Protein-serine/threonine kinase

Overview
NameProtein-serine/threonine kinase
Smed IDSMED30001718
Length (bp)1843
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein-serine/threonine kinase (SMED30001718) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein-serine/threonine kinase (SMED30001718) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein-serine/threonine kinase (SMED30001718) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein-serine/threonine kinase (SMED30001718) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001718

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30001718h1SMcG0013991 dd_Smed_v4_6810_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001718h1SMcG0013991 dd_Smed_v4_6810_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001718h1SMcG0013991 dd_Smed_v4_6810_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
testisSMED30001718h1SMcG0013991 GDAG01053886.1SmedSxl_ww_GDAG01PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein-serine/threonine kinase vs. Ensembl Human
Match: PDK3 (pyruvate dehydrogenase kinase 3 [Source:HGNC Symbol;Acc:HGNC:8811])

HSP 1 Score: 193.356 bits (490), Expect = 6.202e-55
Identity = 106/251 (42.23%), Postives = 146/251 (58.17%), Query Frame = 3
Query:  912 LFGSQVNR-NLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLR-DTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            LFG   N  + K IG ID   N+ +++ DAY+ A  LC+ YY V+PE+ V   N                           A  + I + Y+PSHL+HM FEL KN++RA VE +  R +  P V  LV   +E+++IKI D GGG+P   +D +F Y ++TA   P  +   + + P+AG+GYGLP+SRLYARYF GDL L S+EG GTDA+IYL+    E+ E LP+FNK++ R Y  +   A DWSNP
Sbjct:  171 LFGGDTNPVHPKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAK-------------------------APDKPIQVVYVPSHLFHMLFELFKNSMRATVELYEDRKEGYPAVKTLVTLGKEDLSIKISDLGGGVPLRKIDRLFNYMYSTA---PRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKALSSESFERLPVFNKSAWRHYKTTP-EADDWSNP 392          

HSP 2 Score: 156.762 bits (395), Expect = 1.542e-41
Identity = 84/170 (49.41%), Postives = 108/170 (63.53%), Query Frame = 3
Query:   69 LFSALSGQ-IAKDFIRCSKYTPTPLSLKKFVQFG-ENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLK-SDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            LF  L  Q + K   R S+++P+PLS+K+F+ FG +NA    S+ FL+KELPVRLAN M+E+ LLPDNL     V  V   Y +SF ELL++EN    D   + +F   +  +R RHN VV T AQGV+E KE FG D       QYFLDRF+ NRIS RMLI+QH + F
Sbjct:    3 LFRWLLKQPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANTMREVNLLPDNLLNRPSVGLVQSWYMQSFLELLEYENKSPEDPQVLDNFLQVLIKVRNRHNDVVPTMAQGVIEYKEKFGFDPFISTNIQYFLDRFYTNRISFRMLINQHTLLF 172          
BLAST of Protein-serine/threonine kinase vs. Ensembl Human
Match: PDK3 (pyruvate dehydrogenase kinase 3 [Source:HGNC Symbol;Acc:HGNC:8811])

HSP 1 Score: 193.356 bits (490), Expect = 6.202e-55
Identity = 106/251 (42.23%), Postives = 146/251 (58.17%), Query Frame = 3
Query:  912 LFGSQVNR-NLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLR-DTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            LFG   N  + K IG ID   N+ +++ DAY+ A  LC+ YY V+PE+ V   N                           A  + I + Y+PSHL+HM FEL KN++RA VE +  R +  P V  LV   +E+++IKI D GGG+P   +D +F Y ++TA   P  +   + + P+AG+GYGLP+SRLYARYF GDL L S+EG GTDA+IYL+    E+ E LP+FNK++ R Y  +   A DWSNP
Sbjct:  171 LFGGDTNPVHPKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAK-------------------------APDKPIQVVYVPSHLFHMLFELFKNSMRATVELYEDRKEGYPAVKTLVTLGKEDLSIKISDLGGGVPLRKIDRLFNYMYSTA---PRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKALSSESFERLPVFNKSAWRHYKTTP-EADDWSNP 392          

HSP 2 Score: 156.762 bits (395), Expect = 1.542e-41
Identity = 84/170 (49.41%), Postives = 108/170 (63.53%), Query Frame = 3
Query:   69 LFSALSGQ-IAKDFIRCSKYTPTPLSLKKFVQFG-ENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLK-SDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            LF  L  Q + K   R S+++P+PLS+K+F+ FG +NA    S+ FL+KELPVRLAN M+E+ LLPDNL     V  V   Y +SF ELL++EN    D   + +F   +  +R RHN VV T AQGV+E KE FG D       QYFLDRF+ NRIS RMLI+QH + F
Sbjct:    3 LFRWLLKQPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANTMREVNLLPDNLLNRPSVGLVQSWYMQSFLELLEYENKSPEDPQVLDNFLQVLIKVRNRHNDVVPTMAQGVIEYKEKFGFDPFISTNIQYFLDRFYTNRISFRMLINQHTLLF 172          
BLAST of Protein-serine/threonine kinase vs. Ensembl Human
Match: PDK3 (pyruvate dehydrogenase kinase 3 [Source:HGNC Symbol;Acc:HGNC:8811])

HSP 1 Score: 193.741 bits (491), Expect = 6.888e-55
Identity = 106/251 (42.23%), Postives = 146/251 (58.17%), Query Frame = 3
Query:  912 LFGSQVNR-NLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLR-DTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            LFG   N  + K IG ID   N+ +++ DAY+ A  LC+ YY V+PE+ V   N                           A  + I + Y+PSHL+HM FEL KN++RA VE +  R +  P V  LV   +E+++IKI D GGG+P   +D +F Y ++TA   P  +   + + P+AG+GYGLP+SRLYARYF GDL L S+EG GTDA+IYL+    E+ E LP+FNK++ R Y  +   A DWSNP
Sbjct:  171 LFGGDTNPVHPKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAK-------------------------APDKPIQVVYVPSHLFHMLFELFKNSMRATVELYEDRKEGYPAVKTLVTLGKEDLSIKISDLGGGVPLRKIDRLFNYMYSTA---PRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKALSSESFERLPVFNKSAWRHYKTTP-EADDWSNP 392          

HSP 2 Score: 156.762 bits (395), Expect = 1.830e-41
Identity = 84/170 (49.41%), Postives = 108/170 (63.53%), Query Frame = 3
Query:   69 LFSALSGQ-IAKDFIRCSKYTPTPLSLKKFVQFG-ENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLK-SDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            LF  L  Q + K   R S+++P+PLS+K+F+ FG +NA    S+ FL+KELPVRLAN M+E+ LLPDNL     V  V   Y +SF ELL++EN    D   + +F   +  +R RHN VV T AQGV+E KE FG D       QYFLDRF+ NRIS RMLI+QH + F
Sbjct:    3 LFRWLLKQPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANTMREVNLLPDNLLNRPSVGLVQSWYMQSFLELLEYENKSPEDPQVLDNFLQVLIKVRNRHNDVVPTMAQGVIEYKEKFGFDPFISTNIQYFLDRFYTNRISFRMLINQHTLLF 172          
BLAST of Protein-serine/threonine kinase vs. Ensembl Human
Match: PDK2 (pyruvate dehydrogenase kinase 2 [Source:HGNC Symbol;Acc:HGNC:8810])

HSP 1 Score: 190.274 bits (482), Expect = 1.988e-54
Identity = 102/247 (41.30%), Postives = 140/247 (56.68%), Query Frame = 3
Query:  918 GSQVNRNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            GS    + K IG ID   N+ E++ DAYD A  LC  YY  SP++ +  IN                              + I M Y+PSHLYHM FEL KNA+RA VE H     LPP+ V+V   +E+++IK+ D GGG+P   ++ +F Y ++TA     T    +   P+AG+GYGLP+SRLYA+YF GDL L S+EGFGTDA+IYL+    ++ E LP++NK++ R Y  +   A DW  P
Sbjct:  114 GSTNPAHPKHIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEIN-------------------------AANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTA----PTPQPGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAWRHY-QTIQEAGDWCVP 330          

HSP 2 Score: 105.916 bits (263), Expect = 2.845e-24
Identity = 52/112 (46.43%), Postives = 72/112 (64.29%), Query Frame = 3
Query:  237 MQEILLLPDNLHETSHVKFVIGLYEKSFTELLQF-ENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            M+EI LLPD +  T  V+ V   Y +S  ++++F +    D  T+  FTD +  IR RHN VV T AQGV+E K+ +G D  +    QYFLDRF+++RISIRMLI+QH + F
Sbjct:    1 MKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIF 112          
BLAST of Protein-serine/threonine kinase vs. Ensembl Human
Match: PDK2 (pyruvate dehydrogenase kinase 2 [Source:HGNC Symbol;Acc:HGNC:8810])

HSP 1 Score: 190.274 bits (482), Expect = 1.988e-54
Identity = 102/247 (41.30%), Postives = 140/247 (56.68%), Query Frame = 3
Query:  918 GSQVNRNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            GS    + K IG ID   N+ E++ DAYD A  LC  YY  SP++ +  IN                              + I M Y+PSHLYHM FEL KNA+RA VE H     LPP+ V+V   +E+++IK+ D GGG+P   ++ +F Y ++TA     T    +   P+AG+GYGLP+SRLYA+YF GDL L S+EGFGTDA+IYL+    ++ E LP++NK++ R Y  +   A DW  P
Sbjct:  114 GSTNPAHPKHIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEIN-------------------------AANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTA----PTPQPGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAWRHY-QTIQEAGDWCVP 330          

HSP 2 Score: 105.916 bits (263), Expect = 2.845e-24
Identity = 52/112 (46.43%), Postives = 72/112 (64.29%), Query Frame = 3
Query:  237 MQEILLLPDNLHETSHVKFVIGLYEKSFTELLQF-ENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            M+EI LLPD +  T  V+ V   Y +S  ++++F +    D  T+  FTD +  IR RHN VV T AQGV+E K+ +G D  +    QYFLDRF+++RISIRMLI+QH + F
Sbjct:    1 MKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIF 112          
BLAST of Protein-serine/threonine kinase vs. Ensembl Celegans
Match: pdhk-2 (Probable [pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q02332])

HSP 1 Score: 185.267 bits (469), Expect = 1.948e-52
Identity = 100/248 (40.32%), Postives = 143/248 (57.66%), Query Frame = 3
Query:  912 LFGSQVNRNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSN 1655
            +FG+ +  + + +G ID   ++  ++ DA++NA  LC  YY  SP +++ + N                            K + I +  +PSHLYHM FEL KNA+RA VE H + D LP + V V   QE+++IKI D GGG+  ++++ ++ Y ++TA   P   +      P+AGYGYGLPLSRLYARYF GDL L S+EG GTDA IYL+  P EA E+LPI++ +S R  T      ADWS+
Sbjct:  172 VFGNVLPESPRHVGCIDPACDVESVVYDAFENARFLCDRYYLTSPSMKLEMHN-------------------------AVEKGKPISIVAVPSHLYHMMFELFKNAMRATVEYHGVDDDLPDIKVYVVKGQEDLSIKICDRGGGVSRTILERLYNYMYSTAPPPPRDGT----QAPLAGYGYGLPLSRLYARYFLGDLFLVSMEGHGTDACIYLKAVPVEASEVLPIYSTSSRRNLTMGP-QVADWSH 389          

HSP 2 Score: 144.821 bits (364), Expect = 9.525e-38
Identity = 76/176 (43.18%), Postives = 110/176 (62.50%), Query Frame = 3
Query:   42 LKFNMKISGLFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFGENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            ++F+ K+ G F    G +AK     S++ P+ L++++++ FG     + S+ FLK EL VRLANIMQE  LLP  L +    K V   Y +SF +LL FE   S    V  F D +  + +RH  VVET A+G++E++E+ G+D ++E   QYFLDRF+INRISIRML +QH + F
Sbjct:    1 MRFSRKLLGPFV---GSLAKKLDYYSQFQPSSLTIQQYLDFGRIGTSANSYTFLKNELLVRLANIMQEFTLLPPKLLQMPSSKMVSNWYAESFEDLLLFEASDSSPEQVARFNDQLTVVLKRHAHVVETMAEGLIELRESDGVDIASEKGIQYFLDRFYINRISIRMLQNQHLVVF 173          
BLAST of Protein-serine/threonine kinase vs. Ensembl Fly
Match: Pdk (gene:FBgn0017558 transcript:FBtr0333004)

HSP 1 Score: 218.009 bits (554), Expect = 2.419e-64
Identity = 118/260 (45.38%), Postives = 160/260 (61.54%), Query Frame = 3
Query:  912 LFGSQVNRNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVE--CHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNPHFRSGLYYM 1685
            LFG   +   + IG +D   ++ +++ DAY+NA  LC  YY  SP + +                        +    E   +  I   Y+PSHLY+M FEL KN++RAVVE   H   DTLPP+ V +C  +E++ +KI D GGGIP S  D +FKY ++TA Q PS + L  ++VP+AGYGYGLP+SRLYARYF+GD+ L S EGFGTDAIIYL+   DEA+ELLPIFNKTS++ Y  + +P  DWSN +F +   Y+
Sbjct:  177 LFGGNPHAGGRHIGCLDPACDLSDVVRDAYENARFLCDQYYLTSPALEI------------------------QQHSSEPGDNLPIRTVYVPSHLYYMLFELFKNSMRAVVEHHGHDNNDTLPPLKVAICKGKEDICVKISDQGGGIPRSQTDQLFKYMYSTAPQ-PSKSDL--HTVPLAGYGYGLPISRLYARYFHGDIVLLSCEGFGTDAIIYLKALSDEANELLPIFNKTSSKFY-RATVPTGDWSNQNFSNRWRYL 408          

HSP 2 Score: 159.073 bits (401), Expect = 1.209e-42
Identity = 82/153 (53.59%), Postives = 107/153 (69.93%), Query Frame = 3
Query:  117 SKYTPTPLSLKKFVQFGENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFG--IDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            S + P+PLS+K+F+ FG+NA   +S+ FL+KELPVRLANIM+EI LLPDNL  T  V  V   Y KSF ++L +E  +     +Q F   +  IR RHN VV+T AQGV+E+KEN G  +DA TE   QYFLDR +++RISIRMLI+QH + F
Sbjct:   26 SGFNPSPLSIKQFMDFGQNACEKKSYIFLRKELPVRLANIMKEIALLPDNLLHTRSVSEVSSWYVKSFEDVLVYEKAEPTHDNLQKFVADLDLIRNRHNDVVQTMAQGVIEMKENEGGQVDAPTESSIQYFLDRLYMSRISIRMLINQHTLLF 178          
BLAST of Protein-serine/threonine kinase vs. Ensembl Fly
Match: Pdk (gene:FBgn0017558 transcript:FBtr0088508)

HSP 1 Score: 216.468 bits (550), Expect = 9.575e-64
Identity = 116/250 (46.40%), Postives = 155/250 (62.00%), Query Frame = 3
Query:  912 LFGSQVNRNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVE--CHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSN 1655
            LFG   +   + IG +D   ++ +++ DAY+NA  LC  YY  SP + +                        +    E   +  I   Y+PSHLY+M FEL KN++RAVVE   H   DTLPP+ V +C  +E++ +KI D GGGIP S  D +FKY ++TA Q PS + L  ++VP+AGYGYGLP+SRLYARYF+GD+ L S EGFGTDAIIYL+   DEA+ELLPIFNKTS++ Y  + +P  DWSN
Sbjct:  177 LFGGNPHAGGRHIGCLDPACDLSDVVRDAYENARFLCDQYYLTSPALEI------------------------QQHSSEPGDNLPIRTVYVPSHLYYMLFELFKNSMRAVVEHHGHDNNDTLPPLKVAICKGKEDICVKISDQGGGIPRSQTDQLFKYMYSTAPQ-PSKSDL--HTVPLAGYGYGLPISRLYARYFHGDIVLLSCEGFGTDAIIYLKALSDEANELLPIFNKTSSKFY-RATVPTGDWSN 398          

HSP 2 Score: 159.844 bits (403), Expect = 8.026e-43
Identity = 82/153 (53.59%), Postives = 107/153 (69.93%), Query Frame = 3
Query:  117 SKYTPTPLSLKKFVQFGENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFG--IDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            S + P+PLS+K+F+ FG+NA   +S+ FL+KELPVRLANIM+EI LLPDNL  T  V  V   Y KSF ++L +E  +     +Q F   +  IR RHN VV+T AQGV+E+KEN G  +DA TE   QYFLDR +++RISIRMLI+QH + F
Sbjct:   26 SGFNPSPLSIKQFMDFGQNACEKKSYIFLRKELPVRLANIMKEIALLPDNLLHTRSVSEVSSWYVKSFEDVLVYEKAEPTHDNLQKFVADLDLIRNRHNDVVQTMAQGVIEMKENEGGQVDAPTESSIQYFLDRLYMSRISIRMLINQHTLLF 178          
BLAST of Protein-serine/threonine kinase vs. Ensembl Fly
Match: Pdk (gene:FBgn0017558 transcript:FBtr0306807)

HSP 1 Score: 216.468 bits (550), Expect = 9.575e-64
Identity = 116/250 (46.40%), Postives = 155/250 (62.00%), Query Frame = 3
Query:  912 LFGSQVNRNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVE--CHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSN 1655
            LFG   +   + IG +D   ++ +++ DAY+NA  LC  YY  SP + +                        +    E   +  I   Y+PSHLY+M FEL KN++RAVVE   H   DTLPP+ V +C  +E++ +KI D GGGIP S  D +FKY ++TA Q PS + L  ++VP+AGYGYGLP+SRLYARYF+GD+ L S EGFGTDAIIYL+   DEA+ELLPIFNKTS++ Y  + +P  DWSN
Sbjct:  177 LFGGNPHAGGRHIGCLDPACDLSDVVRDAYENARFLCDQYYLTSPALEI------------------------QQHSSEPGDNLPIRTVYVPSHLYYMLFELFKNSMRAVVEHHGHDNNDTLPPLKVAICKGKEDICVKISDQGGGIPRSQTDQLFKYMYSTAPQ-PSKSDL--HTVPLAGYGYGLPISRLYARYFHGDIVLLSCEGFGTDAIIYLKALSDEANELLPIFNKTSSKFY-RATVPTGDWSN 398          

HSP 2 Score: 159.844 bits (403), Expect = 8.026e-43
Identity = 82/153 (53.59%), Postives = 107/153 (69.93%), Query Frame = 3
Query:  117 SKYTPTPLSLKKFVQFGENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFG--IDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            S + P+PLS+K+F+ FG+NA   +S+ FL+KELPVRLANIM+EI LLPDNL  T  V  V   Y KSF ++L +E  +     +Q F   +  IR RHN VV+T AQGV+E+KEN G  +DA TE   QYFLDR +++RISIRMLI+QH + F
Sbjct:   26 SGFNPSPLSIKQFMDFGQNACEKKSYIFLRKELPVRLANIMKEIALLPDNLLHTRSVSEVSSWYVKSFEDVLVYEKAEPTHDNLQKFVADLDLIRNRHNDVVQTMAQGVIEMKENEGGQVDAPTESSIQYFLDRLYMSRISIRMLINQHTLLF 178          
BLAST of Protein-serine/threonine kinase vs. Ensembl Fly
Match: Pdk (gene:FBgn0017558 transcript:FBtr0112892)

HSP 1 Score: 216.083 bits (549), Expect = 1.473e-63
Identity = 116/250 (46.40%), Postives = 155/250 (62.00%), Query Frame = 3
Query:  912 LFGSQVNRNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVE--CHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSN 1655
            LFG   +   + IG +D   ++ +++ DAY+NA  LC  YY  SP + +                        +    E   +  I   Y+PSHLY+M FEL KN++RAVVE   H   DTLPP+ V +C  +E++ +KI D GGGIP S  D +FKY ++TA Q PS + L  ++VP+AGYGYGLP+SRLYARYF+GD+ L S EGFGTDAIIYL+   DEA+ELLPIFNKTS++ Y  + +P  DWSN
Sbjct:  177 LFGGNPHAGGRHIGCLDPACDLSDVVRDAYENARFLCDQYYLTSPALEI------------------------QQHSSEPGDNLPIRTVYVPSHLYYMLFELFKNSMRAVVEHHGHDNNDTLPPLKVAICKGKEDICVKISDQGGGIPRSQTDQLFKYMYSTAPQ-PSKSDL--HTVPLAGYGYGLPISRLYARYFHGDIVLLSCEGFGTDAIIYLKALSDEANELLPIFNKTSSKFY-RATVPTGDWSN 398          

HSP 2 Score: 159.458 bits (402), Expect = 9.817e-43
Identity = 82/153 (53.59%), Postives = 107/153 (69.93%), Query Frame = 3
Query:  117 SKYTPTPLSLKKFVQFGENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFG--IDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            S + P+PLS+K+F+ FG+NA   +S+ FL+KELPVRLANIM+EI LLPDNL  T  V  V   Y KSF ++L +E  +     +Q F   +  IR RHN VV+T AQGV+E+KEN G  +DA TE   QYFLDR +++RISIRMLI+QH + F
Sbjct:   26 SGFNPSPLSIKQFMDFGQNACEKKSYIFLRKELPVRLANIMKEIALLPDNLLHTRSVSEVSSWYVKSFEDVLVYEKAEPTHDNLQKFVADLDLIRNRHNDVVQTMAQGVIEMKENEGGQVDAPTESSIQYFLDRLYMSRISIRMLINQHTLLF 178          
BLAST of Protein-serine/threonine kinase vs. Ensembl Zebrafish
Match: pdk1 (pyruvate dehydrogenase kinase, isozyme 1 [Source:ZFIN;Acc:ZDB-GENE-091204-402])

HSP 1 Score: 195.282 bits (495), Expect = 8.304e-56
Identity = 104/252 (41.27%), Postives = 148/252 (58.73%), Query Frame = 3
Query:  912 LFGSQVNRNL---KFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            LFG +V  N    K IG ID    + +++ DAY+NA NLC  YY  SPE+                  ++++N    D        + + + Y+PSHLYHM FEL KNA+RA +E +      PPV+V +    E++T+K+ D GGG+P   +D +F YT++TA +    TS    + P+AGYGYGLP+SRLYARYF GDL L S+EGFGTDA+IY+R    ++ E LP++NK++ + Y  +   A DW  P
Sbjct:  170 LFGGKVRDNPAHPKQIGSIDPSCRVTDVVKDAYENARNLCDRYYMNSPEL-----------------VLEEFNVKGPD--------KPVTVVYVPSHLYHMVFELFKNAMRATMELYEDAMEYPPVHVQIVLGHEDLTVKVSDRGGGVPLRKIDRLFTYTYSTAPRPQMDTS---RATPLAGYGYGLPISRLYARYFQGDLKLYSMEGFGTDAVIYIRALSTDSIERLPVYNKSAWKHY-KTIHEADDWCVP 392          

HSP 2 Score: 171.785 bits (434), Expect = 3.309e-47
Identity = 90/169 (53.25%), Postives = 118/169 (69.82%), Query Frame = 3
Query:   69 LFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFG-ENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTV-QSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            L +A S QI  DF   S+++P+PLS+K+F+ FG ENA    SF FL++ELPVRLANIM+EI LLPDNL  T  V+ V   Y +SF ++L+F++  +D  TV   FTD +  IR RHN VV T AQGV+E KE +G D  T    QYFLDRF+++RISIRML++QH + F
Sbjct:    7 LLNAASKQI--DFY--SRFSPSPLSMKQFIDFGSENACEKTSFTFLRQELPVRLANIMKEIDLLPDNLLRTPSVRLVQSWYMQSFQDILEFKDKDADDETVNHDFTDAVIKIRNRHNDVVPTMAQGVVEYKETYGTDPITSQNMQYFLDRFYMSRISIRMLLNQHTLLF 171          
BLAST of Protein-serine/threonine kinase vs. Ensembl Zebrafish
Match: pdk3b (pyruvate dehydrogenase kinase, isozyme 3b [Source:ZFIN;Acc:ZDB-GENE-070112-1892])

HSP 1 Score: 191.815 bits (486), Expect = 1.597e-54
Identity = 102/243 (41.98%), Postives = 145/243 (59.67%), Query Frame = 3
Query:  942 KFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECH-HLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTA---KQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            K IG ID   N+ E++ DAY+ A  LC+ YY ++PE+++   N  +                           + +   Y+PSHL+HM FEL KN++RA VE + +  + LPPV  +V   +E+++IKI D GGG+P   +D +F Y ++TA   +  PS  +     VP+AG+GYGLP+SRLYARYF GDL L SVEGFGTDA+I+L+    E+ E LP+FNK++ R Y  +   A DWSNP
Sbjct:  181 KHIGSIDPACNVAEVVRDAYETAKMLCEQYYMMAPELKIGEFNSKN-------------------------PKKPVQAVYVPSHLFHMLFELFKNSMRATVELYENSSEGLPPVKAMVTLGKEDLSIKISDKGGGVPLRKIDRLFNYMYSTAPTPRLDPSQPA-----VPLAGFGYGLPISRLYARYFQGDLNLYSVEGFGTDAVIHLKALSSESFERLPVFNKSAWRHY-QTGPEADDWSNP 392          

HSP 2 Score: 153.68 bits (387), Expect = 1.189e-40
Identity = 82/169 (48.52%), Postives = 105/169 (62.13%), Query Frame = 3
Query:   69 LFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFG-ENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLK-SDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            LF  L   +       S+++P+P+S+K+F+ FG ENA    S+ FL+KEL VRLAN M+E+ LLPD+L     VK V   Y +SF ELL+FE     D  T+  F + +  IR RHN VV T AQGV+E KE FG D       QYFLDRF+ NRIS RMLI+QH + F
Sbjct:    3 LFICLLKDVTHKIEYYSRFSPSPMSIKQFLDFGRENACEKTSYMFLRKELAVRLANTMREVTLLPDSLQIQPSVKLVESWYSQSFEELLKFEKRSPEDPHTLNDFLEMLIKIRNRHNDVVPTMAQGVIEYKEKFGFDPFISSNVQYFLDRFYTNRISFRMLINQHTLLF 171          
BLAST of Protein-serine/threonine kinase vs. Ensembl Zebrafish
Match: pdk4 (pyruvate dehydrogenase kinase, isozyme 4 [Source:ZFIN;Acc:ZDB-GENE-060503-754])

HSP 1 Score: 186.037 bits (471), Expect = 2.591e-54
Identity = 100/247 (40.49%), Postives = 140/247 (56.68%), Query Frame = 3
Query:  918 GSQVNRNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            GS    + K IG ID   +++E++ DAY+++  LC  YY  SPE+ +  +N                                I + Y+PSHLYHM FEL KNA+RA VE H     LPP+ V V    E++TIK+ D G G+P   ++ +F Y ++TA   PS  +  + + P+AG+GYGLP+SRLYA+YF GDL L S+EG+GT A+IYL+    E+ E LP+FNK++ R Y  S   A DW  P
Sbjct:    6 GSTNPAHPKHIGSIDPNCDVVEVVRDAYESSKMLCDQYYLTSPEVEIKQVNIK-------------------------GPSDPIHIVYVPSHLYHMLFELFKNAMRATVETHETSLHLPPIKVRVSLGTEDLTIKMSDRGSGVPLRKIERLFSYMYSTA---PSPVAEDTRNAPLAGFGYGLPISRLYAKYFQGDLQLYSMEGYGTSAVIYLKALSTESIERLPVFNKSALRHYQTST-EADDWCIP 223          
BLAST of Protein-serine/threonine kinase vs. Ensembl Zebrafish
Match: pdk3a (pyruvate dehydrogenase kinase, isozyme 3a [Source:ZFIN;Acc:ZDB-GENE-061220-3])

HSP 1 Score: 189.504 bits (480), Expect = 3.162e-54
Identity = 104/251 (41.43%), Postives = 145/251 (57.77%), Query Frame = 3
Query:  912 LFGSQVN-RNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHH-LRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            LFG+ +N  + K IG ID   N+ E++ DAY+ A  +C+ YY  +PE+++   N                           A  + I   Y+PSHL+HM FEL KNA+RA  + H   ++ LP +   V    E++++KI D GGG+    +D +F YT++TA     T SL S  VP+AG+G+GLP+SRLYARYF GDL L S+EG GTDA+IYL+    E+ E LP+FNK++ R Y      A DWSNP
Sbjct:  125 LFGNDINPAHPKHIGSIDPSCNVAEVVTDAYETAKMVCEQYYQAAPELKIEEFNAK-------------------------APQKPIQAVYVPSHLFHMLFELFKNAMRATNDLHEGSKEGLPLIKAKVTLGIEDLSVKISDRGGGVALRKIDRLFNYTYSTA----PTPSLDSKRVPLAGFGHGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKALSSESFERLPVFNKSAWRHYQGGP-GADDWSNP 345          

HSP 2 Score: 134.035 bits (336), Expect = 4.588e-34
Identity = 69/125 (55.20%), Postives = 81/125 (64.80%), Query Frame = 3
Query:  198 FLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLK-SDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            FL+KELPVRLAN M+E+ LLPD L     VK V   Y +SF ELL+FEN K  D   +  F + +  IR RHN VV T AQGV+E KE FG D       QYFLDRF+ NRIS RMLI+QH + F
Sbjct:    2 FLRKELPVRLANTMREVNLLPDRLLSQPSVKLVQKWYLQSFLELLEFENRKPEDGHALNDFLETLIEIRNRHNDVVPTMAQGVIEYKEKFGFDPFVSSNIQYFLDRFYTNRISFRMLINQHTLLF 126          
BLAST of Protein-serine/threonine kinase vs. Ensembl Zebrafish
Match: pdk3a (pyruvate dehydrogenase kinase, isozyme 3a [Source:ZFIN;Acc:ZDB-GENE-061220-3])

HSP 1 Score: 189.119 bits (479), Expect = 1.361e-53
Identity = 105/252 (41.67%), Postives = 146/252 (57.94%), Query Frame = 3
Query:  912 LFGSQVN-RNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHH-LRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAA-DWSNP 1658
            LFG+ +N  + K IG ID   N+ E++ DAY+ A  +C+ YY  +PE+++   N                           A  + I   Y+PSHL+HM FEL KNA+RA  + H   ++ LP +   V    E++++KI D GGG+    +D +F YT++TA     T SL S  VP+AG+G+GLP+SRLYARYF GDL L S+EG GTDA+IYL+    E+ E LP+FNK++ R Y     P A DWSNP
Sbjct:  170 LFGNDINPAHPKHIGSIDPSCNVAEVVTDAYETAKMVCEQYYQAAPELKIEEFN------------------------AAKAPQKPIQAVYVPSHLFHMLFELFKNAMRATNDLHEGSKEGLPLIKAKVTLGIEDLSVKISDRGGGVALRKIDRLFNYTYSTA----PTPSLDSKRVPLAGFGHGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKALSSESFERLPVFNKSAWRHYQGG--PGADDWSNP 391          

HSP 2 Score: 157.532 bits (397), Expect = 5.783e-42
Identity = 81/153 (52.94%), Postives = 103/153 (67.32%), Query Frame = 3
Query:  117 SKYTPTPLSLKKFVQFG-ENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLK-SDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            S+++P+PLS+K+F++FG +NA    S+ FL+KELPVRLAN M+E+ LLPD L     VK V   Y +SF ELL+FEN K  D   +  F + +  IR RHN VV T AQGV+E KE FG D       QYFLDRF+ NRIS RMLI+QH + F
Sbjct:   19 SRFSPSPLSIKQFLEFGRDNACEKTSYMFLRKELPVRLANTMREVNLLPDRLLSQPSVKLVQKWYLQSFLELLEFENRKPEDGHALNDFLETLIEIRNRHNDVVPTMAQGVIEYKEKFGFDPFVSSNIQYFLDRFYTNRISFRMLINQHTLLF 171          
BLAST of Protein-serine/threonine kinase vs. Ensembl Xenopus
Match: pdk3 (pyruvate dehydrogenase kinase 3 [Source:NCBI gene;Acc:100135009])

HSP 1 Score: 207.994 bits (528), Expect = 6.418e-61
Identity = 111/251 (44.22%), Postives = 152/251 (60.56%), Query Frame = 3
Query:  912 LFGSQVN-RNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLR-DTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            LFG  +N  + K IG ID   N+ E++ DAY+ A  LC+ YY  +PE+++   N                           A  R + + Y+PSHL+HM FEL KN++RA VE H  + D LPPV  LV   +E+++I+I D GGG+P   +D +F Y ++TA   P  +   S +VP+AG+GYGLP+SRLYARYF GDL L S+EG GTDA+IYL+    E+ E LP+FNK++ R Y N+A  A DWSNP
Sbjct:  126 LFGGDINPAHPKHIGSIDPTCNVPEVVKDAYETAKMLCEQYYMAAPELKIEEFNAK-------------------------APGRPLHVVYVPSHLFHMLFELFKNSMRATVELHEGKTDALPPVKALVTLGKEDLSIRISDKGGGVPLRKIDRLFNYMYSTA---PRPSLEPSRAVPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKAVSSESFERLPVFNKSAWRHYKNAA-EADDWSNP 347          

HSP 2 Score: 83.9593 bits (206), Expect = 7.625e-17
Identity = 53/152 (34.87%), Postives = 75/152 (49.34%), Query Frame = 3
Query:  117 SKYTPTPLSLKKFVQFGEN-ARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            SK++P+PLS+K+F+ FG N A    S+ FL+KELPVR+AN ++E+ LLP++L +   VK +                          F       RE+                  +G D       QYFLDRF++NRIS RMLI+QH + F
Sbjct:   20 SKFSPSPLSIKQFLDFGRNNACEKTSYLFLRKELPVRIANSLKEVNLLPESLLQRPSVKLL--------------------------FFKWKHMTREK------------------YGFDPFVSSNIQYFLDRFYMNRISFRMLINQHTLLF 127          
BLAST of Protein-serine/threonine kinase vs. Ensembl Xenopus
Match: pdk3 (pyruvate dehydrogenase kinase 3 [Source:NCBI gene;Acc:100135009])

HSP 1 Score: 207.994 bits (528), Expect = 1.284e-60
Identity = 111/251 (44.22%), Postives = 152/251 (60.56%), Query Frame = 3
Query:  912 LFGSQVN-RNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLR-DTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            LFG  +N  + K IG ID   N+ E++ DAY+ A  LC+ YY  +PE+++   N                           A  R + + Y+PSHL+HM FEL KN++RA VE H  + D LPPV  LV   +E+++I+I D GGG+P   +D +F Y ++TA   P  +   S +VP+AG+GYGLP+SRLYARYF GDL L S+EG GTDA+IYL+    E+ E LP+FNK++ R Y N+A  A DWSNP
Sbjct:  153 LFGGDINPAHPKHIGSIDPTCNVPEVVKDAYETAKMLCEQYYMAAPELKIEEFNAK-------------------------APGRPLHVVYVPSHLFHMLFELFKNSMRATVELHEGKTDALPPVKALVTLGKEDLSIRISDKGGGVPLRKIDRLFNYMYSTA---PRPSLEPSRAVPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKAVSSESFERLPVFNKSAWRHYKNAA-EADDWSNP 374          

HSP 2 Score: 126.716 bits (317), Expect = 4.701e-31
Identity = 69/152 (45.39%), Postives = 93/152 (61.18%), Query Frame = 3
Query:  117 SKYTPTPLSLKKFVQFGEN-ARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            SK++P+PLS+K+F+ FG N A    S+ FL+KELPVR+AN ++E+ LLP++L +   VK                 N  S   T Q F + +  +R RHN VV T AQGV+E KE +G D       QYFLDRF++NRIS RMLI+QH + F
Sbjct:   20 SKFSPSPLSIKQFLDFGRNNACEKTSYLFLRKELPVRIANSLKEVNLLPESLLQRPSVKL----------------NTNSS-RTNQIFLNVLIQVRNRHNDVVPTMAQGVIEYKEKYGFDPFVSSNIQYFLDRFYMNRISFRMLINQHTLLF 154          
BLAST of Protein-serine/threonine kinase vs. Ensembl Xenopus
Match: pdk3 (pyruvate dehydrogenase kinase 3 [Source:NCBI gene;Acc:100135009])

HSP 1 Score: 207.608 bits (527), Expect = 1.504e-60
Identity = 111/251 (44.22%), Postives = 152/251 (60.56%), Query Frame = 3
Query:  912 LFGSQVN-RNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLR-DTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            LFG  +N  + K IG ID   N+ E++ DAY+ A  LC+ YY  +PE+++   N                           A  R + + Y+PSHL+HM FEL KN++RA VE H  + D LPPV  LV   +E+++I+I D GGG+P   +D +F Y ++TA   P  +   S +VP+AG+GYGLP+SRLYARYF GDL L S+EG GTDA+IYL+    E+ E LP+FNK++ R Y N+A  A DWSNP
Sbjct:  146 LFGGDINPAHPKHIGSIDPTCNVPEVVKDAYETAKMLCEQYYMAAPELKIEEFNAK-------------------------APGRPLHVVYVPSHLFHMLFELFKNSMRATVELHEGKTDALPPVKALVTLGKEDLSIRISDKGGGVPLRKIDRLFNYMYSTA---PRPSLEPSRAVPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKAVSSESFERLPVFNKSAWRHYKNAA-EADDWSNP 367          

HSP 2 Score: 119.398 bits (298), Expect = 1.197e-28
Identity = 65/154 (42.21%), Postives = 91/154 (59.09%), Query Frame = 3
Query:  117 SKYTPTPLSLKKFVQFGEN-ARPSESFNFLKKELPVRLANIMQEILLLPDNLHE--TSHVKFVIGLYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            SK++P+PLS+K+F+ FG N A    S+ FL+KELPVR+AN ++E+ LLP++L +  +SH+                             F + +  +R RHN VV T AQGV+E KE +G D       QYFLDRF++NRIS RMLI+QH + F
Sbjct:   20 SKFSPSPLSIKQFLDFGRNNACEKTSYLFLRKELPVRIANSLKEVNLLPESLLQRPSSHLYL--------------------------HFLNVLIQVRNRHNDVVPTMAQGVIEYKEKYGFDPFVSSNIQYFLDRFYMNRISFRMLINQHTLLF 147          
BLAST of Protein-serine/threonine kinase vs. Ensembl Xenopus
Match: pdk3 (pyruvate dehydrogenase kinase 3 [Source:NCBI gene;Acc:100135009])

HSP 1 Score: 207.994 bits (528), Expect = 2.326e-60
Identity = 111/251 (44.22%), Postives = 152/251 (60.56%), Query Frame = 3
Query:  912 LFGSQVN-RNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLR-DTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            LFG  +N  + K IG ID   N+ E++ DAY+ A  LC+ YY  +PE+++   N                           A  R + + Y+PSHL+HM FEL KN++RA VE H  + D LPPV  LV   +E+++I+I D GGG+P   +D +F Y ++TA   P  +   S +VP+AG+GYGLP+SRLYARYF GDL L S+EG GTDA+IYL+    E+ E LP+FNK++ R Y N+A  A DWSNP
Sbjct:  180 LFGGDINPAHPKHIGSIDPTCNVPEVVKDAYETAKMLCEQYYMAAPELKIEEFNAK-------------------------APGRPLHVVYVPSHLFHMLFELFKNSMRATVELHEGKTDALPPVKALVTLGKEDLSIRISDKGGGVPLRKIDRLFNYMYSTA---PRPSLEPSRAVPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKAVSSESFERLPVFNKSAWRHYKNAA-EADDWSNP 401          

HSP 2 Score: 148.673 bits (374), Expect = 1.162e-38
Identity = 76/153 (49.67%), Postives = 104/153 (67.97%), Query Frame = 3
Query:  117 SKYTPTPLSLKKFVQFGEN-ARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTV-QSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            SK++P+PLS+K+F+ FG N A    S+ FL+KELPVR+AN ++E+ LLP++L +   VK V   Y +SF ELL++EN   + S V   F + +  +R RHN VV T AQGV+E KE +G D       QYFLDRF++NRIS RMLI+QH + F
Sbjct:   29 SKFSPSPLSIKQFLDFGRNNACEKTSYLFLRKELPVRIANSLKEVNLLPESLLQRPSVKLVRSWYLQSFLELLEYENKSPEDSDVLYDFLNVLIQVRNRHNDVVPTMAQGVIEYKEKYGFDPFVSSNIQYFLDRFYMNRISFRMLINQHTLLF 181          
BLAST of Protein-serine/threonine kinase vs. Ensembl Xenopus
Match: pdk3 (pyruvate dehydrogenase kinase 3 [Source:NCBI gene;Acc:100135009])

HSP 1 Score: 207.994 bits (528), Expect = 3.820e-60
Identity = 111/251 (44.22%), Postives = 152/251 (60.56%), Query Frame = 3
Query:  912 LFGSQVN-RNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLR-DTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            LFG  +N  + K IG ID   N+ E++ DAY+ A  LC+ YY  +PE+++   N                           A  R + + Y+PSHL+HM FEL KN++RA VE H  + D LPPV  LV   +E+++I+I D GGG+P   +D +F Y ++TA   P  +   S +VP+AG+GYGLP+SRLYARYF GDL L S+EG GTDA+IYL+    E+ E LP+FNK++ R Y N+A  A DWSNP
Sbjct:  194 LFGGDINPAHPKHIGSIDPTCNVPEVVKDAYETAKMLCEQYYMAAPELKIEEFNAK-------------------------APGRPLHVVYVPSHLFHMLFELFKNSMRATVELHEGKTDALPPVKALVTLGKEDLSIRISDKGGGVPLRKIDRLFNYMYSTA---PRPSLEPSRAVPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKAVSSESFERLPVFNKSAWRHYKNAA-EADDWSNP 415          

HSP 2 Score: 149.828 bits (377), Expect = 5.974e-39
Identity = 78/170 (45.88%), Postives = 108/170 (63.53%), Query Frame = 3
Query:   66 GLFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFGEN-ARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTV-QSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            G F  +   +       SK++P+PLS+K+F+ FG N A    S+ FL+KELPVR+AN ++E+ LLP++L +   VK V   Y +SF ELL++EN   + S V   F + +  +R RHN VV T AQGV+E KE +G D       QYFLDRF++NRIS RMLI+QH + F
Sbjct:   26 GCFLPMCNTVPSQIEYYSKFSPSPLSIKQFLDFGRNNACEKTSYLFLRKELPVRIANSLKEVNLLPESLLQRPSVKLVRSWYLQSFLELLEYENKSPEDSDVLYDFLNVLIQVRNRHNDVVPTMAQGVIEYKEKYGFDPFVSSNIQYFLDRFYMNRISFRMLINQHTLLF 195          
BLAST of Protein-serine/threonine kinase vs. Ensembl Mouse
Match: Pdk3 (pyruvate dehydrogenase kinase, isoenzyme 3 [Source:MGI Symbol;Acc:MGI:2384308])

HSP 1 Score: 195.667 bits (496), Expect = 8.486e-56
Identity = 106/251 (42.23%), Postives = 147/251 (58.57%), Query Frame = 3
Query:  912 LFGSQVN-RNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHH-LRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            LFG   N  + K IG ID   N+ +++ DAY+ A  LC+ YY V+PE+ V   N                           A ++ I + Y+PSHL+HM FEL KN++RA VE H   ++  P V  LV   +E+++IKI D GGG+P   +D +F Y ++TA   P  +   + + P+AG+GYGLP+SRLYARYF GDL L S+EG GTDA+IYL+    E+ E LP+FNK++ R Y  +   A DWSNP
Sbjct:  171 LFGGDTNPAHPKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAK-------------------------APNKPIQVVYVPSHLFHMLFELFKNSMRATVELHEDKKEGYPAVKTLVTLGKEDLSIKISDLGGGVPLRKIDRLFNYMYSTA---PRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKALSSESFERLPVFNKSAWRHYKTTP-EADDWSNP 392          

HSP 2 Score: 159.458 bits (402), Expect = 1.350e-42
Identity = 83/169 (49.11%), Postives = 108/169 (63.91%), Query Frame = 3
Query:   69 LFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFG-ENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLK-SDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
             +  L   + K   R S+++P+PLS+K+F+ FG +NA    S+ FL+KELPVRLAN M+E+ LLPDNL     V  V   Y +SF ELL++EN    D   + +F + + NIR RHN VV T AQGV+E KE FG D       QYFLDRF+ NRIS RMLI+QH + F
Sbjct:    4 FYRLLKQPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANTMREVNLLPDNLLNRPSVGLVQSWYMQSFLELLEYENKSPEDPRVLDNFLNVLINIRNRHNDVVPTMAQGVIEYKEKFGFDPFISSNIQYFLDRFYTNRISFRMLINQHTLLF 172          
BLAST of Protein-serine/threonine kinase vs. Ensembl Mouse
Match: Pdk2 (pyruvate dehydrogenase kinase, isoenzyme 2 [Source:MGI Symbol;Acc:MGI:1343087])

HSP 1 Score: 187.578 bits (475), Expect = 5.607e-53
Identity = 99/247 (40.08%), Postives = 142/247 (57.49%), Query Frame = 3
Query:  918 GSQVNRNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            GS    + K IG ID   ++ +++ DAYD A  LC  YY  SP++ +  +N                             ++ I M Y+PSHLYHM FEL KNA+RA VE H    TLPP+ ++V   +E+++IK+ D GGG+P   ++ +F Y ++TA     T    +   P+AG+GYGLP+SRLYA+YF GDL L S+EGFGTDA+IYL+    ++ E LP++NK++ R Y  +   A DW  P
Sbjct:  178 GSTNPAHPKHIGSIDPNCSVSDVVKDAYDMAKLLCDKYYMASPDLEIQEVN-------------------------ATNANQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLTLPPIKIMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTA----PTPQPGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAWRHY-QTIQEAGDWCVP 394          

HSP 2 Score: 154.066 bits (388), Expect = 1.185e-40
Identity = 77/153 (50.33%), Postives = 105/153 (68.63%), Query Frame = 3
Query:  117 SKYTPTPLSLKKFVQFGE-NARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQF-ENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            SK++P+PLS+K+F+ FG  NA    SF FL++ELPVRLANIM+EI LLPD +  T  V+ V   Y +S  ++++F +    D  T+  FTD +  IR RHN VV T AQGV+E K+ +G D  +    QYFLDRF+++RISIRMLI+QH + F
Sbjct:   24 SKFSPSPLSMKQFLDFGSSNACEKTSFTFLRQELPVRLANIMKEINLLPDRVLGTPSVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIF 176          
BLAST of Protein-serine/threonine kinase vs. Ensembl Mouse
Match: Pdk4 (pyruvate dehydrogenase kinase, isoenzyme 4 [Source:MGI Symbol;Acc:MGI:1351481])

HSP 1 Score: 185.267 bits (469), Expect = 4.986e-52
Identity = 105/262 (40.08%), Postives = 146/262 (55.73%), Query Frame = 3
Query:  879 SQQRLYELEVSLFGSQVNRNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNS--VPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            S + L    + +F      N   IG ID   +++ ++ DA++ A  LC  YY  SPE+ +T +N                              + I + Y+PSHL+HM FEL KNA+RA VE    R +L PV   V   +E++TIKI D GGG+P  + D +F YT++TA      T +M NS   P+AG+GYGLP+SRLYA+YF GDL L S+ G+GTDAIIYL+    E+ E LP+FNK++ + Y  S+  A DW  P
Sbjct:  168 STRMLMNQHILIFSDSKTGNPSHIGSIDPNCDVVAVVQDAFECAKMLCDQYYLTSPELNLTQVNGKFPG-------------------------QPIHIVYVPSHLHHMLFELFKNAMRATVEHQENRPSLTPVEATVVLGKEDLTIKISDRGGGVPLRITDRLFSYTYSTAP-----TPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNLYSMSGYGTDAIIYLKALSSESVEKLPVFNKSAFKHYQMSS-EADDWCIP 398          

HSP 2 Score: 144.436 bits (363), Expect = 3.438e-37
Identity = 72/153 (47.06%), Postives = 102/153 (66.67%), Query Frame = 3
Query:  117 SKYTPTPLSLKKFVQFG-ENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQF-ENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            S+Y+P+PLS+K+ + FG ENA    SF FL++ELPVRLANI++EI +LPD L  T  V+ V   Y +S  +L++F E    D   +  F D +  +R RH++VV T AQG++E K+   +D  T    QYFLDRF++NRIS RML++QH + F
Sbjct:   28 SRYSPSPLSMKQLLDFGSENACERTSFAFLRQELPVRLANILKEIDILPDRLVNTPSVQLVKSWYIQSLMDLVEFHEKSPEDQKALSEFVDTLVKVRNRHHNVVPTMAQGILEYKDTCTVDPVTNQNLQYFLDRFYMNRISTRMLMNQHILIF 180          
BLAST of Protein-serine/threonine kinase vs. Ensembl Mouse
Match: Pdk1 (pyruvate dehydrogenase kinase, isoenzyme 1 [Source:MGI Symbol;Acc:MGI:1926119])

HSP 1 Score: 183.726 bits (465), Expect = 3.231e-51
Identity = 99/250 (39.60%), Postives = 145/250 (58.00%), Query Frame = 3
Query:  912 LFGSQVN-RNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            LFG + +  + K IG I+   +++E++ D Y+NA  LC  YY  SPE                         L+ + L   +  + I + Y+PSHLYHM FEL KNA+RA +E H  +   PP+ V V   +E++T+K+ D GGG+P   +D +F Y ++TA   P      S +VP+AG+GYGLP+SRLYA+YF GDL L S+EG+GTDA+IY++    E+ E LP++NK + + Y  +   A DW  P
Sbjct:  201 LFGGKGSPSHRKHIGSINPNCDVVEVIKDGYENARRLCDLYYVNSPE-------------------------LELEELNAKSPGQTIQVVYVPSHLYHMVFELFKNAMRATMEHHADKGVYPPIQVHVTLGEEDLTVKMSDRGGGVPLRKIDRLFNYMYSTA---PRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTESVERLPVYNKAAWKHYKANH-EADDWCVP 421          

HSP 2 Score: 164.081 bits (414), Expect = 4.589e-44
Identity = 85/166 (51.20%), Postives = 114/166 (68.67%), Query Frame = 3
Query:   78 ALSGQIAKDFIRCSKYTPTPLSLKKFVQFGE-NARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKS-DLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
             + GQ+  DF   ++++P+PLS+K+F+ FG  NA    SF FL++ELPVRLANIM+EI LLPDNL  T  V+ V   Y +S  ELL F++  + D  T+  FTD +  IR RHN V+ T AQGV E KE+FG+D  T    QYFLDRF+++RISIRML++QH + F
Sbjct:   41 GVPGQV--DFY--ARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKTIYEFTDTVIRIRNRHNDVIPTMAQGVTEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLF 202          
BLAST of Protein-serine/threonine kinase vs. Ensembl Mouse
Match: Bckdk (branched chain ketoacid dehydrogenase kinase [Source:MGI Symbol;Acc:MGI:1276121])

HSP 1 Score: 106.686 bits (265), Expect = 3.271e-24
Identity = 73/218 (33.49%), Postives = 102/218 (46.79%), Query Frame = 3
Query:  945 FIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDT---LPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAK---QSPSTTSLMSN--------SVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLR 1556
            F+GII ++ +  +I+    D A  LC+H YG +P +R+                                 H      +IP  L ++  ELLKNA+RA +E H   DT   +P V + +     ++ I+I D GGGI H  +D V  Y FTTA+   Q P    L  +        S PM G+G+GLP SR YA Y  G L L S++G GTD  + LR
Sbjct:  217 FVGIICTRLSPKKIIEKWVDFARRLCEHKYGNAPRVRIN-------------------------------GHVAARFPFIPMPLDYILPELLKNAMRATMESH--LDTPYNVPDVVITIANNDIDLIIRISDRGGGIAHKDLDRVMDYHFTTAEASTQDPRINPLFGHLDMHSGGQSGPMHGFGFGLPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLR 401          

HSP 2 Score: 55.4546 bits (132), Expect = 1.157e-7
Identity = 35/124 (28.23%), Postives = 63/124 (50.81%), Query Frame = 3
Query:  186 ESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQH 557
            +S  +L++ELPVR+A+ ++    LP  +     +  V  LY ++F +L  F  +K      Q +   +  + + H  VV   A+G+ E +++       E   +YFLD+   +R+ IRML + H
Sbjct:   89 KSGRYLQQELPVRIAHRIKGFRSLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQ-YCQLVRQLLDDHKDVVTLLAEGLRESRKHI----QDEKLVRYFLDKTLTSRLGIRMLATHH 207          
BLAST of Protein-serine/threonine kinase vs. UniProt/SwissProt
Match: sp|P91622|PDK_DROME ([Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Pdk PE=2 SV=2)

HSP 1 Score: 216.468 bits (550), Expect = 9.598e-63
Identity = 116/250 (46.40%), Postives = 155/250 (62.00%), Query Frame = 3
Query:  912 LFGSQVNRNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVE--CHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSN 1655
            LFG   +   + IG +D   ++ +++ DAY+NA  LC  YY  SP + +                        +    E   +  I   Y+PSHLY+M FEL KN++RAVVE   H   DTLPP+ V +C  +E++ +KI D GGGIP S  D +FKY ++TA Q PS + L  ++VP+AGYGYGLP+SRLYARYF+GD+ L S EGFGTDAIIYL+   DEA+ELLPIFNKTS++ Y  + +P  DWSN
Sbjct:  177 LFGGNPHAGGRHIGCLDPACDLSDVVRDAYENARFLCDQYYLTSPALEI------------------------QQHSSEPGDNLPIRTVYVPSHLYYMLFELFKNSMRAVVEHHGHDNNDTLPPLKVAICKGKEDICVKISDQGGGIPRSQTDQLFKYMYSTAPQ-PSKSDL--HTVPLAGYGYGLPISRLYARYFHGDIVLLSCEGFGTDAIIYLKALSDEANELLPIFNKTSSKFY-RATVPTGDWSN 398          

HSP 2 Score: 159.844 bits (403), Expect = 8.045e-42
Identity = 82/153 (53.59%), Postives = 107/153 (69.93%), Query Frame = 3
Query:  117 SKYTPTPLSLKKFVQFGENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFG--IDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            S + P+PLS+K+F+ FG+NA   +S+ FL+KELPVRLANIM+EI LLPDNL  T  V  V   Y KSF ++L +E  +     +Q F   +  IR RHN VV+T AQGV+E+KEN G  +DA TE   QYFLDR +++RISIRMLI+QH + F
Sbjct:   26 SGFNPSPLSIKQFMDFGQNACEKKSYIFLRKELPVRLANIMKEIALLPDNLLHTRSVSEVSSWYVKSFEDVLVYEKAEPTHDNLQKFVADLDLIRNRHNDVVQTMAQGVIEMKENEGGQVDAPTESSIQYFLDRLYMSRISIRMLINQHTLLF 178          
BLAST of Protein-serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q922H2|PDK3_MOUSE ([Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Mus musculus OX=10090 GN=Pdk3 PE=1 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 5.936e-55
Identity = 106/251 (42.23%), Postives = 147/251 (58.57%), Query Frame = 3
Query:  912 LFGSQVN-RNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHH-LRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            LFG   N  + K IG ID   N+ +++ DAY+ A  LC+ YY V+PE+ V   N                           A ++ I + Y+PSHL+HM FEL KN++RA VE H   ++  P V  LV   +E+++IKI D GGG+P   +D +F Y ++TA   P  +   + + P+AG+GYGLP+SRLYARYF GDL L S+EG GTDA+IYL+    E+ E LP+FNK++ R Y  +   A DWSNP
Sbjct:  171 LFGGDTNPAHPKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAK-------------------------APNKPIQVVYVPSHLFHMLFELFKNSMRATVELHEDKKEGYPAVKTLVTLGKEDLSIKISDLGGGVPLRKIDRLFNYMYSTA---PRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKALSSESFERLPVFNKSAWRHYKTTP-EADDWSNP 392          

HSP 2 Score: 159.458 bits (402), Expect = 9.444e-42
Identity = 83/169 (49.11%), Postives = 108/169 (63.91%), Query Frame = 3
Query:   69 LFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFG-ENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLK-SDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
             +  L   + K   R S+++P+PLS+K+F+ FG +NA    S+ FL+KELPVRLAN M+E+ LLPDNL     V  V   Y +SF ELL++EN    D   + +F + + NIR RHN VV T AQGV+E KE FG D       QYFLDRF+ NRIS RMLI+QH + F
Sbjct:    4 FYRLLKQPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANTMREVNLLPDNLLNRPSVGLVQSWYMQSFLELLEYENKSPEDPRVLDNFLNVLINIRNRHNDVVPTMAQGVIEYKEKFGFDPFISSNIQYFLDRFYTNRISFRMLINQHTLLF 172          
BLAST of Protein-serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q15120|PDK3_HUMAN ([Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Homo sapiens OX=9606 GN=PDK3 PE=1 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 2.978e-54
Identity = 106/251 (42.23%), Postives = 146/251 (58.17%), Query Frame = 3
Query:  912 LFGSQVNR-NLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLR-DTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            LFG   N  + K IG ID   N+ +++ DAY+ A  LC+ YY V+PE+ V   N                           A  + I + Y+PSHL+HM FEL KN++RA VE +  R +  P V  LV   +E+++IKI D GGG+P   +D +F Y ++TA   P  +   + + P+AG+GYGLP+SRLYARYF GDL L S+EG GTDA+IYL+    E+ E LP+FNK++ R Y  +   A DWSNP
Sbjct:  171 LFGGDTNPVHPKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAK-------------------------APDKPIQVVYVPSHLFHMLFELFKNSMRATVELYEDRKEGYPAVKTLVTLGKEDLSIKISDLGGGVPLRKIDRLFNYMYSTA---PRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKALSSESFERLPVFNKSAWRHYKTTP-EADDWSNP 392          

HSP 2 Score: 156.762 bits (395), Expect = 7.405e-41
Identity = 84/170 (49.41%), Postives = 108/170 (63.53%), Query Frame = 3
Query:   69 LFSALSGQ-IAKDFIRCSKYTPTPLSLKKFVQFG-ENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLK-SDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            LF  L  Q + K   R S+++P+PLS+K+F+ FG +NA    S+ FL+KELPVRLAN M+E+ LLPDNL     V  V   Y +SF ELL++EN    D   + +F   +  +R RHN VV T AQGV+E KE FG D       QYFLDRF+ NRIS RMLI+QH + F
Sbjct:    3 LFRWLLKQPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANTMREVNLLPDNLLNRPSVGLVQSWYMQSFLELLEYENKSPEDPQVLDNFLQVLIKVRNRHNDVVPTMAQGVIEYKEKFGFDPFISTNIQYFLDRFYTNRISFRMLINQHTLLF 172          
BLAST of Protein-serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q15119|PDK2_HUMAN ([Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Homo sapiens OX=9606 GN=PDK2 PE=1 SV=2)

HSP 1 Score: 190.274 bits (482), Expect = 4.506e-53
Identity = 102/247 (41.30%), Postives = 140/247 (56.68%), Query Frame = 3
Query:  918 GSQVNRNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            GS    + K IG ID   N+ E++ DAYD A  LC  YY  SP++ +  IN                              + I M Y+PSHLYHM FEL KNA+RA VE H     LPP+ V+V   +E+++IK+ D GGG+P   ++ +F Y ++TA     T    +   P+AG+GYGLP+SRLYA+YF GDL L S+EGFGTDA+IYL+    ++ E LP++NK++ R Y  +   A DW  P
Sbjct:  178 GSTNPAHPKHIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEIN-------------------------AANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTAP----TPQPGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAWRHY-QTIQEAGDWCVP 394          

HSP 2 Score: 154.451 bits (389), Expect = 5.630e-40
Identity = 77/153 (50.33%), Postives = 105/153 (68.63%), Query Frame = 3
Query:  117 SKYTPTPLSLKKFVQFGE-NARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQF-ENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            SK++P+PLS+K+F+ FG  NA    SF FL++ELPVRLANIM+EI LLPD +  T  V+ V   Y +S  ++++F +    D  T+  FTD +  IR RHN VV T AQGV+E K+ +G D  +    QYFLDRF+++RISIRMLI+QH + F
Sbjct:   24 SKFSPSPLSMKQFLDFGSSNACEKTSFTFLRQELPVRLANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIF 176          
BLAST of Protein-serine/threonine kinase vs. UniProt/SwissProt
Match: sp|O02623|PDK_ASCSU ([Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Ascaris suum OX=6253 PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 3.304e-52
Identity = 100/248 (40.32%), Postives = 146/248 (58.87%), Query Frame = 3
Query:  912 LFGSQVNRNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSN 1655
            +FG  +  + + IG ID   ++  ++ DAY+NA  LC+ YY  +P +++ + N                                I +  +PSHLYH+ FEL KN++RA VE H   + LPP+ V+V    E+++IKI D GGG+  +++D +F Y ++TA   P          P+AGYGYGLPLSRLYARYF+GD+ L S+EG+GTDA+I+L+  P EA E+LPI++ +S RQ T S   AADWS+
Sbjct:  172 VFGVVLPESPRHIGCIDPGCDVESVVHDAYENARFLCERYYLTAPGMKLEMHN-------------------------SVNPGMPISIVAVPSHLYHIMFELFKNSMRATVENHGADEDLPPIKVMVVRGAEDLSIKISDRGGGVSRTILDRLFTYMYSTAPPPPRD----GTQPPLAGYGYGLPLSRLYARYFHGDMYLVSMEGYGTDAMIFLKAIPVEASEVLPIYSTSSRRQLTMSP-QAADWSH 389          

HSP 2 Score: 146.362 bits (368), Expect = 3.916e-37
Identity = 73/167 (43.71%), Postives = 108/167 (64.67%), Query Frame = 3
Query:   69 LFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFGENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            L    +  IA+     S++ P+ L++++++ FG+      SF FLK EL VRLANIMQEI LLP  L +    + V   Y +SF +LLQFE+ + +   +  F D +  I +RH+ VVET A+G++E++E+ G+D ++E   QYFLDRF+INRISIRML +QH + F
Sbjct:    7 LLGPFTSAIARKLEHYSQFQPSSLTIQQYLDFGQTGTMKSSFLFLKNELLVRLANIMQEISLLPPTLLKMPSRRLVSNWYCESFEDLLQFEHAQVEPDIMSKFNDQLQTILKRHSRVVETMAEGLIELRESEGVDIASERGIQYFLDRFYINRISIRMLQNQHLVVF 173          
BLAST of Protein-serine/threonine kinase vs. TrEMBL
Match: A0A3Q0KH84 (Protein-serine/threonine kinase OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 2.805e-84
Identity = 138/265 (52.08%), Postives = 180/265 (67.92%), Query Frame = 3
Query:  912 LFGSQVNRNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQS-----PSTTSL------MSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNPHFRSG 1673
            +FGS++N++ +++G ID   N+ EIL DA+++A  LC+HYY  +PE+ V V + D+                             ++  Y+PSHLYH+ FELLKNA+RAVVE H   D LPP+ VL+   QEN+TIKI D GGGIP S MDLVF YT+TTA+Q+     PS +S+         + PMAGYGYGLPLSRLYA+YFNGDL LSSVEG+GTDAI+YL+R   EADELLP+FN+TSA+QY +++IP ADWSNPH  +G
Sbjct:  171 MFGSELNKHRRYVGSIDPDCNVREILDDAHEDAKFLCEHYYSAAPEMEVRVHSGDNAK---------------------------VEFVYVPSHLYHILFELLKNAMRAVVEYHSSADHLPPIKVLIATGQENVTIKISDLGGGIPRSQMDLVFNYTYTTARQAERCGEPSLSSMELGPPDQGTNAPMAGYGYGLPLSRLYAKYFNGDLILSSVEGYGTDAIVYLKRNAAEADELLPVFNRTSAKQYGSASIPVADWSNPHITTG 408          

HSP 2 Score: 176.792 bits (447), Expect = 1.215e-45
Identity = 89/172 (51.74%), Postives = 115/172 (66.86%), Query Frame = 3
Query:   54 MKISGLFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFGENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            M++S     LSG+ A  FIR   YTPTPLSLKK + FG+     +S +FL  ELPVRLANI+QEI LLP+ L  T     V   YE+SF EL+ FE ++ D  ++  F + +A+IR RH +VVET AQGVME++ N+  D  T  Q QYFLDRF++ RISIRML+SQH + F
Sbjct:    1 MRLSQTIFILSGKFADHFIRFGGYTPTPLSLKKLIAFGKVGSVQKSASFLAYELPVRLANILQEIHLLPERLVRTPSASLVRRWYEQSFCELMDFEKIEWDEKSLNQFNEILASIRSRHTTVVETMAQGVMEMQGNYKTDIVTNNQVQYFLDRFYMMRISIRMLLSQHLLMF 172          
BLAST of Protein-serine/threonine kinase vs. TrEMBL
Match: A0A3R7JQ23 (Protein-serine/threonine kinase OS=Clonorchis sinensis OX=79923 GN=Pdk PE=3 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 4.505e-81
Identity = 144/286 (50.35%), Postives = 180/286 (62.94%), Query Frame = 3
Query:  870 I*YSQQRLYELEVSL----------FGSQVNRNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEEC-AKHRVIDMYYIPSHLYHMSFELLKNALRAVVECH-HLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQS------PSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNPHFRSG 1673
            I Y   R + + +SL          FGS+ ++  +FIG ID   N+LEI+ DAY +A  LC+HYY V+P++ V                            E C A    +D  Y+PSHLYH+ FELLKNALRAVVE H +    LPP+NVLV    EN+TIKI D GGGIPHS MDL+F YT+TTA          S ++ +  + PMAGYGYGLPLSRLYA+YFNGDL L+SVEG+GTDAI+YL+R   EADE++PIFN+TSARQY  S +P ADWSNP F +G
Sbjct:  147 IQYFLDRFFMMRISLRMLLNQHLLTFGSEFDKQRRFIGSIDPACNVLEIMEDAYGDARYLCEHYYSVAPQLVV----------------------------ETCGAPQGQMDFVYVPSHLYHILFELLKNALRAVVEHHGNSSSDLPPINVLVAVGHENITIKISDLGGGIPHSQMDLIFNYTYTTAHGKDRRPLGESASNDLDTNAPMAGYGYGLPLSRLYAKYFNGDLILTSVEGYGTDAIVYLKRNAAEADEIIPIFNRTSARQYEISGVPVADWSNPQFTTG 404          

HSP 2 Score: 155.606 bits (392), Expect = 5.486e-38
Identity = 77/172 (44.77%), Postives = 109/172 (63.37%), Query Frame = 3
Query:   54 MKISGLFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFGENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            M+++  F A SG+ A+ F++   Y PTPLSLKK + FG     ++S  FL+ EL VR+ANIMQE+ LLP+ L  T     V   YE+SF  L+ +E ++ +  +++ F   +A IR RH + VET AQGVME++     D  T    QYFLDRFF+ RIS+RML++QH + F
Sbjct:    1 MRVTTTFRAFSGKYAEKFVQYGAYCPTPLSLKKLISFGRVGSAAKSAAFLRDELAVRIANIMQELHLLPEALIRTPSALIVERWYEQSFCHLVDYEGIEWNEKSLEKFNHTLAEIRHRHTTTVETMAQGVMEMEAQNKADPITNNHIQYFLDRFFMMRISLRMLLNQHLLTF 172          
BLAST of Protein-serine/threonine kinase vs. TrEMBL
Match: A0A504YAN0 (Protein-serine/threonine kinase OS=Fasciola gigantica OX=46835 GN=FGIG_03617 PE=3 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 2.734e-80
Identity = 133/258 (51.55%), Postives = 168/258 (65.12%), Query Frame = 3
Query:  912 LFGSQVNRNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTA----KQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNPHFRSG 1673
            +FGS++N++ +F G ID   N+LEIL DAY++A  LC+HYY  +P I V  +  D                              I+  Y+PSHLYH+ FELLKNA+RAVVE      +LPP+ VLV   +E++TIKI D GGGIP S M+ VF YT+TTA    K  P      S + P+AGYGYGLPLSRLYA+YFNGDL L+SVEG+GTDAI+YL+R   +ADELLP+FN+TSARQY  + IP ADWSNP F +G
Sbjct:  171 MFGSELNKHRRFAGSIDPDCNVLEILEDAYEDAKFLCEHYYSTAPTITVDTVGADKGK---------------------------IEFVYVPSHLYHILFELLKNAMRAVVEQKSRDTSLPPIEVLVAAGKESVTIKISDLGGGIPRSDMEFVFNYTYTTARGGDKNKPPEPIGESGNAPLAGYGYGLPLSRLYAKYFNGDLILASVEGYGTDAIVYLKRNAADADELLPVFNRTSARQYGTAGIPVADWSNPQFTTG 401          

HSP 2 Score: 163.696 bits (413), Expect = 6.078e-41
Identity = 83/172 (48.26%), Postives = 109/172 (63.37%), Query Frame = 3
Query:   54 MKISGLFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFGENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            M++S     L+G  A+ F++   Y+P PLSLKK   F +     +S  FL+ ELPVRLANIMQEI LLPD L +T     V   YE+SF EL++FE+   D   + +F + +A IR RH + VET AQGVME++E    D  T  Q QYFLDRF++ RISIRMLI+ H + F
Sbjct:    1 MRVSLRLLKLTGTFAEKFVKYGAYSPIPLSLKKLTAFAQGGCAVKSATFLRDELPVRLANIMQEIQLLPDQLIQTPSASLVNHWYEQSFCELMEFESAAFDEKLLTNFNERLAQIRNRHTTTVETMAQGVMEMQERHKTDLITNNQVQYFLDRFYMMRISIRMLINHHLLMF 172          
BLAST of Protein-serine/threonine kinase vs. TrEMBL
Match: A0A4E0RUT7 (Protein-serine/threonine kinase OS=Fasciola hepatica OX=6192 GN=D915_004325 PE=3 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 1.021e-79
Identity = 132/259 (50.97%), Postives = 170/259 (65.64%), Query Frame = 3
Query:  912 LFGSQVNRNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAK-----QSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNPHFRSG 1673
            +FGS++N++ +F G ID   N+LEIL DAY++A  LC+HYY  +P I V  +  D                              I+  Y+PSHLYH+ FELLKNA+RA+VE      +LPP+ VLV   +E++TIKI D GGGIP S M+ VF YT+TTA+     +SP       N+ P+AGYGYGLPLSRLYA+YFNGDL L+SVEG+GTDAI+YL+R   +ADELLP+FN+TSARQY  + IP ADWSNP F +G
Sbjct:  171 MFGSELNKHRRFAGSIDPDCNVLEILEDAYEDAKFLCEHYYSTAPTITVDTVGADKGK---------------------------IEFVYVPSHLYHILFELLKNAMRAIVEQKSRDTSLPPIEVLVAAGKESVTIKISDLGGGIPRSDMEFVFNYTYTTARGGDKHKSPEPIGESGNA-PLAGYGYGLPLSRLYAKYFNGDLILASVEGYGTDAIVYLKRNAADADELLPVFNRTSARQYGTAGIPVADWSNPQFTTG 401          

HSP 2 Score: 164.466 bits (415), Expect = 3.830e-41
Identity = 83/172 (48.26%), Postives = 109/172 (63.37%), Query Frame = 3
Query:   54 MKISGLFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFGENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            M++S     L+G  A+ F++   Y+P PLSLKK   F +     +S  FL+ ELPVRLANIMQEI LLPD L +T     V   YE+SF EL++FE+   D   + +F + +A IR RH + VET AQGVME++E    D  T  Q QYFLDRF++ RISIRMLI+ H + F
Sbjct:    1 MRVSPRLLKLTGTFAEKFVKYGAYSPIPLSLKKLTAFAQGGCAVKSATFLRDELPVRLANIMQEIQLLPDQLIQTPSASLVNHWYEQSFCELMEFESATFDEKLLTNFNERLAQIRNRHTTTVETMAQGVMEMQERHKTDLITNNQVQYFLDRFYMMRISIRMLINHHLLMF 172          
BLAST of Protein-serine/threonine kinase vs. TrEMBL
Match: A0A5J4N9U0 (Protein-serine/threonine kinase OS=Paragonimus westermani OX=34504 GN=DEA37_0005321 PE=3 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 2.510e-79
Identity = 136/278 (48.92%), Postives = 176/278 (63.31%), Query Frame = 3
Query:  876 YSQQRLYELEVSL----------FGSQVNRNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAK-----QSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNPHF 1664
            Y   R Y + +SL          FGS++N++ +F+G +D   N+LEIL DAY++A  LC+HYY  +PE+ V                               A    I+  Y+PSHLYH+ FELLKNA+RAVVE H    +LP + VLV    EN+TIKI D GGGIP S M+ VF YT+TTA+     ++ +  S    + PMAGYGYGLPLSRLYA+YFNGDL L+SVEG+GTDAI+YL+R   +ADE+LP+FN+TSARQY + +IP ADWSNPHF
Sbjct:  149 YFLDRFYMMRISLRMLINQHLLMFGSELNKHRRFVGSVDPDCNVLEILEDAYEDAKYLCEHYYSTAPEMVVETFG---------------------------ASDGKIEFVYVPSHLYHIIFELLKNAMRAVVEQHGRTGSLPSIEVLVAAGLENVTIKISDLGGGIPRSEMEYVFNYTYTTARGGAIIRNENPGSEGGGNAPMAGYGYGLPLSRLYAKYFNGDLILASVEGYGTDAIVYLKRNAADADEVLPVFNRTSARQYGSVSIPIADWSNPHF 399          

HSP 2 Score: 161.384 bits (407), Expect = 4.339e-40
Identity = 83/172 (48.26%), Postives = 109/172 (63.37%), Query Frame = 3
Query:   54 MKISGLFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFGENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            M++     AL+G+ A+ F++   Y+PTPLSLKK + FG      +S  FL  ELPVRLANIMQEI LLP+ L +T     V   YE SF +L+ FE+   +  ++  F   +A IR RH + VET AQGVME+KE    D  T  Q QYFLDRF++ RIS+RMLI+QH + F
Sbjct:    1 MRLYQALMALTGKYAEKFVKNGAYSPTPLSLKKLISFGLVGSAEKSAAFLCDELPVRLANIMQEIQLLPEQLIQTPSASIVKRWYELSFCDLIDFEDTHWNEDSLNKFNRQLAQIRNRHTTTVETMAQGVMEMKERHKTDLITNNQVQYFLDRFYMMRISLRMLINQHLLMF 172          
BLAST of Protein-serine/threonine kinase vs. Ensembl Cavefish
Match: PDK3 (pyruvate dehydrogenase (acetyl-transferring) kinase isozyme 3, mitochondrial-like [Source:NCBI gene;Acc:103028931])

HSP 1 Score: 190.66 bits (483), Expect = 3.860e-54
Identity = 104/251 (41.43%), Postives = 145/251 (57.77%), Query Frame = 3
Query:  912 LFGSQVN-RNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDT-LPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            LFG   N  + K IG ID   N++E++ DAY+ A  LC+ YY ++PE+ +   N                             +R + + Y+PSHL+HM FEL KN++RA VE H   +  LPPV  LV   +E+++IKI D GGG+P   +D +F Y ++TA      +S    + P+AG+GYGLP+SRLYARYF GD+ L S+EG GT A+IYL+    E+ E LP+FNK++ R Y      A DWSNP
Sbjct:  170 LFGDDTNPAHPKHIGGIDPNCNVVEVVRDAYETAKMLCEKYYMMAPELHIKEFNTK-------------------------KPNRPVQVVYVPSHLFHMLFELFKNSMRATVELHENSEKGLPPVKALVTLGKEDLSIKISDQGGGVPLRKIDRLFNYMYSTAPTPRLNSS--EAAAPLAGFGYGLPISRLYARYFQGDMNLYSLEGVGTHAVIYLKALSSESFERLPVFNKSAWRHY-QLGPEADDWSNP 392          

HSP 2 Score: 155.606 bits (392), Expect = 2.340e-41
Identity = 82/169 (48.52%), Postives = 105/169 (62.13%), Query Frame = 3
Query:   69 LFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFG-ENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLK-SDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            LF  L   +       S+++P+P+S+K+F+ FG ENA    S+ FL+KELPVRLAN M+E+ LLP NL     V+ V   Y +SF ELL +EN    D  T+  F D +  IR RHN VV T AQGV+E KE FG D       QYFLDRF+ +RIS RMLI+QH + F
Sbjct:    3 LFELLLKDVTPKIEFYSRFSPSPMSIKQFLDFGRENACEKTSYMFLRKELPVRLANTMREVTLLPGNLLSQPSVQLVQSWYSQSFVELLDYENRSPDDPRTLNDFLDILIQIRNRHNDVVPTMAQGVIEYKEKFGFDPFISSNVQYFLDRFYTSRISFRMLINQHTLLF 171          
BLAST of Protein-serine/threonine kinase vs. Ensembl Cavefish
Match: pdk4 (pyruvate dehydrogenase kinase 4 [Source:NCBI gene;Acc:103027445])

HSP 1 Score: 189.889 bits (481), Expect = 9.637e-54
Identity = 98/239 (41.00%), Postives = 140/239 (58.58%), Query Frame = 3
Query:  942 KFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            K IG ID   +++E++ DAY+++  LC  YY  SPE+ +  +N                             +  I++ Y+PSHLYHM FEL KNA+RA VE H     LPP+ V V    E++TIK+ D GGG+P   ++ +F Y ++TA   PS     + + P+AG+GYGLP+SRLYA+YF GD+ L S+EG+GT A+IYL+    E+ E LP+FN+++ R Y  S I A DW  P
Sbjct:  186 KHIGSIDPNCDVVEVVKDAYESSRMLCDQYYLTSPEVEIKQVNSK-------------------------EPNEPINIVYVPSHLYHMLFELFKNAMRATVETHENSTHLPPIKVRVSLGSEDLTIKMSDRGGGVPLRKIERLFSYMYSTA---PSPVHDNARNAPLAGFGYGLPISRLYAKYFQGDIQLYSMEGYGTAAVIYLKALSTESVERLPVFNRSALRHYQTS-IEADDWCIP 395          

HSP 2 Score: 156.762 bits (395), Expect = 1.265e-41
Identity = 83/169 (49.11%), Postives = 110/169 (65.09%), Query Frame = 3
Query:   69 LFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFGE-NARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQF-ENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            L +A    I K   R SK++P+PLS+K+F+ FG  NA    SF FL++ELPVRLANIM+EI  LPD L  T  V+ +   Y +S  EL+ F E    D + +  FT+ + N+R RHN+VV T AQGV+E KE FG+D  T    QYFLDRF+ +RIS RML++QH + F
Sbjct:    8 LKNASKFNIPKQVDRFSKFSPSPLSMKQFIDFGSANACEKTSFIFLRQELPVRLANIMKEIDFLPDKLISTPSVQLLHSWYAQSLMELVDFLEKDPDDKNVLTMFTETLINVRNRHNNVVPTMAQGVVEYKEAFGVDPVTNQNVQYFLDRFYTSRISTRMLMNQHTLIF 176          
BLAST of Protein-serine/threonine kinase vs. Ensembl Cavefish
Match: pdk3a (pyruvate dehydrogenase (acetyl-transferring) kinase isozyme 3, mitochondrial [Source:NCBI gene;Acc:103043532])

HSP 1 Score: 189.119 bits (479), Expect = 1.359e-53
Identity = 106/252 (42.06%), Postives = 146/252 (57.94%), Query Frame = 3
Query:  912 LFGSQVN-RNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDT-LPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAA-DWSNP 1658
            LFG+  N  + K IG ID   ++ +++ DA++ A  LC+ YY  +P +++   N                           A  + I   Y+PSHL+HM FEL KNA+RA VE H   +T LP +   V   +E+++IKI D GGG+    +D +F YT++TA     T SL S  VP+AG+G+GLP+SRLYARYF GDL L S+EG GTDA+IYL+    E+ E LP+FNK++ R Y     P A DWSNP
Sbjct:  171 LFGNDTNPAHPKHIGSIDPACSVADVVTDAFETAKMLCEQYYPAAPGLKIEEFNAK-------------------------APKKPIQAVYVPSHLFHMLFELFKNAMRATVEHHEEDETDLPIIKAKVTLGKEDLSIKISDKGGGVALRKIDRLFNYTYSTA----PTPSLESKRVPLAGFGHGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKALSSESFERLPVFNKSAWRHYQGG--PGADDWSNP 391          

HSP 2 Score: 152.91 bits (385), Expect = 1.845e-40
Identity = 77/153 (50.33%), Postives = 102/153 (66.67%), Query Frame = 3
Query:  117 SKYTPTPLSLKKFVQFG-ENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLK-SDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            S+++P+PLS+K+F++FG +NA    S+ FL+KELPVRLAN M+E+ LLPD L     V+ V   Y +SF ELL++EN    D   +  F + +  IR RHN VV T AQG++E KE FG D       QYFLDRF+ NRIS RMLI+QH + F
Sbjct:   20 SRFSPSPLSIKQFLEFGRDNACEKTSYMFLRKELPVRLANTMREVNLLPDKLLSQPSVRLVQKWYMQSFVELLEYENRSPDDPHALNDFLEALIEIRNRHNDVVPTMAQGLIEYKEKFGFDPFVTSNIQYFLDRFYTNRISFRMLINQHTLLF 172          
BLAST of Protein-serine/threonine kinase vs. Ensembl Cavefish
Match: pdk1 (pyruvate dehydrogenase kinase 1 [Source:NCBI gene;Acc:103033744])

HSP 1 Score: 187.963 bits (476), Expect = 3.443e-53
Identity = 104/252 (41.27%), Postives = 147/252 (58.33%), Query Frame = 3
Query:  912 LFGSQVNRNL---KFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            LFG +V  N    K IG ID    + +++ DAY+NA +LC  YY  SPE+++   N                       ++E  K   I + Y+PSHLYHM FEL KNA+RA +E +      PP+NV +    E++T+K+ D GGG+P   +D +F YT++TA   P      + + P+AGYGYGLP+SRLYARYF GDL L S+EG+GTDA+IY+R    E+ E LP++NK++ + Y  +   A DW  P
Sbjct:  172 LFGGRVRVNPAHPKQIGGIDPHCRVTDVVKDAYENARSLCDRYYMNSPELQLEEFN-----------------------VKEPNKP--ITVVYVPSHLYHMVFELFKNAMRATMELYGDAMEYPPINVRIALGNEDLTVKVSDHGGGVPLRKIDRLFTYTYSTA---PRPQMDAARAAPLAGYGYGLPISRLYARYFQGDLKLYSLEGYGTDAVIYIRALSSESIERLPVYNKSAWKHY-KTIHEADDWCVP 394          

HSP 2 Score: 160.229 bits (404), Expect = 4.340e-43
Identity = 81/164 (49.39%), Postives = 112/164 (68.29%), Query Frame = 3
Query:   84 SGQIAKDFIRCSKYTPTPLSLKKFVQFG-ENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTVQ-SFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            +  I K   + S+++P+PLS+K+F+ FG +NA    SF FL++ELPVRLANIM+EI LLPDNL  T  V+ V   Y +S  ++L+F++  ++   V   FTD +  IR RHN VV T AQGV+E KE +G D  T    QYFLDRF+++RISIRML++QH + F
Sbjct:   10 NASIGKLVDQYSRFSPSPLSMKQFLDFGSDNACEKTSFTFLRQELPVRLANIMKEINLLPDNLLRTPSVRLVQSWYMQSLKDILEFKDRDANDEKVTFDFTDAVIKIRNRHNDVVPTMAQGVVEYKEAYGTDPITSQNMQYFLDRFYMSRISIRMLLNQHTLLF 173          
BLAST of Protein-serine/threonine kinase vs. Ensembl Cavefish
Match: ENSAMXT00000024993.2 (pyruvate dehydrogenase (acetyl-transferring) kinase isozyme 2, mitochondrial-like [Source:NCBI gene;Acc:103035067])

HSP 1 Score: 187.193 bits (474), Expect = 7.681e-53
Identity = 98/237 (41.35%), Postives = 138/237 (58.23%), Query Frame = 3
Query:  948 IGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            IG ID    + E++ DAY+ A  LC+ YY   PE+++  IN ++                         K   I + Y+PSHLYH+ FEL KN++RA +E H    +LPP+ V+V    E+++IK+ D GGG+P   ++ +F Y ++TA +   TT       P+AGYGYGLPLSRLY RYF GDL L  +EGFGTDAII+++    ++ E LP+FNKT+ R Y +S   A DW  P
Sbjct:  187 IGCIDPNCKVTEVMEDAYECAKLLCEQYYMCFPELKLQEINVNN-------------------------KTEPIRISYVPSHLYHVLFELFKNSMRATIENHECSSSLPPIKVMVALGGEDLSIKMSDRGGGVPSRKIERLFSYMYSTAPRPEITTQ---RRTPLAGYGYGLPLSRLYIRYFQGDLQLYPLEGFGTDAIIHMKALSTDSVEKLPVFNKTALRHYKSSQ-EADDWCVP 394          

HSP 2 Score: 152.525 bits (384), Expect = 2.584e-40
Identity = 84/178 (47.19%), Postives = 110/178 (61.80%), Query Frame = 3
Query:   42 LKFNMKISGLFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFGE-NARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQF-ENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            ++F M+ + L       + K     SK++P+PLS+K+F+ FG  NA    SF FL++ELPVRLANIM+EI LLP  L  T   + V   Y +S  ELL F +    D   +Q F + +  IR RHN VV T AQGV+E KE FG D  T    QYFLDRF+++RISIRMLI+QH + F
Sbjct:    4 VRFIMRNAAL-----ANVPKHVDHFSKFSPSPLSMKQFLDFGSINACEKTSFKFLRQELPVRLANIMKEIRLLPPRLLSTPSAQLVHSWYVQSLMELLDFLDKSPEDHVVLQDFVEALVAIRNRHNDVVPTMAQGVIEYKEAFGQDPVTSQNIQYFLDRFYMSRISIRMLINQHTLIF 176          
BLAST of Protein-serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003108.1 (pep scaffold:Pmarinus_7.0:GL477025:51675:72049:1 gene:ENSPMAG00000002802.1 transcript:ENSPMAT00000003108.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 181.03 bits (458), Expect = 2.751e-51
Identity = 99/239 (41.42%), Postives = 139/239 (58.16%), Query Frame = 3
Query:  942 KFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            K IG ID    + E++ DA+D+A  LC  YY   P++++   N  +                             I   Y+PSHL+HM FELLKNA+RA VE HH     PPV+VL+    E++TIK+ D GGG+P   ++ +F Y ++TA   P   + +S + P+AG+G+GLP+SRLYA+YFNGDL L S+EG GTDA+IYL+    E+ E LP+FN+++ R Y N    A DW  P
Sbjct:  186 KHIGTIDPTCQVAEVVQDAFDSAKQLCNQYYLGCPDVQIQQHNGKNPGLP-------------------------IQAVYVPSHLFHMLFELLKNAVRATVE-HHGESDFPPVHVLITLGPEDLTIKVSDQGGGVPLRKIERLFHYMYSTA---PPPHTDVSRAPPLAGFGFGLPISRLYAQYFNGDLKLYSMEGQGTDALIYLKALSSESVEKLPVFNRSAWRHYRNLH-EADDWCVP 394          

HSP 2 Score: 147.517 bits (371), Expect = 3.069e-39
Identity = 82/173 (47.40%), Postives = 114/173 (65.90%), Query Frame = 3
Query:   63 SGLFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFG-ENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTV-QSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFFLL 575
            +GL  +L  Q+  +F   S+++P+PLS+K+F+ FG +NA    SF FL++ELPVRLAN M+EI LLPD L  T  V+ V   Y KS TE+L + +   D   V  +FT+ +  +R  H  VV T AQGVME KE  G+D +++   QYFLDRF+++RIS RMLI+QH + F L
Sbjct:   12 AGLSQSLLSQV--EFY--SRFSPSPLSIKQFLDFGYKNACERTSFIFLRQELPVRLANTMKEINLLPDKLLHTPSVQLVQSWYAKSMTEILGYVDKNPDDGKVLTNFTETLLEVRTLHKDVVPTMAQGVMEYKEVLGVDLASDRNVQYFLDRFYMSRISFRMLINQHALLFGL 180          
BLAST of Protein-serine/threonine kinase vs. Ensembl Sea Lamprey
Match: pdk4 (pyruvate dehydrogenase kinase, isozyme 4 [Source:ZFIN;Acc:ZDB-GENE-060503-754])

HSP 1 Score: 179.874 bits (455), Expect = 7.336e-51
Identity = 102/251 (40.64%), Postives = 147/251 (58.57%), Query Frame = 3
Query:  912 LFGSQVN-RNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHH-LRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            LF   +N  + K IG ID   N +E++ DA++NA  LC  YY   PE+ V+                 Q+N   + + EE      + M YIPSHLYH+ FEL KN++RA VE H  L    P + V+V   +E+++IK+ D GGG+P   ++ +F Y ++TA +    T+    + P+AG+GYGLP+SRLYARYF GD+ L S+EG+GTDA+IYL+    E+ E LP+FNK+  + Y  +   A DW  P
Sbjct:  174 LFNGSLNPAHPKHIGSIDPNCNAVEVVKDAFENAKMLCYQYYLGCPELEVS-----------------QFNI--QGAEEE------VHMVYIPSHLYHVLFELFKNSMRATVEHHDALGTAYPAIKVMVSLGKEDLSIKVSDRGGGVPLRKIERLFNYMYSTAPRPHIDTA---RAAPLAGFGYGLPISRLYARYFQGDIQLYSMEGYGTDAVIYLKALSSESVERLPVFNKSVFKHYQVNQ-EADDWCVP 395          

HSP 2 Score: 165.622 bits (418), Expect = 9.674e-46
Identity = 83/177 (46.89%), Postives = 117/177 (66.10%), Query Frame = 3
Query:   42 LKFNMKISGLFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFG-ENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            ++F MK +GL       + +     SK++P+PLS+K+F+ FG  NA    S+ FL++ELPVRLANIM+EI LLPDNL  T  V+ V   Y +SF ++L++E    +   +  F + + NIR RHN VV T AQGV+E KE +G+D  T    QYFLDRF+++RISIRM+I+QH + F
Sbjct:    4 VRFLMKNAGLV-----HLPRQLEHYSKFSPSPLSIKQFIDFGSRNACERTSYVFLRQELPVRLANIMKEINLLPDNLLSTPSVQLVQSWYVQSFMDILKYEGKDPESDVLSGFMETLVNIRNRHNDVVPTVAQGVIEYKETYGVDPVTSQNVQYFLDRFYMSRISIRMIINQHTLLF 175          
BLAST of Protein-serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001099.1 (pep scaffold:Pmarinus_7.0:GL480105:32238:43471:1 gene:ENSPMAG00000000977.1 transcript:ENSPMAT00000001099.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 149.828 bits (377), Expect = 1.430e-41
Identity = 76/175 (43.43%), Postives = 110/175 (62.86%), Query Frame = 3
Query:   60 ISGLFSALSGQIAKDFIRCSKYTPTPLSLKKFVQF----GENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDL-STVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            +  L  + +G I +     S+++P+PLS+K+F+       ENA    SF FL+ ELPVRL NIM+EI LLPD L +T  V+ V   Y +S  ++L +E    +  +T+  F + +  IR RHN VV T AQGV+E K+ +G+D  +    QYFLDRF+++RISIRMLI+QH + F
Sbjct:    5 VRALLQSGAGNIPRHIEHYSRFSPSPLSMKQFMGLRLTGSENACEKTSFTFLRHELPVRLCNIMKEINLLPDKLLQTPSVRLVQSWYNQSLLDMLDYERKDPEEDATLNIFVETLIKIRNRHNDVVPTMAQGVIEYKDAYGVDPVSSSNVQYFLDRFYMSRISIRMLINQHTLLF 179          

HSP 2 Score: 59.6918 bits (143), Expect = 3.047e-10
Identity = 36/105 (34.29%), Postives = 48/105 (45.71%), Query Frame = 3
Query:  912 LFGSQVN-RNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLK 1223
            LFG  VN  + K IG ID   +++ ++ DAY+NA  LC  YY  SPE+ +T  N                              + I +  +PSHLYHM FEL K
Sbjct:  178 LFGGGVNPAHPKHIGSIDPNCDVVGVIKDAYENAKMLCDQYYLASPELEITECNAQ-------------------------TPKQAIHVVNVPSHLYHMLFELFK 257          
BLAST of Protein-serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002673.1 (pep scaffold:Pmarinus_7.0:GL485541:1449:4237:1 gene:ENSPMAG00000002440.1 transcript:ENSPMAT00000002673.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.9005 bits (237), Expect = 8.285e-24
Identity = 53/120 (44.17%), Postives = 73/120 (60.83%), Query Frame = 3
Query: 1329 DCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMS----------NSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            D GGG+P   +D +F Y ++TA +    TS  +          +S   AG+GYGLPLSRLYARYF GD+ L S+EG GT A++YL+    E+ E LP++NK++ R Y + A  A DW  P
Sbjct:    1 DKGGGVPLRKIDRLFNYMYSTAPRPRMDTSRAAPLVRKPSGGRHSPVTAGFGYGLPLSRLYARYFQGDIHLYSMEGHGTSALVYLKALSSESVERLPVYNKSAWRHY-HEAHEADDWCVP 119          
BLAST of Protein-serine/threonine kinase vs. Ensembl Yeast
Match: PKP1 (Mitochondrial protein kinase; involved in negative regulation of pyruvate dehydrogenase complex activity by phosphorylating the ser-133 residue of the Pda1p subunit; acts in concert with kinase Pkp2p and phosphatases Ptc5p and Ptc6p [Source:SGD;Acc:S000001304])

HSP 1 Score: 60.4622 bits (145), Expect = 2.788e-10
Identity = 38/131 (29.01%), Postives = 68/131 (51.91%), Query Frame = 3
Query: 1182 IPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVP------MAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLR 1556
            IP  L ++  E+ KNA  A +     ++ +P    L+    + + ++I D GGGI   +  L+F Y+++T  Q  + +   S  +P      ++G G+GLP+ + Y   F G + + S+ G+GTD  I L+
Sbjct:  257 IPPILEYIMTEVFKNAFEAQIALG--KEHMPIEINLLKPDDDELYLRIRDHGGGITPEVEALMFNYSYSTHTQQSADSE--STDLPGEQINNVSGMGFGLPMCKTYLELFGGKIDVQSLLGWGTDVYIKLK 383          
BLAST of Protein-serine/threonine kinase vs. Ensembl Nematostella
Match: EDO42209 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S223])

HSP 1 Score: 197.208 bits (500), Expect = 7.901e-57
Identity = 110/256 (42.97%), Postives = 155/256 (60.55%), Query Frame = 3
Query:  912 LFGSQVNRNLK--FIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTN---SAIPAADWSNPHF 1664
            LFG +  R+ K  F+G  D   ++  I+ DA +NA  LC  YY  SPE+ V+  N                         E   H  I   Y+P+HLYHM FELLKNA+RAV E +     +PP+ V++   +E++TIKI D GGGIP S +D VF+Y ++TA + PST+  ++   P+AGYGYGLPLSRLYA+YF+GDL L S+EG+GTDA+I+L+    +A E+LP++N+ + + Y     SA  A+DWS+  F
Sbjct:  165 LFGHEAARSSKSNFVGCFDPNCHVASIVEDAANNARFLCDQYYCSSPELVVSEHN-----------------------AYESISH--IKFAYLPAHLYHMLFELLKNAMRAVTENYSTSVDMPPIQVMITKGREDLTIKISDKGGGIPRSKIDEVFEYHYSTAPE-PSTSGTVA---PLAGYGYGLPLSRLYAKYFDGDLQLYSMEGYGTDAVIWLKALSTDASEVLPMYNRRTPKNYEEVRASANYASDWSSSRF 391          

HSP 2 Score: 150.984 bits (380), Expect = 5.395e-40
Identity = 81/172 (47.09%), Postives = 117/172 (68.02%), Query Frame = 3
Query:   54 MKISGLFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFGENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            M+IS    AL   I+K   R S+Y  + LS++++  FG+NA+P +S+ F K ELPVRLA+I++EI LLP NL     V+ V   Y +SF+ELL+FE+   D      FT+ +A+I++RHN+VVET AQG+ME+++  G+ A      QYFLDRF++NRI IR+LI+QH + F
Sbjct:    1 MRIS---RALLRDISKLIQRYSRYQQSCLSIEQYTTFGKNAKPVDSYRFGKHELPVRLAHIIREIDLLPKNLLRMPSVELVRSWYVQSFSELLEFED--DDGEEANRFTETLAHIKQRHNNVVETMAQGIMELRQKEGLSA-FHPSIQYFLDRFYMNRIGIRILITQHLMLF 166          
BLAST of Protein-serine/threonine kinase vs. Ensembl Nematostella
Match: EDO37783 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SER7])

HSP 1 Score: 103.99 bits (258), Expect = 4.252e-24
Identity = 69/221 (31.22%), Postives = 108/221 (48.87%), Query Frame = 3
Query:  945 FIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLR-DTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTT----AKQSPSTTSLMSNSV------------PMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLR 1556
            +IG+I +Q N+ + +  + D A  +C+H YGV+P +   ++N                             H      YIPS L ++  EL+KNA+RA VE H  +   +P + V  C    +  ++I D GGGIP + +  +FKY+FTT    ++  PS    + + +            PMAG+G+GLP SR Y+ Y  G L + ++EG GTD  + LR
Sbjct:  176 YIGMICTQLNLKQAIERSSDFARQICEHLYGVAPGV---IVN----------------------------GHTKAMFPYIPSPLEYILQELIKNAMRASVEYHGKQLMEVPNIVVTTCTNDTDFYVRISDRGGGIPENKLKDIFKYSFTTMGDRSQIRPSDGLGVFDDICQGHPNNSPSGGPMAGWGFGLPTSRAYSTYLGGSLQVQTMEGLGTDVYLRLR 365          

HSP 2 Score: 60.8474 bits (146), Expect = 6.588e-10
Identity = 38/142 (26.76%), Postives = 68/142 (47.89%), Query Frame = 3
Query:  132 TPLSLKKFVQFGENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQH 557
            TP  +    +F +     +S  +L KELP+R+A  +++   LP  +     +     LY ++FT L ++  +  +L + + F+  + N+ + H  VV   A+G  E K++   +         FLDR   +R+ IRML   H
Sbjct:   31 TPYQMLYAGKFKDGTHLLKSAQYLHKELPIRIARRLKDFQQLPYIILSNPSIHDTYELYLRAFTSLTKYPKI-DNLESEERFSHLVKNLLDNHQHVVTNLAEGFQECKQHVSYETMGN-----FLDRTLKSRLGIRMLAEHH 166          
BLAST of Protein-serine/threonine kinase vs. Ensembl Medaka
Match: pdk3a (pyruvate dehydrogenase kinase 3 [Source:NCBI gene;Acc:101171116])

HSP 1 Score: 203.371 bits (516), Expect = 7.015e-59
Identity = 110/251 (43.82%), Postives = 150/251 (59.76%), Query Frame = 3
Query:  912 LFGSQVN-RNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECH-HLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            LFG+  N  + K IG ID   N+ E++ DAYD A  LC+ YY  +PE+++   N                           A ++ I + Y+PSHL+HM FEL KN++RA VE H +  + LPPV   V   +E++++KI D GGG+P   +D +F Y ++TA     T SL   +VP+AG+GYGLP+SRLYARYF GDL L S+EG GTDA+IYL+    E+ E LP+FNK++ R Y  S   A DWSNP
Sbjct:  170 LFGNDTNPAHPKHIGSIDPTCNVAEVVKDAYDTAKMLCEKYYFAAPELKIEEFNMK-------------------------APNKPIQVVYVPSHLFHMLFELFKNSMRATVELHENSAEGLPPVKTRVTLGKEDLSVKISDKGGGVPLRKIDRLFNYMYSTA----PTPSLEPGAVPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKALSSESFERLPVFNKSAWRHYKTSP-EADDWSNP 390          

HSP 2 Score: 157.532 bits (397), Expect = 4.455e-42
Identity = 81/153 (52.94%), Postives = 102/153 (66.67%), Query Frame = 3
Query:  117 SKYTPTPLSLKKFVQFG-ENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLK-SDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            S+Y+P+PLS+K+F+ FG +NA    S+ FL+KELPVRLAN M+E+ LLPD L     V+ V   Y +SF ELL +EN K  D  T+  F + +  IR RHN VV T AQGV+E KE FG D       QYFLDRF+ NRIS RMLI+QH + F
Sbjct:   19 SRYSPSPLSIKQFLDFGRDNACEKTSYVFLRKELPVRLANTMREVNLLPDKLLSQPSVRLVQKWYMQSFVELLDYENRKPEDPHTLNDFLEVLIEIRNRHNDVVPTMAQGVIEYKEKFGFDPFVSSNIQYFLDRFYTNRISFRMLINQHTLLF 171          
BLAST of Protein-serine/threonine kinase vs. Ensembl Medaka
Match: pdk1 (pyruvate dehydrogenase kinase 1 [Source:NCBI gene;Acc:101161766])

HSP 1 Score: 192.971 bits (489), Expect = 4.161e-55
Identity = 105/250 (42.00%), Postives = 146/250 (58.40%), Query Frame = 3
Query:  912 LFGSQVN-RNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            LFG +VN  + K IG ID   ++ E++ DAY+NA NLC  YY  SP++ +   N                      + E  +   V+   Y+PSHLYHM FEL KNA+RA +E        PP+   V    E++T+K+ D GGG+P   +D +F YT++TA + PS     S+  P+AGYGYGLP+SRLYARYF GDL L S+EG+GTDA+IY+R    E+ E LP++NK++ + Y  +   A DW  P
Sbjct:  170 LFGGKVNPAHPKQIGSIDPHCHVTEVIKDAYENARNLCDRYYMNSPDLILEEFN----------------------AKEPGSPVTVV---YVPSHLYHMVFELFKNAMRATMELCGDTMECPPIQAQVALGSEDLTVKVSDRGGGVPMRKIDRLFTYTYSTAPR-PSIDG--SSGAPLAGYGYGLPISRLYARYFQGDLKLYSLEGYGTDAVIYIRALSTESIERLPVYNKSAWKHY-KTIHEADDWCVP 390          

HSP 2 Score: 167.162 bits (422), Expect = 1.312e-45
Identity = 84/161 (52.17%), Postives = 111/161 (68.94%), Query Frame = 3
Query:   93 IAKDFIRCSKYTPTPLSLKKFVQFG-ENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTV-QSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            + KD    SK++P+PLS+K+F+ FG ENA    SF FL++ELPVRLANIM+EI LLPDNL  TS V  V   Y +SF ++L+F++  +D   V   FTD +  IR RHN V+ T AQGV+E KE +G D       QYFLDRF+++RISIRML++QH + F
Sbjct:   11 VGKDIDYYSKFSPSPLSMKQFLDFGSENACEKTSFAFLRQELPVRLANIMKEINLLPDNLLRTSSVSLVQSWYMQSFQDILKFKDKNADNEKVTHEFTDAVIKIRNRHNDVIPTMAQGVVEYKETYGTDPVVSQNVQYFLDRFYMSRISIRMLLNQHTLLF 171          
BLAST of Protein-serine/threonine kinase vs. Ensembl Medaka
Match: pdk1 (pyruvate dehydrogenase kinase 1 [Source:NCBI gene;Acc:101161766])

HSP 1 Score: 192.586 bits (488), Expect = 6.113e-55
Identity = 104/250 (41.60%), Postives = 145/250 (58.00%), Query Frame = 3
Query:  912 LFGSQVN-RNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            LFG +VN  + K IG ID   ++ E++ DAY+NA NLC  YY  SP++ +   N +   S                          + + Y+PSHLYHM FEL KNA+RA +E        PP+   V    E++T+K+ D GGG+P   +D +F YT++TA + PS     S+  P+AGYGYGLP+SRLYARYF GDL L S+EG+GTDA+IY+R    E+ E LP++NK++ + Y  +   A DW  P
Sbjct:  172 LFGGKVNPAHPKQIGSIDPHCHVTEVIKDAYENARNLCDRYYMNSPDLILEEFNGNKPGSP-------------------------VTVVYVPSHLYHMVFELFKNAMRATMELCGDTMECPPIQAQVALGSEDLTVKVSDRGGGVPMRKIDRLFTYTYSTAPR-PSIDG--SSGAPLAGYGYGLPISRLYARYFQGDLKLYSLEGYGTDAVIYIRALSTESIERLPVYNKSAWKHY-KTIHEADDWCVP 392          

HSP 2 Score: 167.162 bits (422), Expect = 1.498e-45
Identity = 84/161 (52.17%), Postives = 111/161 (68.94%), Query Frame = 3
Query:   93 IAKDFIRCSKYTPTPLSLKKFVQFG-ENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTV-QSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            + KD    SK++P+PLS+K+F+ FG ENA    SF FL++ELPVRLANIM+EI LLPDNL  TS V  V   Y +SF ++L+F++  +D   V   FTD +  IR RHN V+ T AQGV+E KE +G D       QYFLDRF+++RISIRML++QH + F
Sbjct:   13 VGKDIDYYSKFSPSPLSMKQFLDFGSENACEKTSFAFLRQELPVRLANIMKEINLLPDNLLRTSSVSLVQSWYMQSFQDILKFKDKNADNEKVTHEFTDAVIKIRNRHNDVIPTMAQGVVEYKETYGTDPVVSQNVQYFLDRFYMSRISIRMLLNQHTLLF 173          
BLAST of Protein-serine/threonine kinase vs. Ensembl Medaka
Match: pdk1 (pyruvate dehydrogenase kinase 1 [Source:NCBI gene;Acc:101161766])

HSP 1 Score: 192.971 bits (489), Expect = 6.516e-55
Identity = 105/250 (42.00%), Postives = 146/250 (58.40%), Query Frame = 3
Query:  912 LFGSQVN-RNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            LFG +VN  + K IG ID   ++ E++ DAY+NA NLC  YY  SP++ +   N                      + E  +   V+   Y+PSHLYHM FEL KNA+RA +E        PP+   V    E++T+K+ D GGG+P   +D +F YT++TA + PS     S+  P+AGYGYGLP+SRLYARYF GDL L S+EG+GTDA+IY+R    E+ E LP++NK++ + Y  +   A DW  P
Sbjct:  177 LFGGKVNPAHPKQIGSIDPHCHVTEVIKDAYENARNLCDRYYMNSPDLILEEFN----------------------AKEPGSPVTVV---YVPSHLYHMVFELFKNAMRATMELCGDTMECPPIQAQVALGSEDLTVKVSDRGGGVPMRKIDRLFTYTYSTAPR-PSIDG--SSGAPLAGYGYGLPISRLYARYFQGDLKLYSLEGYGTDAVIYIRALSTESIERLPVYNKSAWKHY-KTIHEADDWCVP 397          

HSP 2 Score: 162.925 bits (411), Expect = 6.161e-44
Identity = 85/166 (51.20%), Postives = 111/166 (66.87%), Query Frame = 3
Query:   93 IAKDFIRCSKYTPTPLSLKKFVQFG-ENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDL--STVQSF----TDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            + KD    SK++P+PLS+K+F+ FG ENA    SF FL++ELPVRLANIM+EI LLPDNL  TS V  V   Y +SF ++L+F++  S    ST   F    TD +  IR RHN V+ T AQGV+E KE +G D       QYFLDRF+++RISIRML++QH + F
Sbjct:   13 VGKDIDYYSKFSPSPLSMKQFLDFGSENACEKTSFAFLRQELPVRLANIMKEINLLPDNLLRTSSVSLVQSWYMQSFQDILKFKDKNSGFTHSTCNGFLIRFTDAVIKIRNRHNDVIPTMAQGVVEYKETYGTDPVVSQNVQYFLDRFYMSRISIRMLLNQHTLLF 178          
BLAST of Protein-serine/threonine kinase vs. Ensembl Medaka
Match: pdk4 (pyruvate dehydrogenase kinase 4 [Source:NCBI gene;Acc:101155612])

HSP 1 Score: 191.045 bits (484), Expect = 3.041e-54
Identity = 98/240 (40.83%), Postives = 143/240 (59.58%), Query Frame = 3
Query:  942 KFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSL-MSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNP 1658
            K IG ID   +++E++ DA++ +  LC+ YY  SP++ +T +N  +                           + + + Y+PSHLYHM FEL KNA+RA VE H    TLPP+ V +    E++TIK+ D GGG+P   ++ +F Y ++TA   PS   +  S + P+AG+GYGLP+SRLYA+YF GDL L S+EG+GT A+IYL+    E+ E LP+FNK++ R Y  S + A DW  P
Sbjct:  186 KHIGSIDPSCDVVEVVKDAFETSKMLCEQYYLTSPDMEITEVNSKN-------------------------PDQPLHIVYVPSHLYHMLFELFKNAMRATVETHETSPTLPPIKVRISLGSEDLTIKMSDKGGGVPLRKIERLFSYMYSTA---PSPVHMDNSRNAPLAGFGYGLPISRLYAKYFQGDLQLYSMEGYGTSAVIYLKALSSESVERLPVFNKSALRHYQTS-MEADDWCMP 396          

HSP 2 Score: 159.844 bits (403), Expect = 8.441e-43
Identity = 83/170 (48.82%), Postives = 112/170 (65.88%), Query Frame = 3
Query:   66 GLFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFGE-NARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQF-ENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            G FS +  Q+     R SK++P+PLS+K+F+ FG  NA    SF FL++ELPVRLANIM+EI  LPD L  T  VK +   Y +S  EL+ F E    D   +++FT  + N+R RHN+VV T AQGV+E K+ FG+D  T    QYFLDRF+++RIS RML++QH + F
Sbjct:   11 GSFSGILKQVE----RFSKFSPSPLSMKQFIDFGSTNACEKTSFVFLRQELPVRLANIMKEIDYLPDKLLSTPSVKLLNSWYSRSLMELVDFLEKDPDDKDVLKNFTKTLVNVRNRHNNVVPTMAQGVLEYKDAFGVDPVTNQNVQYFLDRFYMSRISTRMLMNQHTLIF 176          
BLAST of Protein-serine/threonine kinase vs. Planmine SMEST
Match: SMESG000036411.1 (SMESG000036411.1)

HSP 1 Score: 523.472 bits (1347), Expect = 0.000e+0
Identity = 263/271 (97.05%), Postives = 264/271 (97.42%), Query Frame = 3
Query:  879 SQQRLYELEVSLFGSQVNRNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNPHFRSGLYYMTS 1691
            S + L    VSLFGSQVNRNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDSKSSNSKKVSIKQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHL DTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNPHFRSGLYYMTS
Sbjct:  160 SIRMLISQHVSLFGSQVNRNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDSKSSNSKKVSIKQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLSDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWSNPHFRSGLYYMTS 430          

HSP 2 Score: 345.125 bits (884), Expect = 6.342e-113
Identity = 169/172 (98.26%), Postives = 169/172 (98.26%), Query Frame = 3
Query:   54 MKISGLFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFGENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            MKISGLFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFGENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQH   F
Sbjct:    1 MKISGLFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFGENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHVSLF 172          
BLAST of Protein-serine/threonine kinase vs. Planmine SMEST
Match: SMESG000036411.1 (SMESG000036411.1)

HSP 1 Score: 375.17 bits (962), Expect = 1.953e-128
Identity = 182/183 (99.45%), Postives = 182/183 (99.45%), Query Frame = 3
Query:   54 MKISGLFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFGENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFFLLMKYLCPPMI 602
            MKISGLFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFGENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIF LLMKYLCPPMI
Sbjct:    1 MKISGLFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFGENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFLLLMKYLCPPMI 183          
BLAST of Protein-serine/threonine kinase vs. Planmine SMEST
Match: SMESG000009286.1 (SMESG000009286.1)

HSP 1 Score: 202.986 bits (515), Expect = 3.839e-59
Identity = 100/249 (40.16%), Postives = 146/249 (58.63%), Query Frame = 3
Query:  906 VSLFGSQVNRNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWS 1652
            V LFG  +     F+G ID   ++++++ D++D A  LC HYY  SP++   V                           E +  +++   Y+PSHLYH+ FE+ KN++RA+VE       L P+NV++   +E++TI++ D GGGI  S+M L+F YTFTTAK  PS     S    MAG+GYGLPLSRLYARY NGDL + S++G GTDA ++L+ +  +ADE LPIF+++S  ++ N      DWS
Sbjct:  170 VILFGPHLRNEKDFVGCIDCNCDVVKVIQDSFDKAKYLCDHYYMDSPQMNFRV-------------------------YPENSSPKIV---YVPSHLYHILFEIFKNSMRALVENKSATSKLAPINVVLVTGKEDLTIRVSDKGGGISRSMMPLIFNYTFTTAKYQPSLRE--SGEAAMAGFGYGLPLSRLYARYLNGDLVIVSMDGHGTDAYVFLKLRAADADEYLPIFSRSSVMKHANQINNRTDWS 388          

HSP 2 Score: 184.111 bits (466), Expect = 5.229e-52
Identity = 89/173 (51.45%), Postives = 123/173 (71.10%), Query Frame = 3
Query:   54 MKISGLFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFGENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKS-DLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            MKIS + +A++G++AK F++  K++PTPLSLKK   F ENA    S  FL+ E+PVRLANIMQEI LLPD L  T   K V+ +YEK+F E++ FE   + D+ T   FT C+A +  R+++ V+  ++GVME+KE FGID S + Q  YFLDR++++RISIRMLI+QH I F
Sbjct:    1 MKISTMLNAMTGEVAKSFVKYGKFSPTPLSLKKLTNFAENASVKRSVEFLRLEMPVRLANIMQEIQLLPDKLLSTPSGKLVVEIYEKNFQEVIAFEKKDTNDVETQNQFTHCLAEMVRRNDTNVDILSEGVMEMKEMFGIDTSLDRQLSYFLDRYYMSRISIRMLINQHVILF 173          
BLAST of Protein-serine/threonine kinase vs. Planmine SMEST
Match: SMESG000009286.1 (SMESG000009286.1)

HSP 1 Score: 202.601 bits (514), Expect = 4.550e-59
Identity = 100/249 (40.16%), Postives = 146/249 (58.63%), Query Frame = 3
Query:  906 VSLFGSQVNRNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWS 1652
            V LFG  +     F+G ID   ++++++ D++D A  LC HYY  SP++   V                           E +  +++   Y+PSHLYH+ FE+ KN++RA+VE       L P+NV++   +E++TI++ D GGGI  S+M L+F YTFTTAK  PS     S    MAG+GYGLPLSRLYARY NGDL + S++G GTDA ++L+ +  +ADE LPIF+++S  ++ N      DWS
Sbjct:  161 VILFGPHLRNEKDFVGCIDCNCDVVKVIQDSFDKAKYLCDHYYMDSPQMNFRV-------------------------YPENSSPKIV---YVPSHLYHILFEIFKNSMRALVENKSATSKLAPINVVLVTGKEDLTIRVSDKGGGISRSMMPLIFNYTFTTAKYQPSLRE--SGEAAMAGFGYGLPLSRLYARYLNGDLVIVSMDGHGTDAYVFLKLRAADADEYLPIFSRSSVMKHANQINNRTDWS 379          

HSP 2 Score: 174.096 bits (440), Expect = 1.889e-48
Identity = 84/164 (51.22%), Postives = 116/164 (70.73%), Query Frame = 3
Query:   81 LSGQIAKDFIRCSKYTPTPLSLKKFVQFGENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKS-DLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            ++G++AK F++  K++PTPLSLKK   F ENA    S  FL+ E+PVRLANIMQEI LLPD L  T   K V+ +YEK+F E++ FE   + D+ T   FT C+A +  R+++ V+  ++GVME+KE FGID S + Q  YFLDR++++RISIRMLI+QH I F
Sbjct:    1 MTGEVAKSFVKYGKFSPTPLSLKKLTNFAENASVKRSVEFLRLEMPVRLANIMQEIQLLPDKLLSTPSGKLVVEIYEKNFQEVIAFEKKDTNDVETQNQFTHCLAEMVRRNDTNVDILSEGVMEMKEMFGIDTSLDRQLSYFLDRYYMSRISIRMLINQHVILF 164          
BLAST of Protein-serine/threonine kinase vs. Planmine SMEST
Match: SMESG000009286.1 (SMESG000009286.1)

HSP 1 Score: 202.601 bits (514), Expect = 4.847e-59
Identity = 100/249 (40.16%), Postives = 146/249 (58.63%), Query Frame = 3
Query:  906 VSLFGSQVNRNLKFIGIIDSQTNILEILADAYDNAANLCKHYYGVSPEIRVTVINHDXXXXXXXXXXXXQWNCLDRDSLEECAKHRVIDMYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIKILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLSRLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYTNSAIPAADWS 1652
            V LFG  +     F+G ID   ++++++ D++D A  LC HYY  SP++   V                           E +  +++   Y+PSHLYH+ FE+ KN++RA+VE       L P+NV++   +E++TI++ D GGGI  S+M L+F YTFTTAK  PS     S    MAG+GYGLPLSRLYARY NGDL + S++G GTDA ++L+ +  +ADE LPIF+++S  ++ N      DWS
Sbjct:  165 VILFGPHLRNEKDFVGCIDCNCDVVKVIQDSFDKAKYLCDHYYMDSPQMNFRV-------------------------YPENSSPKIV---YVPSHLYHILFEIFKNSMRALVENKSATSKLAPINVVLVTGKEDLTIRVSDKGGGISRSMMPLIFNYTFTTAKYQPSLRE--SGEAAMAGFGYGLPLSRLYARYLNGDLVIVSMDGHGTDAYVFLKLRAADADEYLPIFSRSSVMKHANQINNRTDWS 383          

HSP 2 Score: 177.178 bits (448), Expect = 1.698e-49
Identity = 85/168 (50.60%), Postives = 119/168 (70.83%), Query Frame = 3
Query:   69 LFSALSGQIAKDFIRCSKYTPTPLSLKKFVQFGENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIGLYEKSFTELLQFENLKS-DLSTVQSFTDCIANIRERHNSVVETTAQGVMEVKENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFF 569
            + +A++G++AK F++  K++PTPLSLKK   F ENA    S  FL+ E+PVRLANIMQEI LLPD L  T   K V+ +YEK+F E++ FE   + D+ T   FT C+A +  R+++ V+  ++GVME+KE FGID S + Q  YFLDR++++RISIRMLI+QH I F
Sbjct:    1 MLNAMTGEVAKSFVKYGKFSPTPLSLKKLTNFAENASVKRSVEFLRLEMPVRLANIMQEIQLLPDKLLSTPSGKLVVEIYEKNFQEVIAFEKKDTNDVETQNQFTHCLAEMVRRNDTNVDILSEGVMEMKEMFGIDTSLDRQLSYFLDRYYMSRISIRMLINQHVILF 168          
The following BLAST results are available for this feature:
BLAST of Protein-serine/threonine kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDK36.202e-5542.23pyruvate dehydrogenase kinase 3 [Source:HGNC Symbo... [more]
PDK36.202e-5542.23pyruvate dehydrogenase kinase 3 [Source:HGNC Symbo... [more]
PDK36.888e-5542.23pyruvate dehydrogenase kinase 3 [Source:HGNC Symbo... [more]
PDK21.988e-5441.30pyruvate dehydrogenase kinase 2 [Source:HGNC Symbo... [more]
PDK21.988e-5441.30pyruvate dehydrogenase kinase 2 [Source:HGNC Symbo... [more]
back to top
BLAST of Protein-serine/threonine kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pdhk-21.948e-5240.32Probable [pyruvate dehydrogenase (acetyl-transferr... [more]
back to top
BLAST of Protein-serine/threonine kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Pdk2.419e-6445.38gene:FBgn0017558 transcript:FBtr0333004[more]
Pdk9.575e-6446.40gene:FBgn0017558 transcript:FBtr0088508[more]
Pdk9.575e-6446.40gene:FBgn0017558 transcript:FBtr0306807[more]
Pdk1.473e-6346.40gene:FBgn0017558 transcript:FBtr0112892[more]
back to top
BLAST of Protein-serine/threonine kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdk18.304e-5641.27pyruvate dehydrogenase kinase, isozyme 1 [Source:Z... [more]
pdk3b1.597e-5441.98pyruvate dehydrogenase kinase, isozyme 3b [Source:... [more]
pdk42.591e-5440.49pyruvate dehydrogenase kinase, isozyme 4 [Source:Z... [more]
pdk3a3.162e-5441.43pyruvate dehydrogenase kinase, isozyme 3a [Source:... [more]
pdk3a1.361e-5341.67pyruvate dehydrogenase kinase, isozyme 3a [Source:... [more]
back to top
BLAST of Protein-serine/threonine kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdk36.418e-6144.22pyruvate dehydrogenase kinase 3 [Source:NCBI gene;... [more]
pdk31.284e-6044.22pyruvate dehydrogenase kinase 3 [Source:NCBI gene;... [more]
pdk31.504e-6044.22pyruvate dehydrogenase kinase 3 [Source:NCBI gene;... [more]
pdk32.326e-6044.22pyruvate dehydrogenase kinase 3 [Source:NCBI gene;... [more]
pdk33.820e-6044.22pyruvate dehydrogenase kinase 3 [Source:NCBI gene;... [more]
back to top
BLAST of Protein-serine/threonine kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pdk38.486e-5642.23pyruvate dehydrogenase kinase, isoenzyme 3 [Source... [more]
Pdk25.607e-5340.08pyruvate dehydrogenase kinase, isoenzyme 2 [Source... [more]
Pdk44.986e-5240.08pyruvate dehydrogenase kinase, isoenzyme 4 [Source... [more]
Pdk13.231e-5139.60pyruvate dehydrogenase kinase, isoenzyme 1 [Source... [more]
Bckdk3.271e-2433.49branched chain ketoacid dehydrogenase kinase [Sour... [more]
back to top
BLAST of Protein-serine/threonine kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P91622|PDK_DROME9.598e-6346.40[Pyruvate dehydrogenase (acetyl-transferring)] kin... [more]
sp|Q922H2|PDK3_MOUSE5.936e-5542.23[Pyruvate dehydrogenase (acetyl-transferring)] kin... [more]
sp|Q15120|PDK3_HUMAN2.978e-5442.23[Pyruvate dehydrogenase (acetyl-transferring)] kin... [more]
sp|Q15119|PDK2_HUMAN4.506e-5341.30[Pyruvate dehydrogenase (acetyl-transferring)] kin... [more]
sp|O02623|PDK_ASCSU3.304e-5240.32[Pyruvate dehydrogenase (acetyl-transferring)] kin... [more]
back to top
BLAST of Protein-serine/threonine kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KH842.805e-8452.08Protein-serine/threonine kinase OS=Schistosoma man... [more]
A0A3R7JQ234.505e-8150.35Protein-serine/threonine kinase OS=Clonorchis sine... [more]
A0A504YAN02.734e-8051.55Protein-serine/threonine kinase OS=Fasciola gigant... [more]
A0A4E0RUT71.021e-7950.97Protein-serine/threonine kinase OS=Fasciola hepati... [more]
A0A5J4N9U02.510e-7948.92Protein-serine/threonine kinase OS=Paragonimus wes... [more]
back to top
BLAST of Protein-serine/threonine kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDK33.860e-5441.43pyruvate dehydrogenase (acetyl-transferring) kinas... [more]
pdk49.637e-5441.00pyruvate dehydrogenase kinase 4 [Source:NCBI gene;... [more]
pdk3a1.359e-5342.06pyruvate dehydrogenase (acetyl-transferring) kinas... [more]
pdk13.443e-5341.27pyruvate dehydrogenase kinase 1 [Source:NCBI gene;... [more]
ENSAMXT00000024993.27.681e-5341.35pyruvate dehydrogenase (acetyl-transferring) kinas... [more]
back to top
BLAST of Protein-serine/threonine kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000003108.12.751e-5141.42pep scaffold:Pmarinus_7.0:GL477025:51675:72049:1 g... [more]
pdk47.336e-5140.64pyruvate dehydrogenase kinase, isozyme 4 [Source:Z... [more]
ENSPMAT00000001099.11.430e-4143.43pep scaffold:Pmarinus_7.0:GL480105:32238:43471:1 g... [more]
ENSPMAT00000002673.18.285e-2444.17pep scaffold:Pmarinus_7.0:GL485541:1449:4237:1 gen... [more]
back to top
BLAST of Protein-serine/threonine kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PKP12.788e-1029.01Mitochondrial protein kinase; involved in negative... [more]
back to top
BLAST of Protein-serine/threonine kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO422097.901e-5742.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377834.252e-2431.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein-serine/threonine kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdk3a7.015e-5943.82pyruvate dehydrogenase kinase 3 [Source:NCBI gene;... [more]
pdk14.161e-5542.00pyruvate dehydrogenase kinase 1 [Source:NCBI gene;... [more]
pdk16.113e-5541.60pyruvate dehydrogenase kinase 1 [Source:NCBI gene;... [more]
pdk16.516e-5542.00pyruvate dehydrogenase kinase 1 [Source:NCBI gene;... [more]
pdk43.041e-5440.83pyruvate dehydrogenase kinase 4 [Source:NCBI gene;... [more]
back to top
BLAST of Protein-serine/threonine kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036411.16.342e-11397.05SMESG000036411.1[more]
SMESG000036411.11.953e-12899.45SMESG000036411.1[more]
SMESG000009286.13.839e-5940.16SMESG000009286.1[more]
SMESG000009286.14.550e-5940.16SMESG000009286.1[more]
SMESG000009286.14.847e-5940.16SMESG000009286.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001718 ID=SMED30001718|Name=Protein-serine/threonine kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1843bp
TTGAAATTGTAATTTATTCAATTAAACTACTTTTTTCTAAATTGAAATTT
AACATGAAAATTTCTGGATTATTTAGTGCTCTTAGTGGTCAAATTGCTAA
AGATTTTATTAGATGCAGCAAGTACACTCCGACGCCATTAAGCTTGAAAA
AGTTTGTGCAATTTGGCGAAAATGCGAGACCATCTGAGTCATTTAACTTT
TTAAAAAAAGAATTGCCTGTTCGATTAGCGAATATAATGCAAGAAATTCT
TTTATTACCTGATAATTTGCATGAGACATCTCATGTGAAATTTGTAATTG
GATTATATGAAAAAAGTTTCACCGAACTTTTGCAGTTCGAAAATTTAAAA
AGCGATCTTTCAACTGTTCAGTCATTCACGGACTGCATAGCAAACATTCG
TGAGAGGCACAATTCTGTTGTTGAAACAACGGCTCAAGGTGTCATGGAAG
TGAAAGAAAATTTTGGAATTGATGCTTCTACAGAGATGCAGTTTCAATAT
TTTCTGGATCGTTTTTTTATTAATCGTATCAGTATCCGAATGTTGATCAG
TCAGCATGGTATTTTTTTTCTTCTAATGAAATATCTCTGCCCTCCTATGA
TATAACCTACCGAAAAATGACCACTAAAATGTACAGTACAGACCAATGAA
GCAAAAGTATTCAAGAATTAGATTGCAAGATATCACTTACTATGCTTGAT
ATGCAAGGAAACTGGTCATTGCAGGTGCGAATGTTTGAGGTGAGCAGAAA
ATGACTCAACAGAAAATTGGCAGGGATCGATGATGTAGACGATTATGGTA
ACCATAAATTGTACCCACAAGTCAAAGCGTTGGTGAAAGATGAGGACGCA
GCAGCACAGGAGTAAATGAATATAATACTCTCAGCAAAGATTGTATGAAT
TAGAAGTTAGTCTTTTCGGATCTCAAGTGAATAGAAACTTGAAATTTATT
GGGATAATTGACTCTCAAACAAATATTCTCGAAATTCTTGCTGATGCGTA
TGACAATGCTGCAAATCTATGTAAACATTACTATGGAGTCTCACCAGAAA
TTAGGGTTACTGTTATTAATCATGATAGTAAAAGTAGCAATTCCAAAAAA
GTATCCATCAAACAGTGGAATTGTTTAGATAGAGATTCATTAGAAGAATG
TGCCAAACATCGAGTTATAGACATGTATTATATTCCATCTCATTTGTATC
ATATGTCGTTTGAGTTACTCAAAAATGCTTTGCGAGCTGTTGTAGAATGT
CATCATCTGAGGGATACATTGCCTCCTGTCAATGTTTTGGTATGTGGAGC
TCAAGAAAATATGACCATCAAGATTTTGGATTGTGGAGGAGGAATTCCTC
ATTCTTTAATGGATCTTGTGTTTAAATATACATTTACCACTGCTAAGCAA
TCCCCTTCTACAACCTCATTGATGTCCAACAGTGTCCCAATGGCTGGTTA
TGGCTACGGTTTGCCTTTAAGTAGATTGTACGCTCGATATTTTAATGGAG
ATCTCACTCTGAGTTCCGTTGAAGGCTTTGGAACTGACGCGATAATCTAT
TTGAGGAGAAAACCCGATGAAGCCGATGAGTTACTGCCAATATTCAACAA
AACATCTGCTCGTCAATACACTAATTCAGCGATTCCTGCCGCAGATTGGT
CGAATCCACACTTCAGAAGTGGACTTTATTACATGACGAGCTGAATTGTT
TACCCTTCGAAATATGACTTCCGTTTGAACAGCCTTCAAATATTTCAGAT
TTCTCCCAAATTCTTATTTCAAATCGTTCATTATTCGATATTTTGATAAT
TTTATAAGGTGAAAAATCTTTCAACATTTTACCGATTTCCTCG
back to top

protein sequence of SMED30001718-orf-1

>SMED30001718-orf-1 ID=SMED30001718-orf-1|Name=SMED30001718-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=174bp
MYYIPSHLYHMSFELLKNALRAVVECHHLRDTLPPVNVLVCGAQENMTIK
ILDCGGGIPHSLMDLVFKYTFTTAKQSPSTTSLMSNSVPMAGYGYGLPLS
RLYARYFNGDLTLSSVEGFGTDAIIYLRRKPDEADELLPIFNKTSARQYT
NSAIPAADWSNPHFRSGLYYMTS*
back to top

protein sequence of SMED30001718-orf-2

>SMED30001718-orf-2 ID=SMED30001718-orf-2|Name=SMED30001718-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=201bp
EIVIYSIKLLFSKLKFNMKISGLFSALSGQIAKDFIRCSKYTPTPLSLKK
FVQFGENARPSESFNFLKKELPVRLANIMQEILLLPDNLHETSHVKFVIG
LYEKSFTELLQFENLKSDLSTVQSFTDCIANIRERHNSVVETTAQGVMEV
KENFGIDASTEMQFQYFLDRFFINRISIRMLISQHGIFFLLMKYLCPPMI
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000208testis
Vocabulary: INTERPRO
TermDefinition
IPR036784AK/P_DHK_N_sf
IPR039028BCKD/PDK
IPR018955BCDHK/PDK_N
IPR003594HATPase_C
IPR005467His_kinase_dom
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0004672protein kinase activity
GO:0004740pyruvate dehydrogenase (acetyl-transferring) kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005759mitochondrial matrix
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
GO:0006006glucose metabolic process
GO:0006090pyruvate metabolic process
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018955Branched-chain alpha-ketoacid dehydrogenase kinase/Pyruvate dehydrogenase kinase, N-terminalPFAMPF10436BCDHK_Adom3coord: 45..185
e-value: 1.9E-41
score: 141.6
IPR036784Alpha-ketoacid/pyruvate dehydrogenase kinase, N-terminal domain superfamilyGENE3DG3DSA:1.20.140.20coord: 23..192
e-value: 3.3E-54
score: 185.2
IPR036784Alpha-ketoacid/pyruvate dehydrogenase kinase, N-terminal domain superfamilySUPERFAMILYSSF69012alpha-ketoacid dehydrogenase kinase, N-terminal domaincoord: 37..186
NoneNo IPR availablePANTHERPTHR11947:SF14[PYRUVATE DEHYDROGENASE (ACETYL-TRANSFERRING)] KINASE ISOZYME 1, MITOCHONDRIALcoord: 28..188
IPR039028PDK/BCKDK protein kinasePANTHERPTHR11947PYRUVATE DEHYDROGENASE KINASEcoord: 28..188