCAAGGGTGCTTTCATAGGGT
TCGCGCGAACTAGCTATTAGTCAGAAAACATTTACTTTCAAAAGTTATTT
AGTGTAAATTTGTATATACAATTTAAAATTTTTATCTAGTTTTTATTGCG
ATTGGAATTTAAAATTTCCTAAAAATCTGCAAAATTTAAAAATTCCGTTA
ATTTGTTTTGGTTCTAAGTGATTGGTTATTTTGTCAAACATAGTTTTTAT
ATATTGTTGGGCAACAGTAGATGTAAAGTTATCCACAAAAATTATAGAAT
TTAATTTAAATTAAAAAAATTTTCCAGTTAATTTAAAGAAAATCGAATAT
CAGTAAAAGTTGAAACCATTTCTTTTGTCAGTTATTACTAATAACTTATT
GGTTGTTTTGTTTAGTTCAATTTAATACATTTGTTAATCATTTTGCTAAT
AAAATGGAAGATTTTTAAAATTGCTCAAGGTAAGTAACTTACCGTAAGTT
CAATTAACCAATTTTATGTTTTAGATAACATAATTTCTTTATCATCCCTA
TCTTAACTTTCGAAGATCAAAGACAAAATTCATTAACTACATATTACTAA
AAAAATTAAGAGAGGAAACATTAGTAATTGATGAAAGTAGGCCTTGATTG
TTCTATATTATTCACGAGTTAGTGTCCCCCTGCTAAATGATAATATTTCA
ATGGAAATATTAAAATTAAAAAATGTATTCACTGCCAAGCCCCTGATAAA
TTTTGGGAAAGCATTCCTGGATATGAGCATAAATATGGTCATGTTAAAAA
TACAGTACTTATTGAGTACATAGAAATTGGGCATTTCATCAAAAAGAAAT
ATAATATATATTAAAAACCATGCCCAAAAGCACAATATTAATCACATCAC
CTATTTTAATTTGCTGGTAATTTTTAACAATTTCGAAATATTTCTTCGTT
GAGAATCATCTTTCTTTTGTATTCGATATATTCTCTTTTACTGACATGTC
TCTGTCCTTTCCATTCTATGATTTTGCTTACTTTTCTTATTGAAATTTAA
TTACGATCTTACTGTTTATTTGAAAATAGAATACAATAAATGTCTTTAAA
CCTTATTTTTAATATTGTCCTTCAAATCTGACTCACACTACTCTATTGAC
CTGAAATATTATGATTGGTTACCTCCGTCTATAAATGAAATACATAAGGA
GTATATAGAAAATTGACAGTGCAGACCATTAAAAAGAATTACTGCTCTTC
GTAAAGTAGTTTGACTGATCACTTGAAATATAATCAATTTTTAGGCTCCT
AATTACATAGGTCGATTCCACTTAATGCGAGTACTGAGATGAGGGAGTAT
TAAAGGGTTAATTTCTGACACAGCGATTTAAGTTCTTATCAGTTCTTTTT
AGTTTAGTGCTTTTTTAGCAATCAACATTCAATTTCACTATTTTCACTTG
ACTAGATGACGCATCAAGCAAGGGCTGAAGTTGTAGCAATGAGAGCAGAT
CTTGTGCAGAAAAAAATCAACTTATCAATGGCGAGAAGTCAACATTTGTC
CAGTATGGGCACTCAAGATGTTTATCGTTCAACAAGAGTGTCTTTAGTTA
AACCAGTTTAATAGAAATCTCCAAAATTTGTTATTGTATGTTACTGAAAA
CTTTATATGACGAGTTGTG
back to top

protein sequence of SMED30001723-orf-1

>SMED30001723-orf-1 ID=SMED30001723-orf-1|Name=SMED30001723-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=240bp
MLGAYGDGKKMPPYVIFKRKSLPKNIHWPAGMIVKAQENGWMNEELTKDW
IKTIWCNDRKDEFRNSRRLLVLDAFRCHRMPCVKEILAKNKTDLVIIPGG
MTGQLQVMDVVCNRPFKQEMRKRWNEWFFSGAPSFTASGNRRKVGLETIC
KWIQLSWDAVSEAIIIKGFKKCCLSNAMDGSEDDIIWQDDISDVGNEEDD
IDDMENELMFGEVDESIEIENLMESEDENNGLCNEKNIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000136whole organism
PLANA:0000231vitelline gland
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR004875DDE_SF_endonuclease_dom
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0005622intracellular
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0007275multicellular organism development
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR19303TRANSPOSONcoord: 1..112
NoneNo IPR availablePANTHERPTHR19303:SF23POGO TRANSPOSABLE ELEMENT WITH KRAB DOMAINcoord: 1..112