Nuclear factor related to kappa-B-binding protein

Overview
NameNuclear factor related to kappa-B-binding protein
Smed IDSMED30001713
Length (bp)2632
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nuclear factor related to kappa-B-binding protein (SMED30001713) t-SNE clustered cells

Violin plots show distribution of expression levels for Nuclear factor related to kappa-B-binding protein (SMED30001713) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nuclear factor related to kappa-B-binding protein (SMED30001713) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nuclear factor related to kappa-B-binding protein (SMED30001713) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001713

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30001713h1SMcG0005561 SmedASXL_016128SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30001713h1SMcG0005561 SmedASXL_016128SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Human
Match: NFRKB (nuclear factor related to kappaB binding protein [Source:HGNC Symbol;Acc:HGNC:7802])

HSP 1 Score: 163.696 bits (413), Expect = 1.651e-40
Identity = 106/305 (34.75%), Postives = 160/305 (52.46%), Query Frame = 1
Query: 1042 TDFFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLSHNELSI-------LEHRKKSQTWRW--KTEVDCHVLRRLFNDW-----HQISQGTNSGANRANQSVGIECEQIAPPLFQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQ 1914
            + FFSLL  + +   Q  L    +E+R+  W    + +   S N W   + +W  L +PAL YL+    ++       +E ++K+Q W+   +++ +   L  LF  W         +  N  ++ A   V         P  +TD+ VR ST EE+  FQ QER R+ +P + F + +HG+   V P++G    ++ S  KAR H LL +DRP +V I+ +VRDA ARLPNGEG+RA+I  L  DS F +      +   ++  +S ALDRL  E  DP VKY+   KLW Y HR++S EE E+
Sbjct:  402 SSFFSLLLEILLLESQASL--PMLEERVLDW----QSSPASSLNSWFSAAPNWAELVLPALQYLAGESRAVPSSFSPFVEFKEKTQQWKLLGQSQDNEKELAALFQLWLETKDQAFCKQENEDSSDATTPV---------PRVRTDYVVRPSTGEEKRVFQEQERYRYSQPHKAFTFRMHGFESVVGPVKGVF-DKETSLNKAREHSLLRSDRPAYVTILSLVRDAAARLPNGEGTRAEICELLKDSQFLAPDV---TSTQVNTVVSGALDRLHYEK-DPCVKYDIGRKLWIYLHRDRSEEEFER 686          

HSP 2 Score: 55.0694 bits (131), Expect = 6.239e-7
Identity = 26/89 (29.21%), Postives = 46/89 (51.69%), Query Frame = 1
Query:   91 GSKIYQLPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSI 357
            G     LP+ L+ + +   ++VS + W   L  S + +L +FLP FP +   ++ E +  LF G++  F N +    +L +DG FN  +
Sbjct:   45 GGTRVSLPEDLLEDPEIFFDVVSLSTWQEVLSDSQREHLQQFLPQFPEDSAEQQNELILALFSGENFRFGNPLHIAQKLFRDGHFNPEV 133          
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Human
Match: NFRKB (nuclear factor related to kappaB binding protein [Source:HGNC Symbol;Acc:HGNC:7802])

HSP 1 Score: 163.31 bits (412), Expect = 1.964e-40
Identity = 106/305 (34.75%), Postives = 160/305 (52.46%), Query Frame = 1
Query: 1042 TDFFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLSHNELSI-------LEHRKKSQTWRW--KTEVDCHVLRRLFNDW-----HQISQGTNSGANRANQSVGIECEQIAPPLFQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQ 1914
            + FFSLL  + +   Q  L    +E+R+  W    + +   S N W   + +W  L +PAL YL+    ++       +E ++K+Q W+   +++ +   L  LF  W         +  N  ++ A   V         P  +TD+ VR ST EE+  FQ QER R+ +P + F + +HG+   V P++G    ++ S  KAR H LL +DRP +V I+ +VRDA ARLPNGEG+RA+I  L  DS F +      +   ++  +S ALDRL  E  DP VKY+   KLW Y HR++S EE E+
Sbjct:  377 SSFFSLLLEILLLESQASL--PMLEERVLDW----QSSPASSLNSWFSAAPNWAELVLPALQYLAGESRAVPSSFSPFVEFKEKTQQWKLLGQSQDNEKELAALFQLWLETKDQAFCKQENEDSSDATTPV---------PRVRTDYVVRPSTGEEKRVFQEQERYRYSQPHKAFTFRMHGFESVVGPVKGVF-DKETSLNKAREHSLLRSDRPAYVTILSLVRDAAARLPNGEGTRAEICELLKDSQFLAPDV---TSTQVNTVVSGALDRLHYEK-DPCVKYDIGRKLWIYLHRDRSEEEFER 661          

HSP 2 Score: 55.0694 bits (131), Expect = 6.766e-7
Identity = 26/89 (29.21%), Postives = 46/89 (51.69%), Query Frame = 1
Query:   91 GSKIYQLPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSI 357
            G     LP+ L+ + +   ++VS + W   L  S + +L +FLP FP +   ++ E +  LF G++  F N +    +L +DG FN  +
Sbjct:   32 GGTRVSLPEDLLEDPEIFFDVVSLSTWQEVLSDSQREHLQQFLPQFPEDSAEQQNELILALFSGENFRFGNPLHIAQKLFRDGHFNPEV 120          
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Human
Match: NFRKB (nuclear factor related to kappaB binding protein [Source:HGNC Symbol;Acc:HGNC:7802])

HSP 1 Score: 163.31 bits (412), Expect = 1.964e-40
Identity = 106/305 (34.75%), Postives = 160/305 (52.46%), Query Frame = 1
Query: 1042 TDFFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLSHNELSI-------LEHRKKSQTWRW--KTEVDCHVLRRLFNDW-----HQISQGTNSGANRANQSVGIECEQIAPPLFQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQ 1914
            + FFSLL  + +   Q  L    +E+R+  W    + +   S N W   + +W  L +PAL YL+    ++       +E ++K+Q W+   +++ +   L  LF  W         +  N  ++ A   V         P  +TD+ VR ST EE+  FQ QER R+ +P + F + +HG+   V P++G    ++ S  KAR H LL +DRP +V I+ +VRDA ARLPNGEG+RA+I  L  DS F +      +   ++  +S ALDRL  E  DP VKY+   KLW Y HR++S EE E+
Sbjct:  377 SSFFSLLLEILLLESQASL--PMLEERVLDW----QSSPASSLNSWFSAAPNWAELVLPALQYLAGESRAVPSSFSPFVEFKEKTQQWKLLGQSQDNEKELAALFQLWLETKDQAFCKQENEDSSDATTPV---------PRVRTDYVVRPSTGEEKRVFQEQERYRYSQPHKAFTFRMHGFESVVGPVKGVF-DKETSLNKAREHSLLRSDRPAYVTILSLVRDAAARLPNGEGTRAEICELLKDSQFLAPDV---TSTQVNTVVSGALDRLHYEK-DPCVKYDIGRKLWIYLHRDRSEEEFER 661          

HSP 2 Score: 55.0694 bits (131), Expect = 6.766e-7
Identity = 26/89 (29.21%), Postives = 46/89 (51.69%), Query Frame = 1
Query:   91 GSKIYQLPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSI 357
            G     LP+ L+ + +   ++VS + W   L  S + +L +FLP FP +   ++ E +  LF G++  F N +    +L +DG FN  +
Sbjct:   32 GGTRVSLPEDLLEDPEIFFDVVSLSTWQEVLSDSQREHLQQFLPQFPEDSAEQQNELILALFSGENFRFGNPLHIAQKLFRDGHFNPEV 120          
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Human
Match: NFRKB (nuclear factor related to kappaB binding protein [Source:HGNC Symbol;Acc:HGNC:7802])

HSP 1 Score: 160.614 bits (405), Expect = 1.119e-39
Identity = 105/300 (35.00%), Postives = 160/300 (53.33%), Query Frame = 1
Query: 1042 TDFFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLSHNELSI-------LEHRKKSQTWRW--KTEVDCHVLRRLFNDWHQISQGTNSGANRANQSVGIECEQIAPPLFQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQ 1914
            + FFSLL  + +   Q  L    +E+R+  W    + +   S N W   + +W  L +PAL YL+    ++       +E ++K+Q W+   +++ +   L  LF  W +    T   A           + ++  L +TD+ VR ST EE+  FQ QER R+ +P + F + +HG+   V P++G    ++ S  KAR H LL +DRP +V I+ +VRDA ARLPNGEG+RA+I  L  DS F +      +   ++  +S ALDRL  E  DP VKY+   KLW Y HR++S EE E+
Sbjct:  389 SSFFSLLLEILLLESQASLP--MLEERVLDW----QSSPASSLNSWFSAAPNWAELVLPALQYLAGESRAVPSSFSPFVEFKEKTQQWKLLGQSQDNEKELAALFQLWLE----TKDQAFCKKMKTAQMPQHLS--LGRTDYVVRPSTGEEKRVFQEQERYRYSQPHKAFTFRMHGFESVVGPVKGVF-DKETSLNKAREHSLLRSDRPAYVTILSLVRDAAARLPNGEGTRAEICELLKDSQFLAPDV---TSTQVNTVVSGALDRLHYEK-DPCVKYDIGRKLWIYLHRDRSEEEFER 671          

HSP 2 Score: 55.8398 bits (133), Expect = 4.216e-7
Identity = 26/89 (29.21%), Postives = 46/89 (51.69%), Query Frame = 1
Query:   91 GSKIYQLPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSI 357
            G     LP+ L+ + +   ++VS + W   L  S + +L +FLP FP +   ++ E +  LF G++  F N +    +L +DG FN  +
Sbjct:   32 GGTRVSLPEDLLEDPEIFFDVVSLSTWQEVLSDSQREHLQQFLPQFPEDSAEQQNELILALFSGENFRFGNPLHIAQKLFRDGHFNPEV 120          
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Human
Match: NFRKB (nuclear factor related to kappaB binding protein [Source:HGNC Symbol;Acc:HGNC:7802])

HSP 1 Score: 55.8398 bits (133), Expect = 1.827e-8
Identity = 26/89 (29.21%), Postives = 46/89 (51.69%), Query Frame = 1
Query:   91 GSKIYQLPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSI 357
            G     LP+ L+ + +   ++VS + W   L  S + +L +FLP FP +   ++ E +  LF G++  F N +    +L +DG FN  +
Sbjct:   32 GGTRVSLPEDLLEDPEIFFDVVSLSTWQEVLSDSQREHLQQFLPQFPEDSAEQQNELILALFSGENFRFGNPLHIAQKLFRDGHFNPEV 120          
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Fly
Match: CG11970 (gene:FBgn0027503 transcript:FBtr0081959)

HSP 1 Score: 155.606 bits (392), Expect = 2.972e-38
Identity = 106/306 (34.64%), Postives = 157/306 (51.31%), Query Frame = 1
Query: 1048 FFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLSHNELSI-------LEHRKKSQTWRW---KTEVDCHVL-------RRLFNDWHQISQGTNSGANRANQSVGIECEQIAPPLFQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQ 1914
            FFSLL+ LFV   Q +LT  +++  +  W  ++  +       W     DW  L   A+ +LS +  S+       +EH+ +   ++W     + D  +L       R       Q+S    SG +  +    ++     PP   T W VR +T  E + FQ QER RF  P R F Y ++GY   V P++G    +     KARGH ++V+DRPP V I+ +VRDA ARLPNGEG+R++I  L   S + S  +   ++  +   +S ALDR+ G G DP VKY+AR K+W Y HRN+S  E E+
Sbjct:  567 FFSLLRDLFVSTPQHRLTYGELQILLSSWREINS-DASIPIGEWPRFRPDWSKLLQSAINFLSGDFSSVPADYVPYIEHKTQLGIYQWIGAGRDSDARLLSLCQFWLRTQREKQSQLSPVLISGVHLNSL---VDASPTPPPRCPTTWTVRSATQAEILEFQSQERIRFEYPHRPFTYRLNGYESVVGPVKGIY-TQGLPLNKARGHAVMVDDRPPFVTILTLVRDATARLPNGEGTRSEISELLKCSQYISQQA---ADNVLQTIVSGALDRMHG-GPDPCVKYDARRKIWIYLHRNRSEAEFEK 863          
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Fly
Match: CG11970 (gene:FBgn0027503 transcript:FBtr0346139)

HSP 1 Score: 155.606 bits (392), Expect = 2.972e-38
Identity = 106/306 (34.64%), Postives = 157/306 (51.31%), Query Frame = 1
Query: 1048 FFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLSHNELSI-------LEHRKKSQTWRW---KTEVDCHVL-------RRLFNDWHQISQGTNSGANRANQSVGIECEQIAPPLFQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQ 1914
            FFSLL+ LFV   Q +LT  +++  +  W  ++  +       W     DW  L   A+ +LS +  S+       +EH+ +   ++W     + D  +L       R       Q+S    SG +  +    ++     PP   T W VR +T  E + FQ QER RF  P R F Y ++GY   V P++G    +     KARGH ++V+DRPP V I+ +VRDA ARLPNGEG+R++I  L   S + S  +   ++  +   +S ALDR+ G G DP VKY+AR K+W Y HRN+S  E E+
Sbjct:  567 FFSLLRDLFVSTPQHRLTYGELQILLSSWREINS-DASIPIGEWPRFRPDWSKLLQSAINFLSGDFSSVPADYVPYIEHKTQLGIYQWIGAGRDSDARLLSLCQFWLRTQREKQSQLSPVLISGVHLNSL---VDASPTPPPRCPTTWTVRSATQAEILEFQSQERIRFEYPHRPFTYRLNGYESVVGPVKGIY-TQGLPLNKARGHAVMVDDRPPFVTILTLVRDATARLPNGEGTRSEISELLKCSQYISQQA---ADNVLQTIVSGALDRMHG-GPDPCVKYDARRKIWIYLHRNRSEAEFEK 863          
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Zebrafish
Match: nfrkb (nuclear factor related to kappaB binding protein [Source:ZFIN;Acc:ZDB-GENE-030131-6419])

HSP 1 Score: 162.155 bits (409), Expect = 3.218e-40
Identity = 103/304 (33.88%), Postives = 160/304 (52.63%), Query Frame = 1
Query: 1048 FFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLSHNE-----------LSILEHRKKSQTWRW--KTEVDCHVLRRLFNDWHQISQGTNSGANRANQSVGIECEQIAPPLFQ--TDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQ 1914
            FF LL+ +     +   T+  +E++++ W    + +   + N W  ++  W  + VPAL +L+              +  +E ++ SQ W+W   ++     L  L   W +      S  +   +  G E  ++ PP  +  TD+ VR ST EER  FQ QE++R+ +P + F Y +HG+   V P++G    ++ S  KAR H LL +DRP +V I+ +VRDA ARLPNGEG+RA+I  L  DS F +      +   ++  +S ALDRL  E  DP VKY+   KLW Y HR++S EE E+
Sbjct:  374 FFHLLEDIL--RLEGLATSSTMEEKVQQW----QSSPASTLNPWFSMAPCWSEVVVPALQFLAGESKAGVMALPTGFIPFVEFKEVSQQWKWIGSSQDGDKDLSALCQLWLE------SKDHVIVKQEGEETAELTPPTPRVWTDYVVRPSTGEERHVFQEQEQQRYDQPHKAFTYRMHGFESVVGPVKGVF-DKETSLNKAREHSLLRSDRPAYVTILSLVRDAAARLPNGEGTRAEICELLKDSQFLAPDV---TSAQVNTVVSGALDRLHYEK-DPCVKYDIGRKLWIYLHRDRSQEEFER 660          
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Xenopus
Match: blmh (bleomycin hydrolase [Source:Xenbase;Acc:XB-GENE-997246])

HSP 1 Score: 163.31 bits (412), Expect = 1.388e-40
Identity = 105/305 (34.43%), Postives = 157/305 (51.48%), Query Frame = 1
Query: 1048 FFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLS-------HNELSILEHRKKSQTWRW-------KTEVDCHVLRRLFNDWHQISQGTNSGANRANQSVGIECEQIAPPL--FQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQ 1914
            FF LL  L +   +   +   +ED++  W  +       + N W  ++ +W  L  PAL YLS        +    +E R+K+Q W+        + E+  H     F+ W +      S  N        +C   + P+   +TD+ VR S+ EE+  FQ QER R+I+P + F + +HG+   V P++G    ++ S  KAR H LL +DRP +V I+ +VRDA ARLPNGEG+RA+I  L  DS F +      +   ++  +S ALDRL  E  DP VKY+   KLW Y HR++S EE E+
Sbjct:  148 FFCLL--LDILTMEGPCSLPLLEDKVSDWQSLP----ASTLNSWFSVAPNWCDLVHPALIYLSGECKVASSSFTPFVEFREKTQQWKCVVSSSDSEKELVAH-----FHLWLETKDQIYSKENE-------DCIDASTPIPRVRTDYIVRPSSGEEKHVFQEQERHRYIQPHKAFTFRMHGFESVVGPVKGVF-DKETSLNKAREHSLLRSDRPAYVTILSLVRDAAARLPNGEGTRAEICELLKDSQFLAPDV---TSAQVNTVVSGALDRLHYEK-DPCVKYDIGRKLWIYLHRDRSEEEFER 429          
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Xenopus
Match: blmh (bleomycin hydrolase [Source:Xenbase;Acc:XB-GENE-997246])

HSP 1 Score: 159.844 bits (403), Expect = 2.015e-39
Identity = 102/295 (34.58%), Postives = 153/295 (51.86%), Query Frame = 1
Query: 1048 FFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLSHNELS-----ILEHRKKSQTWRWKTEVDCHVLRRLFNDWHQISQGTNSGANRANQSVGIECEQIAPPLFQ-TDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQ 1914
            FF LL  L +   +   +   +ED++  W  +       + N W  ++ +W  L  PAL YLS    S      +E R+K+Q W+   +         + + + +S   +           + C Q     F+ TD+ VR S+ EE+  FQ QER R+I+P + F + +HG+   V P++G    ++ S  KAR H LL +DRP +V I+ +VRDA ARLPNGEG+RA+I  L  DS F +      +   ++  +S ALDRL  E  DP VKY+   KLW Y HR++S EE E+
Sbjct:  161 FFCLL--LDILTMEGPCSLPLLEDKVSDWQSLP----ASTLNSWFSVAPNWCDLVHPALIYLSGEFASSSFTPFVEFREKTQQWKCVGK---------YYNLYTLSSCLSI----------VSCSQCIIYTFRRTDYIVRPSSGEEKHVFQEQERHRYIQPHKAFTFRMHGFESVVGPVKGVF-DKETSLNKAREHSLLRSDRPAYVTILSLVRDAAARLPNGEGTRAEICELLKDSQFLAPDV---TSAQVNTVVSGALDRLHYEK-DPCVKYDIGRKLWIYLHRDRSEEEFER 425          
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Xenopus
Match: blmh (bleomycin hydrolase [Source:Xenbase;Acc:XB-GENE-997246])

HSP 1 Score: 155.606 bits (392), Expect = 3.519e-38
Identity = 101/289 (34.95%), Postives = 146/289 (50.52%), Query Frame = 1
Query: 1048 FFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLSHNELSILEHRKKSQTWRWKTEVDCHVLRRLFNDWHQISQGTNSGANRANQSVGIECEQIAPPLFQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQ 1914
            FF LL  L +   +   +   +ED++  W  +       + N W  ++ +W  L  PAL YLS          K     R K  V C++ R          +  N     A+  +         P  +TD+ VR S+ EE+  FQ QER R+I+P + F + +HG+   V P++G    ++ S  KAR H LL +DRP +V I+ +VRDA ARLPNGEG+RA+I  L  DS F +      +   ++  +S ALDRL  E  DP VKY+   KLW Y HR++S EE E+
Sbjct:  163 FFCLL--LDILTMEGPCSLPLLEDKVSDWQSLP----ASTLNSWFSVAPNWCDLVHPALIYLSG-------ECKGEFAGRNKRSVKCYLYRF---QLKLACKDENEDCIDASTPI---------PRVRTDYIVRPSSGEEKHVFQEQERHRYIQPHKAFTFRMHGFESVVGPVKGVF-DKETSLNKAREHSLLRSDRPAYVTILSLVRDAAARLPNGEGTRAEICELLKDSQFLAPDV---TSAQVNTVVSGALDRLHYEK-DPCVKYDIGRKLWIYLHRDRSEEEFER 421          
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Xenopus
Match: blmh (bleomycin hydrolase [Source:Xenbase;Acc:XB-GENE-997246])

HSP 1 Score: 150.984 bits (380), Expect = 8.176e-37
Identity = 100/289 (34.60%), Postives = 144/289 (49.83%), Query Frame = 1
Query: 1048 FFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLSHNELSILEHRKKSQTWRWKTEVDCHVLRRLFNDWHQISQGTNSGANRANQSVGIECEQ--IAPPLFQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEEL 1908
            FF LL  L +   +   +   +ED++  W  +       + N W  ++ +W  L  PAL YLS          K     R K  V C++ R  F                    + + C+   I     +TD+ VR S+ EE+  FQ QER R+I+P + F + +HG+   V P++G    ++ S  KAR H LL +DRP +V I+ +VRDA ARLPNGEG+RA+I  L  DS F +      +   ++  +S ALDRL  E  DP VKY+   KLW Y HR++S EE 
Sbjct:  151 FFCLL--LDILTMEGPCSLPLLEDKVSDWQSLP----ASTLNSWFSVAPNWCDLVHPALIYLSG-------ECKGEFAGRNKRSVKCYLYR--FQ-------------------LKLACKDQCIIYTFRRTDYIVRPSSGEEKHVFQEQERHRYIQPHKAFTFRMHGFESVVGPVKGVF-DKETSLNKAREHSLLRSDRPAYVTILSLVRDAAARLPNGEGTRAEICELLKDSQFLAPDV---TSAQVNTVVSGALDRLHYEK-DPCVKYDIGRKLWIYLHRDRSEEEF 400          
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Xenopus
Match: seh1l (SEH1 like nucleoporin [Source:Xenbase;Acc:XB-GENE-1015661])

HSP 1 Score: 49.6766 bits (117), Expect = 9.282e-7
Identity = 24/81 (29.63%), Postives = 45/81 (55.56%), Query Frame = 1
Query:   91 GSKIYQLPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAK 333
            G     LP+ L+ + D   E+VS + W N L  S + +L +FLP FP+++  ++++ ++ LF G +  F N +    +L +
Sbjct:   32 GGTRVSLPEDLLEDPDLFFEVVSRDTWKNVLSDSQREHLKQFLPVFPDDNANQQEKIIQSLFRGDNFRFGNPLHIAQKLFR 112          
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Mouse
Match: Nfrkb (nuclear factor related to kappa B binding protein [Source:MGI Symbol;Acc:MGI:2442410])

HSP 1 Score: 165.622 bits (418), Expect = 3.091e-41
Identity = 106/301 (35.22%), Postives = 161/301 (53.49%), Query Frame = 1
Query: 1042 TDFFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLSHNELSI-------LEHRKKSQTWRW--KTEVDCHVLRRLFNDWHQISQGTNSGANRANQSVGIECEQIAP-PLFQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQ 1914
            + FFSLL  + +   Q  L    +EDR+  W    + +   S N W   + +W  L +PAL YL+    ++       +E ++K+Q W+   +++ +   L  LF+ W +         N  +       + + P P  +TD+ VR ST EE+  FQ QER R+ +P + F + +HG+   V P++G    ++ S  KAR H LL +DRP +V I+ +VRDA ARLPNGEG+RA+I  L  DS F +      +   ++  +S ALDRL  E  DP VKY+   KLW Y HR++S EE E+
Sbjct:  377 SSFFSLLLEILLLESQASLP--MLEDRVLDW----QSSPASSLNSWFSAAPNWAELVLPALQYLAGESRAVPSSFSPFVEFKEKTQQWKLLGQSQDNEKELAALFHLWLETKDQAFCKENEDS------SDAMTPVPRVRTDYVVRPSTGEEKRVFQEQERYRYSQPHKAFTFRMHGFESVVGPVKGVF-DKETSLNKAREHSLLRSDRPAYVTILSLVRDAAARLPNGEGTRAEICELLKDSQFLAPDV---TSTQVNTVVSGALDRLHYEK-DPCVKYDIGRKLWIYLHRDRSEEEFER 660          

HSP 2 Score: 55.0694 bits (131), Expect = 4.413e-7
Identity = 26/89 (29.21%), Postives = 47/89 (52.81%), Query Frame = 1
Query:   91 GSKIYQLPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSI 357
            G     LP+ L+ + +   ++VS + W   L  S + +L +FLP FP +   +++E +  LF G++  F N +    +L +DG FN  +
Sbjct:   32 GGTRVSLPEDLLEDPEIFFDVVSLSTWQEVLSDSQREHLQQFLPRFPADSVEQQRELILALFSGENFRFGNPLHIAQKLFRDGHFNPEV 120          
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Mouse
Match: Nfrkb (nuclear factor related to kappa B binding protein [Source:MGI Symbol;Acc:MGI:2442410])

HSP 1 Score: 56.6102 bits (135), Expect = 2.421e-8
Identity = 26/89 (29.21%), Postives = 47/89 (52.81%), Query Frame = 1
Query:   91 GSKIYQLPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSI 357
            G     LP+ L+ + +   ++VS + W   L  S + +L +FLP FP +   +++E +  LF G++  F N +    +L +DG FN  +
Sbjct:   32 GGTRVSLPEDLLEDPEIFFDVVSLSTWQEVLSDSQREHLQQFLPRFPADSVEQQRELILALFSGENFRFGNPLHIAQKLFRDGHFNPEV 120          
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Mouse
Match: Nfrkb (nuclear factor related to kappa B binding protein [Source:MGI Symbol;Acc:MGI:2442410])

HSP 1 Score: 56.225 bits (134), Expect = 4.782e-8
Identity = 26/89 (29.21%), Postives = 47/89 (52.81%), Query Frame = 1
Query:   91 GSKIYQLPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSI 357
            G     LP+ L+ + +   ++VS + W   L  S + +L +FLP FP +   +++E +  LF G++  F N +    +L +DG FN  +
Sbjct:   32 GGTRVSLPEDLLEDPEIFFDVVSLSTWQEVLSDSQREHLQQFLPRFPADSVEQQRELILALFSGENFRFGNPLHIAQKLFRDGHFNPEV 120          
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Mouse
Match: Nfrkb (nuclear factor related to kappa B binding protein [Source:MGI Symbol;Acc:MGI:2442410])

HSP 1 Score: 55.4546 bits (132), Expect = 1.307e-7
Identity = 26/89 (29.21%), Postives = 47/89 (52.81%), Query Frame = 1
Query:   91 GSKIYQLPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSI 357
            G     LP+ L+ + +   ++VS + W   L  S + +L +FLP FP +   +++E +  LF G++  F N +    +L +DG FN  +
Sbjct:   32 GGTRVSLPEDLLEDPEIFFDVVSLSTWQEVLSDSQREHLQQFLPRFPADSVEQQRELILALFSGENFRFGNPLHIAQKLFRDGHFNPEV 120          
BLAST of Nuclear factor related to kappa-B-binding protein vs. UniProt/SwissProt
Match: sp|Q6PIJ4|NFRKB_MOUSE (Nuclear factor related to kappa-B-binding protein OS=Mus musculus OX=10090 GN=Nfrkb PE=1 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 2.162e-40
Identity = 106/301 (35.22%), Postives = 161/301 (53.49%), Query Frame = 1
Query: 1042 TDFFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLSHNELSI-------LEHRKKSQTWRW--KTEVDCHVLRRLFNDWHQISQGTNSGANRANQSVGIECEQIAP-PLFQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQ 1914
            + FFSLL  + +   Q  L    +EDR+  W    + +   S N W   + +W  L +PAL YL+    ++       +E ++K+Q W+   +++ +   L  LF+ W +         N  +       + + P P  +TD+ VR ST EE+  FQ QER R+ +P + F + +HG+   V P++G    ++ S  KAR H LL +DRP +V I+ +VRDA ARLPNGEG+RA+I  L  DS F +      +   ++  +S ALDRL  E  DP VKY+   KLW Y HR++S EE E+
Sbjct:  377 SSFFSLLLEILLLESQASLP--MLEDRVLDW----QSSPASSLNSWFSAAPNWAELVLPALQYLAGESRAVPSSFSPFVEFKEKTQQWKLLGQSQDNEKELAALFHLWLETKDQAFCKENEDS------SDAMTPVPRVRTDYVVRPSTGEEKRVFQEQERYRYSQPHKAFTFRMHGFESVVGPVKGVF-DKETSLNKAREHSLLRSDRPAYVTILSLVRDAAARLPNGEGTRAEICELLKDSQFLAPDV---TSTQVNTVVSGALDRLHYEK-DPCVKYDIGRKLWIYLHRDRSEEEFER 660          

HSP 2 Score: 55.0694 bits (131), Expect = 3.087e-6
Identity = 26/89 (29.21%), Postives = 47/89 (52.81%), Query Frame = 1
Query:   91 GSKIYQLPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSI 357
            G     LP+ L+ + +   ++VS + W   L  S + +L +FLP FP +   +++E +  LF G++  F N +    +L +DG FN  +
Sbjct:   32 GGTRVSLPEDLLEDPEIFFDVVSLSTWQEVLSDSQREHLQQFLPRFPADSVEQQRELILALFSGENFRFGNPLHIAQKLFRDGHFNPEV 120          
BLAST of Nuclear factor related to kappa-B-binding protein vs. UniProt/SwissProt
Match: sp|Q6P4L9|NFRKB_XENTR (Nuclear factor related to kappa-B-binding protein OS=Xenopus tropicalis OX=8364 GN=nfrkb PE=2 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 9.420e-40
Identity = 105/305 (34.43%), Postives = 157/305 (51.48%), Query Frame = 1
Query: 1048 FFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLS-------HNELSILEHRKKSQTWRW-------KTEVDCHVLRRLFNDWHQISQGTNSGANRANQSVGIECEQIAPPL--FQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQ 1914
            FF LL  L +   +   +   +ED++  W  +       + N W  ++ +W  L  PAL YLS        +    +E R+K+Q W+        + E+  H     F+ W +      S  N        +C   + P+   +TD+ VR S+ EE+  FQ QER R+I+P + F + +HG+   V P++G    ++ S  KAR H LL +DRP +V I+ +VRDA ARLPNGEG+RA+I  L  DS F +      +   ++  +S ALDRL  E  DP VKY+   KLW Y HR++S EE E+
Sbjct:  380 FFCLL--LDILTMEGPCSLPLLEDKVSDWQSLP----ASTLNSWFSVAPNWCDLVHPALIYLSGECKVASSSFTPFVEFREKTQQWKCVVSSSDSEKELVAH-----FHLWLETKDQIYSKENE-------DCIDASTPIPRVRTDYIVRPSSGEEKHVFQEQERHRYIQPHKAFTFRMHGFESVVGPVKGVF-DKETSLNKAREHSLLRSDRPAYVTILSLVRDAAARLPNGEGTRAEICELLKDSQFLAPDV---TSAQVNTVVSGALDRLHYEK-DPCVKYDIGRKLWIYLHRDRSEEEFER 661          

HSP 2 Score: 59.6918 bits (143), Expect = 1.130e-7
Identity = 31/99 (31.31%), Postives = 53/99 (53.54%), Query Frame = 1
Query:   61 IMANVMNIQYGSKIYQLPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSI 357
            IM   M    G     LP+ L+ + D   E+VS + W N L  S + +L +FLP FP+++  ++++ ++ LF G +  F N +    +L +DG FN  +
Sbjct:   25 IMEECM---LGGTRVSLPEDLLEDPDLFFEVVSRDTWKNVLSDSQREHLKQFLPVFPDDNANQQEKIIQSLFRGDNFRFGNPLHIAQKLFRDGHFNPEV 120          
BLAST of Nuclear factor related to kappa-B-binding protein vs. UniProt/SwissProt
Match: sp|Q6P4R8|NFRKB_HUMAN (Nuclear factor related to kappa-B-binding protein OS=Homo sapiens OX=9606 GN=NFRKB PE=1 SV=2)

HSP 1 Score: 163.31 bits (412), Expect = 9.431e-40
Identity = 106/305 (34.75%), Postives = 160/305 (52.46%), Query Frame = 1
Query: 1042 TDFFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLSHNELSI-------LEHRKKSQTWRW--KTEVDCHVLRRLFNDW-----HQISQGTNSGANRANQSVGIECEQIAPPLFQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQ 1914
            + FFSLL  + +   Q  L    +E+R+  W    + +   S N W   + +W  L +PAL YL+    ++       +E ++K+Q W+   +++ +   L  LF  W         +  N  ++ A   V         P  +TD+ VR ST EE+  FQ QER R+ +P + F + +HG+   V P++G    ++ S  KAR H LL +DRP +V I+ +VRDA ARLPNGEG+RA+I  L  DS F +      +   ++  +S ALDRL  E  DP VKY+   KLW Y HR++S EE E+
Sbjct:  377 SSFFSLLLEILLLESQASL--PMLEERVLDW----QSSPASSLNSWFSAAPNWAELVLPALQYLAGESRAVPSSFSPFVEFKEKTQQWKLLGQSQDNEKELAALFQLWLETKDQAFCKQENEDSSDATTPV---------PRVRTDYVVRPSTGEEKRVFQEQERYRYSQPHKAFTFRMHGFESVVGPVKGVF-DKETSLNKAREHSLLRSDRPAYVTILSLVRDAAARLPNGEGTRAEICELLKDSQFLAPDV---TSTQVNTVVSGALDRLHYEK-DPCVKYDIGRKLWIYLHRDRSEEEFER 661          

HSP 2 Score: 55.0694 bits (131), Expect = 3.249e-6
Identity = 26/89 (29.21%), Postives = 46/89 (51.69%), Query Frame = 1
Query:   91 GSKIYQLPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSI 357
            G     LP+ L+ + +   ++VS + W   L  S + +L +FLP FP +   ++ E +  LF G++  F N +    +L +DG FN  +
Sbjct:   32 GGTRVSLPEDLLEDPEIFFDVVSLSTWQEVLSDSQREHLQQFLPQFPEDSAEQQNELILALFSGENFRFGNPLHIAQKLFRDGHFNPEV 120          
BLAST of Nuclear factor related to kappa-B-binding protein vs. TrEMBL
Match: A0A293MPI1 (NFRKB_winged domain-containing protein (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 2.799e-47
Identity = 135/415 (32.53%), Postives = 201/415 (48.43%), Query Frame = 1
Query: 1048 FFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLSHNELSIL--------EHRKKSQTWRW---KTEVDCHVLRRLFNDWHQISQGTNSGANRANQSVGIECEQIAPPLFQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQAVHIQHQQDDMKRYHRNSTSSNAGPSNGSGHGHRSQPSSGTTITMAGS-QQQQSGSLVYGQILLSSNTGYQHGSVSRYGQVQSYQQFSQAVNHARDLTLQQPIYISRPLSSANSG 2256
            FFSLL+ LF    +QK++  ++E+R+R W      +   + + W      W  L   AL +L+ + + IL        ++++K Q W+W     + D   L  L   W Q  +     A  A Q          PP   TDW VR +T EER+R++ QE  R+  P + F + VHGY   V P++G   G++    KAR H LLV+DRPP V I+ +VRDA ARLPNGEG+RADI  L  DS + +      S++ I   +S ALDRL  E  DP VKY+   KLW Y HR+++ EE E+    Q      K+  + + +      N  G  H+S+ +  T  T + S     S S +    L ++ +  Q    +   QV        ++  A     Q P+ +S  + S+N G
Sbjct:  352 FFSLLRNLFNETAEQKMSAAKLEERVRAWSC----STSAAVHPWTSQRDSWGDLVSSALKFLAGDSIGILPDDFVPYLDYKEKQQQWQWIGAGRDSDAQTLA-LCQHWLQHREDVAMDALEATQG------SPPPPKSTTDWTVRPTTDEERLRYRDQECVRYQNPHKAFTFRVHGYEAVVGPVKGVY-GKESGVNKAREHSLLVSDRPPFVTILSLVRDAAARLPNGEGTRADICELLKDSQYLAL----ASDQQIHTVVSGALDRLHYEK-DPCVKYDVNRKLWIYLHRSRTEEEFEKIHQAQAAAAKAKKAIQKNKTPRV--VNEQGKKHKSKEAPKTPPTASTSVPTLPSPSPITPATLTATTSSIQTNPTTVMPQVAPPAIAVASI--AEHPLPQAPVTVSEAIRSSNGG 745          
BLAST of Nuclear factor related to kappa-B-binding protein vs. TrEMBL
Match: R7VJU8 (NFRKB_winged domain-containing protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_225186 PE=4 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 1.465e-46
Identity = 109/307 (35.50%), Postives = 168/307 (54.72%), Query Frame = 1
Query: 1039 FTDFFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNR-WAVLSIDWVGLAVPALTYLS--------HNELSILEHRKKSQTWRWKT---EVDCHVLRRLFNDW--HQISQGTNSGANRANQSVGIECEQIAPPLFQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPG-SEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQ 1914
            +  FFS+L+ +       KL+  ++ED++  W     R+  +S N  W     DW+ +   AL +LS         N + +L+++++ Q WRW     + D   L+ L++ W  +  +QG  +   R+N           PP ++TD+ VR ST EE+  +  QE + F+ P R F +N+HGY   V P++G       ++ KAR H LL+N+RP  V I+ +VR+A ARLPNGEGSR+D+  L  DS + +    PG ++  I+  +S ALDRL  E  DP VKY+   KLW Y HRN+S E+ E+
Sbjct:  471 YNSFFSMLRSVICAEPDMKLSASKLEDKVTKW-----RDSAESKNNSWITDLPDWLAILPSALKFLSGDILTFKLDNFIPLLDYKERVQMWRWIAQDRDSDAQ-LKVLYDLWRSNPSTQGEGAKGERSNSP--------PPPNYRTDYIVRPSTLEEKNAYNKQEEQYFVNPHRPFTFNLHGYKAVVGPVKGVFEKEANTSTKAREHALLINERPAFVTILTLVRNAAARLPNGEGSRSDVCELLKDSQYLA----PGVTDTQINTVVSGALDRLHYEK-DPCVKYDVNRKLWIYLHRNRSEEDFEK 758          
BLAST of Nuclear factor related to kappa-B-binding protein vs. TrEMBL
Match: A0A293LFU6 (NFRKB_winged domain-containing protein (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 2.043e-46
Identity = 145/450 (32.22%), Postives = 215/450 (47.78%), Query Frame = 1
Query: 1048 FFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLSHNELSIL--------EHRKKSQTWRW---KTEVDCHVLRRLFNDWHQISQGTNSGANRANQSVGIECEQIAPPLFQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQAVHIQHQQDDMKRYHRNSTSSNAGPSNGSGHGHRSQPSSGTTITMAGSQQQ-QSGSLVYGQILLSSNTGYQHGSVSRYGQVQSYQQFSQAVNHARDLTLQQPIYISRPLSSANSGLLYNQ--HSQQLFPSSTNHSLSSSAVPRIITPVPS 2355
            FFSLL+ LF    +QK++  ++E+R+R W      +   + + W      W  L   AL +L+ + + IL        ++++K Q W+W     + D   L  L   W Q  +     A  A Q          PP   TDW VR +T EER+R++ QE  R+  P + F + VHGY   V P++G   G++    KAR H LLV+DRPP V I+ +VRDA ARLPNGEG+RADI  L  DS + +      S++ I   +S ALDRL  E  DP VKY+   KLW Y HR+++ EE E+    Q      K+  + + +      N  G  H+S+ +  T  T + S     S S +    L ++ +  Q    +   QV        ++  A     Q P+ +S  + S+N G    +    QQL  S  + + S  A P I   +PS
Sbjct:  459 FFSLLRNLFNETAEQKMSAAKLEERVRAWSC----STSAAVHPWTSQRDSWGDLVSSALKFLAGDSIGILPDDFVPYLDYKEKQQQWQWIGAGRDSDAQTLA-LCQHWLQHREDVAMDALEATQG------SPPPPKSTTDWTVRPTTDEERLRYRDQECVRYQNPHKAFTFRVHGYEAVVGPVKGVY-GKESGVNKAREHSLLVSDRPPFVTILSLVRDAAARLPNGEGTRADICELLKDSQYLAL----ASDQQIHTVVSGALDRLHYEK-DPCVKYDVNRKLWIYLHRSRTEEEFEKIHQAQAAAAKAKKAIQKNKTPRV--VNEQGKKHKSKEAPKTPPTASTSVPTLPSPSPITPATLTATTSSIQTNPTTVMPQVAPPAIAVASI--AEHPLPQAPVTVSEAIRSSNGGSPTKRLPPPQQLLRSKEDPA-SPKANPPIPPALPS 886          

HSP 2 Score: 79.7221 bits (195), Expect = 2.133e-11
Identity = 43/127 (33.86%), Postives = 70/127 (55.12%), Query Frame = 1
Query:   88 YGSKIYQLPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSIKCQKALDLLLAERNRKINLFKRRLNDLKKIVNTKKSL 468
            YGS + ++P++L   E     I+S + WNN L +S K++L+ FLP FP ND  EK E+L++LF  ++  F N +  F    +DG     I    AL    + R+ K +  K   N L++++ ++K L
Sbjct:   24 YGSVLIEIPQALCEEEPLFNAILSIDTWNNVLTESQKLHLMNFLPTFPENDKEEKIESLQRLFSVQNFRFGNPVHQFFEKLRDGMLVPDIAKTAALVRKASYRDYKAHQRKYHCNLLQEVLISRKRL 150          
BLAST of Nuclear factor related to kappa-B-binding protein vs. TrEMBL
Match: A0A2C9K0B6 (NFRKB_winged domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106074943 PE=4 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 1.867e-45
Identity = 115/307 (37.46%), Postives = 170/307 (55.37%), Query Frame = 1
Query: 1042 TDFFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSF-NRWAVLSIDWVGLAVPALTYLSHNELSI--------LEHRKKSQTWRW---KTEVDCHVLRRLFNDWHQISQGTNSGANRANQSV-GIECEQIAPPL--FQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPG-SEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQ 1914
            ++FF LL+ +       K +T +IEDR+R W      ++ D   N W  L   WV   V AL +LS +EL +        +++++++Q W+W     + D   L  LF  W Q         ++ + +V G++  Q +PP    +T + VR ++  E+  F+ QER+RF  P + F + +HGY+  V P++G    +D    KAR H LLV+DRPP V I+ +VRDA ARLPNGEG+R DI  L  DS F +    PG +E  I+  +S ALDRL  E  DP VKY+   KLW Y HRN++ +E E+
Sbjct:  426 SNFFCLLKSILSEFPDSKCSTPKIEDRVREW-----LDLNDEISNPWLALQKSWVDHVVSALKFLSGSELGLKVENFVPLVDYKERAQQWKWIGIGRDSDPE-LSSLFRYWLQ---------HKDDVTVDGVDSTQGSPPPPKAKTSFIVRPTSNNEKALFREQERRRFAAPHKAFTFMMHGYDSVVGPVKGVY-DKDSGANKAREHNLLVSDRPPFVTILTLVRDAAARLPNGEGTRGDICELLKDSQFLA----PGVTETQINAVVSGALDRLHSE-KDPCVKYDVTRKLWIYLHRNRTEDEFER 711          

HSP 2 Score: 61.6178 bits (148), Expect = 9.190e-6
Identity = 42/171 (24.56%), Postives = 82/171 (47.95%), Query Frame = 1
Query:   85 QYGSKIYQLPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSIKCQKALDLLLAERNRKINLFKRRLNDLKKIVNTKKSLSMEISEEEEKCLKDFQYILDAD---DPLSEVVEARFNKIMRKI 588
            + G +  QLP+  +     +  ++S + W+  L    K  L + LP FP+ND  EK+ET+++LF G++  F N ++   R  ++G  +  I   +    L   R+ K+   +   + LK ++  ++ L    S         FQYI        PL + V+ + ++I++++
Sbjct:   34 KVGKETLQLPELFLEKRHILMSVLSTDTWDTVLTDDQKQRLEQLLPSFPSNDGEEKRETIRRLFNGENFKFGNPVEDLQRKLREGYLHPEIARYRKQTRLFRYRDYKMRQQRHLSDLLKHLLLARQGLFEHASTLAPGEPIKFQYIPPPKKKASPLEQTVKKKTSRILKEV 204          
BLAST of Nuclear factor related to kappa-B-binding protein vs. TrEMBL
Match: A0A2C9K0B7 (NFRKB_winged domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106074943 PE=4 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 1.888e-45
Identity = 115/307 (37.46%), Postives = 170/307 (55.37%), Query Frame = 1
Query: 1042 TDFFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSF-NRWAVLSIDWVGLAVPALTYLSHNELSI--------LEHRKKSQTWRW---KTEVDCHVLRRLFNDWHQISQGTNSGANRANQSV-GIECEQIAPPL--FQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPG-SEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQ 1914
            ++FF LL+ +       K +T +IEDR+R W      ++ D   N W  L   WV   V AL +LS +EL +        +++++++Q W+W     + D   L  LF  W Q         ++ + +V G++  Q +PP    +T + VR ++  E+  F+ QER+RF  P + F + +HGY+  V P++G    +D    KAR H LLV+DRPP V I+ +VRDA ARLPNGEG+R DI  L  DS F +    PG +E  I+  +S ALDRL  E  DP VKY+   KLW Y HRN++ +E E+
Sbjct:  431 SNFFCLLKSILSEFPDSKCSTPKIEDRVREW-----LDLNDEISNPWLALQKSWVDHVVSALKFLSGSELGLKVENFVPLVDYKERAQQWKWIGIGRDSDPE-LSSLFRYWLQ---------HKDDVTVDGVDSTQGSPPPPKAKTSFIVRPTSNNEKALFREQERRRFAAPHKAFTFMMHGYDSVVGPVKGVY-DKDSGANKAREHNLLVSDRPPFVTILTLVRDAAARLPNGEGTRGDICELLKDSQFLA----PGVTETQINAVVSGALDRLHSE-KDPCVKYDVTRKLWIYLHRNRTEDEFER 716          

HSP 2 Score: 61.6178 bits (148), Expect = 8.664e-6
Identity = 42/171 (24.56%), Postives = 82/171 (47.95%), Query Frame = 1
Query:   85 QYGSKIYQLPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSIKCQKALDLLLAERNRKINLFKRRLNDLKKIVNTKKSLSMEISEEEEKCLKDFQYILDAD---DPLSEVVEARFNKIMRKI 588
            + G +  QLP+  +     +  ++S + W+  L    K  L + LP FP+ND  EK+ET+++LF G++  F N ++   R  ++G  +  I   +    L   R+ K+   +   + LK ++  ++ L    S         FQYI        PL + V+ + ++I++++
Sbjct:   34 KVGKETLQLPELFLEKRHILMSVLSTDTWDTVLTDDQKQRLEQLLPSFPSNDGEEKRETIRRLFNGENFKFGNPVEDLQRKLREGYLHPEIARYRKQTRLFRYRDYKMRQQRHLSDLLKHLLLARQGLFEHASTLAPGEPIKFQYIPPPKKKASPLEQTVKKKTSRILKEV 204          
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Cavefish
Match: nfrkb (nuclear factor related to kappaB binding protein [Source:NCBI gene;Acc:103028898])

HSP 1 Score: 164.081 bits (414), Expect = 6.830e-41
Identity = 121/377 (32.10%), Postives = 186/377 (49.34%), Query Frame = 1
Query: 1024 CP---QDDFTDFFSLLQRLFVGAHQQKL-TTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLS-HNELSIL----------EHRKKSQTWRW-----KTEVDCHVLRRLFNDWHQISQGTNSGANRANQSVGIECEQIAPPLFQ--TDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQAVHIQH----------QQDDMKRYHRNSTSSNAGPSNGSGHGHRSQPSSGTTITMAGS 2058
            CP   ++    FF+LL+ +     Q  L ++  +E++++ W    + +   + N W  ++  W  L VPAL +L+  N+   +          E ++++Q W+W       E D   L  L   W +      S  +   +  G E  ++ PP  +  TD+ VR ST EER  FQ QE++R+ +P + F + +HG+   V P++G    ++ S  KAR H LL +DRP +V I+ +VRDA ARLPNGEG+RA+I  L  DS F +      +   ++  +S ALDRL  E  DP VKY+   KLW Y HR++S EE E+ +H             QQ         S +   G  +G+  G  S P  G +I  A S
Sbjct:  364 CPDIVEEIAISFFNLLEDIL---RQDPLQSSSVVEEKVQQW----QASPASALNPWFSMAPCWSELVVPALQFLAGENKAGAMALPSGFAPYVEFKEQTQQWKWIGLPQDAEKDLSALCLL---WLE------SKDHVVVKQEGEEAAELTPPAPRVWTDYVVRPSTGEERHVFQEQEQQRYDQPHKAFTFRMHGFESVVGPVKGVF-DKETSLNKAREHSLLRSDRPAYVTILSLVRDAAARLPNGEGTRAEICELLKDSQFLAPDV---TSAQVNTVVSGALDRLHYEK-DPCVKYDIGRKLWIYLHRDRSQEEFER-IHQAQAAAAKARKALQQKPKPTPKPKSGNKETGGKSGAAEGQCSVP-EGPSIPAAAS 717          

HSP 2 Score: 51.9878 bits (123), Expect = 2.941e-6
Identity = 38/169 (22.49%), Postives = 77/169 (45.56%), Query Frame = 1
Query:  103 YQLPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSIK-----CQKALDLLLAERNRKINLFKRRLNDLKK--IVNTKKSLSMEISEEEEKCLKDFQYILDADDPLSEVVEARFNKIMRKI 588
             ++P+ L+ + D    ++S + W+  L  + +  L + LP FP N+  E+   +  LF  ++  F N +    +L +DG FN  +      C K      ++R R I   ++  + L K  +V+ K+ L + +    E  +K    +    +   + V +R  +I+R +
Sbjct:   33 VRIPEDLLEDPDIFFSVMSESTWSEVLTDAQRQKLRQLLPQFPENNASEQDGVISDLFNNQNFCFGNPLHLAQKLFRDGYFNPEVVKYRQLCAK------SQRKRHIYSLQQYYHKLLKQILVSRKELLDLAVCGGPELAVKRRYTVPSHKEVQEQRVRSRVGRILRDV 195          
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Cavefish
Match: nfrkb (nuclear factor related to kappaB binding protein [Source:NCBI gene;Acc:103028898])

HSP 1 Score: 164.081 bits (414), Expect = 6.830e-41
Identity = 121/377 (32.10%), Postives = 186/377 (49.34%), Query Frame = 1
Query: 1024 CP---QDDFTDFFSLLQRLFVGAHQQKL-TTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLS-HNELSIL----------EHRKKSQTWRW-----KTEVDCHVLRRLFNDWHQISQGTNSGANRANQSVGIECEQIAPPLFQ--TDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQAVHIQH----------QQDDMKRYHRNSTSSNAGPSNGSGHGHRSQPSSGTTITMAGS 2058
            CP   ++    FF+LL+ +     Q  L ++  +E++++ W    + +   + N W  ++  W  L VPAL +L+  N+   +          E ++++Q W+W       E D   L  L   W +      S  +   +  G E  ++ PP  +  TD+ VR ST EER  FQ QE++R+ +P + F + +HG+   V P++G    ++ S  KAR H LL +DRP +V I+ +VRDA ARLPNGEG+RA+I  L  DS F +      +   ++  +S ALDRL  E  DP VKY+   KLW Y HR++S EE E+ +H             QQ         S +   G  +G+  G  S P  G +I  A S
Sbjct:  364 CPDIVEEIAISFFNLLEDIL---RQDPLQSSSVVEEKVQQW----QASPASALNPWFSMAPCWSELVVPALQFLAGENKAGAMALPSGFAPYVEFKEQTQQWKWIGLPQDAEKDLSALCLL---WLE------SKDHVVVKQEGEEAAELTPPAPRVWTDYVVRPSTGEERHVFQEQEQQRYDQPHKAFTFRMHGFESVVGPVKGVF-DKETSLNKAREHSLLRSDRPAYVTILSLVRDAAARLPNGEGTRAEICELLKDSQFLAPDV---TSAQVNTVVSGALDRLHYEK-DPCVKYDIGRKLWIYLHRDRSQEEFER-IHQAQAAAAKARKALQQKPKPTPKPKSGNKETGGKSGAAEGQCSVP-EGPSIPAAAS 717          

HSP 2 Score: 51.9878 bits (123), Expect = 2.941e-6
Identity = 38/169 (22.49%), Postives = 77/169 (45.56%), Query Frame = 1
Query:  103 YQLPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSIK-----CQKALDLLLAERNRKINLFKRRLNDLKK--IVNTKKSLSMEISEEEEKCLKDFQYILDADDPLSEVVEARFNKIMRKI 588
             ++P+ L+ + D    ++S + W+  L  + +  L + LP FP N+  E+   +  LF  ++  F N +    +L +DG FN  +      C K      ++R R I   ++  + L K  +V+ K+ L + +    E  +K    +    +   + V +R  +I+R +
Sbjct:   33 VRIPEDLLEDPDIFFSVMSESTWSEVLTDAQRQKLRQLLPQFPENNASEQDGVISDLFNNQNFCFGNPLHLAQKLFRDGYFNPEVVKYRQLCAK------SQRKRHIYSLQQYYHKLLKQILVSRKELLDLAVCGGPELAVKRRYTVPSHKEVQEQRVRSRVGRILRDV 195          
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Nematostella
Match: EDO28120 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7D0])

HSP 1 Score: 117.087 bits (292), Expect = 3.001e-30
Identity = 62/142 (43.66%), Postives = 88/142 (61.97%), Query Frame = 1
Query: 1489 ERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQ 1914
            E KR+I P   + + +HG+   V P++G        N KAR H LL+++RPP V I+ +VRDA ARLPNGEG+RA++  L  DS F +  +   ++  I   +S ALDRL  E  DP VKY++  K+W Y HRN++ EE E+
Sbjct:    1 EAKRYINPHLAYTFVMHGFESIVGPVKGVFSKETNLN-KAREHSLLISNRPPFVTILTLVRDAAARLPNGEGTRAEVCELLKDSQFLNMDA---TDAQIHTVVSGALDRLHYEK-DPCVKYDSNRKVWIYLHRNRTEEEFEK 137          
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Medaka
Match: nfrkb (nuclear factor related to kappaB binding protein [Source:NCBI gene;Acc:101163596])

HSP 1 Score: 168.703 bits (426), Expect = 2.163e-42
Identity = 115/347 (33.14%), Postives = 171/347 (49.28%), Query Frame = 1
Query: 1042 TDFFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLSHNE-----------LSILEHRKKSQTWRW-----KTEVDCHVLRRLFNDWHQISQGTNSGANRANQSVGIECEQIAP-PLFQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQAVHIQHQQDDMKRYHRNSTSSNAGPSNGSGHGHRSQPSS 2031
            T FFSLL+ +F    +   +T  +E++++ W +        S N W   +  W  L + AL +L+                 +E   + Q WRW      TE D   L +L+ D       T S      + +    E ++P P   TD+ VR ST +ER  FQ+QE++R+  P + F + +HG+   V P++G    ++ S  KAR H LL +DRPP+V I+ +VRDA ARLPNGEG+RA+I  L  DS F +      +   ++  +S ALDRL  E  DP VKY+   KLW Y HR++S EE E+    Q      ++  +      + P +GS  G    P S
Sbjct:  379 TSFFSLLESIF--RTEGLASTLMLEEKVQMWQMCP----ASSHNPWFSFASCWSDLVLQALQFLAGETKDGMMALPSGFFPFVEFVDECQQWRWIGPTQDTEKDLGALCQLWLDSKDFVVKTES------EDIS---EMMSPIPKLSTDYVVRPSTGDERQVFQIQEQQRYNEPHKAFTFRMHGFESVVGPVKGVF-DKEMSLNKAREHTLLRSDRPPYVTILSLVRDAAARLPNGEGTRAEICELLKDSQFLAPDV---TSAQVNTVVSGALDRLHYEK-DPCVKYDIGRKLWIYLHRHRSQEEFERIHQAQAAAAKARKALQQKPKPASKPKSGSKDGGGKTPGS 705          

HSP 2 Score: 58.5362 bits (140), Expect = 2.877e-8
Identity = 28/83 (33.73%), Postives = 46/83 (55.42%), Query Frame = 1
Query:  109 LPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSI 357
            LP+ L+ + D    ++S N WN  L  S + +L  FLP FP+N+  E+  T+  LF  ++ +F N +    +L +DG FN  +
Sbjct:   35 LPEDLLEDPDIFFSVLSKNTWNEVLTDSQRQHLRHFLPQFPDNNPEEQDSTIADLFNNRNFHFGNPLHLAQKLFRDGYFNPEV 117          
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Medaka
Match: nfrkb (nuclear factor related to kappaB binding protein [Source:NCBI gene;Acc:101163596])

HSP 1 Score: 168.703 bits (426), Expect = 2.163e-42
Identity = 115/347 (33.14%), Postives = 171/347 (49.28%), Query Frame = 1
Query: 1042 TDFFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLSHNE-----------LSILEHRKKSQTWRW-----KTEVDCHVLRRLFNDWHQISQGTNSGANRANQSVGIECEQIAP-PLFQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQAVHIQHQQDDMKRYHRNSTSSNAGPSNGSGHGHRSQPSS 2031
            T FFSLL+ +F    +   +T  +E++++ W +        S N W   +  W  L + AL +L+                 +E   + Q WRW      TE D   L +L+ D       T S      + +    E ++P P   TD+ VR ST +ER  FQ+QE++R+  P + F + +HG+   V P++G    ++ S  KAR H LL +DRPP+V I+ +VRDA ARLPNGEG+RA+I  L  DS F +      +   ++  +S ALDRL  E  DP VKY+   KLW Y HR++S EE E+    Q      ++  +      + P +GS  G    P S
Sbjct:  379 TSFFSLLESIF--RTEGLASTLMLEEKVQMWQMCP----ASSHNPWFSFASCWSDLVLQALQFLAGETKDGMMALPSGFFPFVEFVDECQQWRWIGPTQDTEKDLGALCQLWLDSKDFVVKTES------EDIS---EMMSPIPKLSTDYVVRPSTGDERQVFQIQEQQRYNEPHKAFTFRMHGFESVVGPVKGVF-DKEMSLNKAREHTLLRSDRPPYVTILSLVRDAAARLPNGEGTRAEICELLKDSQFLAPDV---TSAQVNTVVSGALDRLHYEK-DPCVKYDIGRKLWIYLHRHRSQEEFERIHQAQAAAAKARKALQQKPKPASKPKSGSKDGGGKTPGS 705          

HSP 2 Score: 58.5362 bits (140), Expect = 2.877e-8
Identity = 28/83 (33.73%), Postives = 46/83 (55.42%), Query Frame = 1
Query:  109 LPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSI 357
            LP+ L+ + D    ++S N WN  L  S + +L  FLP FP+N+  E+  T+  LF  ++ +F N +    +L +DG FN  +
Sbjct:   35 LPEDLLEDPDIFFSVLSKNTWNEVLTDSQRQHLRHFLPQFPDNNPEEQDSTIADLFNNRNFHFGNPLHLAQKLFRDGYFNPEV 117          
BLAST of Nuclear factor related to kappa-B-binding protein vs. Planmine SMEST
Match: SMESG000024916.1 (SMESG000024916.1)

HSP 1 Score: 1490.32 bits (3857), Expect = 0.000e+0
Identity = 793/794 (99.87%), Postives = 793/794 (99.87%), Query Frame = 1
Query:   64 MANVMNIQYGSKIYQLPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSIKCQKALDLLLAERNRKINLFKRRLNDLKKIVNTKKSLSMEISEEEEKCLKDFQYILDADDPLSEVVEARFNKIMRKITCDPDEYKKSEICAEFVANAANIDYKSMLLCDVINRCQNESDSIQDHQLEXXXXXXXXXXXXXPMTRKRRQLQNGYSNSLSKYAKFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVGSGLAQSANQKPARLNRHERREFRCPQDDFTDFFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLSHNELSILEHRKKSQTWRWKTEVDCHVLRRLFNDWHQISQGTNSGANRANQSVGIECEQIAPPLFQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQAVHIQHQQDDMKRYHRNSTSSNAGPSNGSGHGHRSQPSSGTTITMAGSQQQQSGSLVYGQILLSSNTGYQHGSVSRYGQVQSYQQFSQAVNHARDLTLQQPIYISRPLSSANSGLLYNQHSQQLFPSSTNHSLSSSAVPRIITPVPSQQRHHDDLPLPEFYAXXXXXXXXXXXXXFY 2445
            MANVMNIQYGSKIYQLPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSIKCQKALDLLLAERNRKINLFKRRLNDLKKIVNTKKSLSMEISEEEEKCLKDFQYILDADDPLSEVVEARFNKIMRKITCDPDEYKKSEICAEFVANAANIDYKSMLLCDVINRCQNESDSIQDHQLESVGVVNSNGLGGGPMTRKRRQLQNGYSNSLSKYAKFSESISDSQSDSSDDNRMSNDDNSDNESITSDTDSVGSGLAQSANQKPARLNRHERREFRCPQDDFTDFFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLSHNELSILEHRKKSQTWRWKTEVDCHVLRRLFNDWHQISQGTNS ANRANQSVGIECEQIAPPLFQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQAVHIQHQQDDMKRYHRNSTSSNAGPSNGSGHGHRSQPSSGTTITMAGSQQQQSGSLVYGQILLSSNTGYQHGSVSRYGQVQSYQQFSQAVNHARDLTLQQPIYISRPLSSANSGLLYNQHSQQLFPSSTNHSLSSSAVPRIITPVPSQQRHHDDLPLPEFYANHNHHYQQQQQQNFY
Sbjct:    1 MANVMNIQYGSKIYQLPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSIKCQKALDLLLAERNRKINLFKRRLNDLKKIVNTKKSLSMEISEEEEKCLKDFQYILDADDPLSEVVEARFNKIMRKITCDPDEYKKSEICAEFVANAANIDYKSMLLCDVINRCQNESDSIQDHQLESVGVVNSNGLGGGPMTRKRRQLQNGYSNSLSKYAKFSESISDSQSDSSDDNRMSNDDNSDNESITSDTDSVGSGLAQSANQKPARLNRHERREFRCPQDDFTDFFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLSHNELSILEHRKKSQTWRWKTEVDCHVLRRLFNDWHQISQGTNSVANRANQSVGIECEQIAPPLFQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQAVHIQHQQDDMKRYHRNSTSSNAGPSNGSGHGHRSQPSSGTTITMAGSQQQQSGSLVYGQILLSSNTGYQHGSVSRYGQVQSYQQFSQAVNHARDLTLQQPIYISRPLSSANSGLLYNQHSQQLFPSSTNHSLSSSAVPRIITPVPSQQRHHDDLPLPEFYANHNHHYQQQQQQNFY 794          
BLAST of Nuclear factor related to kappa-B-binding protein vs. Planmine SMEST
Match: SMESG000024916.1 (SMESG000024916.1)

HSP 1 Score: 1481.85 bits (3835), Expect = 0.000e+0
Identity = 789/790 (99.87%), Postives = 789/790 (99.87%), Query Frame = 1
Query:   76 MNIQYGSKIYQLPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSIKCQKALDLLLAERNRKINLFKRRLNDLKKIVNTKKSLSMEISEEEEKCLKDFQYILDADDPLSEVVEARFNKIMRKITCDPDEYKKSEICAEFVANAANIDYKSMLLCDVINRCQNESDSIQDHQLEXXXXXXXXXXXXXPMTRKRRQLQNGYSNSLSKYAKFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVGSGLAQSANQKPARLNRHERREFRCPQDDFTDFFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLSHNELSILEHRKKSQTWRWKTEVDCHVLRRLFNDWHQISQGTNSGANRANQSVGIECEQIAPPLFQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQAVHIQHQQDDMKRYHRNSTSSNAGPSNGSGHGHRSQPSSGTTITMAGSQQQQSGSLVYGQILLSSNTGYQHGSVSRYGQVQSYQQFSQAVNHARDLTLQQPIYISRPLSSANSGLLYNQHSQQLFPSSTNHSLSSSAVPRIITPVPSQQRHHDDLPLPEFYAXXXXXXXXXXXXXFY 2445
            MNIQYGSKIYQLPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSIKCQKALDLLLAERNRKINLFKRRLNDLKKIVNTKKSLSMEISEEEEKCLKDFQYILDADDPLSEVVEARFNKIMRKITCDPDEYKKSEICAEFVANAANIDYKSMLLCDVINRCQNESDSIQDHQLESVGVVNSNGLGGGPMTRKRRQLQNGYSNSLSKYAKFSESISDSQSDSSDDNRMSNDDNSDNESITSDTDSVGSGLAQSANQKPARLNRHERREFRCPQDDFTDFFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLSHNELSILEHRKKSQTWRWKTEVDCHVLRRLFNDWHQISQGTNS ANRANQSVGIECEQIAPPLFQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQAVHIQHQQDDMKRYHRNSTSSNAGPSNGSGHGHRSQPSSGTTITMAGSQQQQSGSLVYGQILLSSNTGYQHGSVSRYGQVQSYQQFSQAVNHARDLTLQQPIYISRPLSSANSGLLYNQHSQQLFPSSTNHSLSSSAVPRIITPVPSQQRHHDDLPLPEFYANHNHHYQQQQQQNFY
Sbjct:    1 MNIQYGSKIYQLPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLKFLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSIKCQKALDLLLAERNRKINLFKRRLNDLKKIVNTKKSLSMEISEEEEKCLKDFQYILDADDPLSEVVEARFNKIMRKITCDPDEYKKSEICAEFVANAANIDYKSMLLCDVINRCQNESDSIQDHQLESVGVVNSNGLGGGPMTRKRRQLQNGYSNSLSKYAKFSESISDSQSDSSDDNRMSNDDNSDNESITSDTDSVGSGLAQSANQKPARLNRHERREFRCPQDDFTDFFSLLQRLFVGAHQQKLTTHQIEDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLSHNELSILEHRKKSQTWRWKTEVDCHVLRRLFNDWHQISQGTNSVANRANQSVGIECEQIAPPLFQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAPIRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRADIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARLKLWFYRHRNKSLEELEQAVHIQHQQDDMKRYHRNSTSSNAGPSNGSGHGHRSQPSSGTTITMAGSQQQQSGSLVYGQILLSSNTGYQHGSVSRYGQVQSYQQFSQAVNHARDLTLQQPIYISRPLSSANSGLLYNQHSQQLFPSSTNHSLSSSAVPRIITPVPSQQRHHDDLPLPEFYANHNHHYQQQQQQNFY 790          
The following BLAST results are available for this feature:
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NFRKB1.651e-4034.75nuclear factor related to kappaB binding protein [... [more]
NFRKB1.964e-4034.75nuclear factor related to kappaB binding protein [... [more]
NFRKB1.964e-4034.75nuclear factor related to kappaB binding protein [... [more]
NFRKB1.119e-3935.00nuclear factor related to kappaB binding protein [... [more]
NFRKB1.827e-829.21nuclear factor related to kappaB binding protein [... [more]
back to top
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG119702.972e-3834.64gene:FBgn0027503 transcript:FBtr0081959[more]
CG119702.972e-3834.64gene:FBgn0027503 transcript:FBtr0346139[more]
back to top
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nfrkb3.218e-4033.88nuclear factor related to kappaB binding protein [... [more]
back to top
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
blmh1.388e-4034.43bleomycin hydrolase [Source:Xenbase;Acc:XB-GENE-99... [more]
blmh2.015e-3934.58bleomycin hydrolase [Source:Xenbase;Acc:XB-GENE-99... [more]
blmh3.519e-3834.95bleomycin hydrolase [Source:Xenbase;Acc:XB-GENE-99... [more]
blmh8.176e-3734.60bleomycin hydrolase [Source:Xenbase;Acc:XB-GENE-99... [more]
seh1l9.282e-729.63SEH1 like nucleoporin [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Nfrkb3.091e-4135.22nuclear factor related to kappa B binding protein ... [more]
Nfrkb2.421e-829.21nuclear factor related to kappa B binding protein ... [more]
Nfrkb4.782e-829.21nuclear factor related to kappa B binding protein ... [more]
Nfrkb1.307e-729.21nuclear factor related to kappa B binding protein ... [more]
back to top
BLAST of Nuclear factor related to kappa-B-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q6PIJ4|NFRKB_MOUSE2.162e-4035.22Nuclear factor related to kappa-B-binding protein ... [more]
sp|Q6P4L9|NFRKB_XENTR9.420e-4034.43Nuclear factor related to kappa-B-binding protein ... [more]
sp|Q6P4R8|NFRKB_HUMAN9.431e-4034.75Nuclear factor related to kappa-B-binding protein ... [more]
back to top
BLAST of Nuclear factor related to kappa-B-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A293MPI12.799e-4732.53NFRKB_winged domain-containing protein (Fragment) ... [more]
R7VJU81.465e-4635.50NFRKB_winged domain-containing protein (Fragment) ... [more]
A0A293LFU62.043e-4632.22NFRKB_winged domain-containing protein (Fragment) ... [more]
A0A2C9K0B61.867e-4537.46NFRKB_winged domain-containing protein OS=Biomphal... [more]
A0A2C9K0B71.888e-4537.46NFRKB_winged domain-containing protein OS=Biomphal... [more]
back to top
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nfrkb6.830e-4132.10nuclear factor related to kappaB binding protein [... [more]
nfrkb6.830e-4132.10nuclear factor related to kappaB binding protein [... [more]
back to top
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO281203.001e-3043.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nuclear factor related to kappa-B-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nfrkb2.163e-4233.14nuclear factor related to kappaB binding protein [... [more]
nfrkb2.163e-4233.14nuclear factor related to kappaB binding protein [... [more]
back to top
BLAST of Nuclear factor related to kappa-B-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000024916.10.000e+099.87SMESG000024916.1[more]
SMESG000024916.10.000e+099.87SMESG000024916.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001713 ID=SMED30001713|Name=Nuclear factor related to kappa-B-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2632bp
TTTAATTGTTTTTAAGTTGTATCAAGGATATTTTATTACCTAGTTATTTT
TGTAATTTTAATCATGGCCAACGTTATGAATATACAATATGGCAGCAAAA
TATATCAATTGCCTAAATCCTTAATTATTAATGAAGATTTTGTCAAAGAA
ATAGTATCTGCCAACGTATGGAACAATAAGTTACGTAAAAGTGATAAAAT
GAATTTACTTAAATTTTTACCCGATTTTCCAAATAATGATACTTATGAAA
AAAAAGAAACATTAAAGAAATTATTCCTCGGGAAACATATCAATTTTGAA
AACCAGATCAAAACTTTTGTCCGCTTAGCAAAAGATGGCGATTTCAATTC
TTCCATAAAATGCCAGAAAGCGCTCGACTTACTGCTGGCAGAACGCAATA
GAAAAATTAATTTATTTAAGCGCCGATTGAATGACCTGAAGAAAATTGTT
AACACAAAAAAATCTTTGTCAATGGAAATCAGTGAGGAAGAAGAGAAATG
CTTGAAGGATTTCCAATATATTCTCGATGCCGACGATCCGTTGTCGGAAG
TCGTTGAGGCGCGGTTCAATAAAATCATGCGGAAGATTACCTGCGATCCA
GACGAGTACAAGAAATCGGAAATCTGTGCCGAATTCGTAGCAAACGCAGC
GAATATCGATTACAAATCCATGTTGTTGTGTGATGTGATTAATCGATGCC
AGAACGAGAGCGACAGCATCCAGGATCACCAATTGGAATCAGTTGGCGTT
GTCAATAGTAACGGTCTCGGCGGAGGACCAATGACTCGCAAGCGCCGCCA
ACTGCAAAATGGATACAGCAACAGCTTGTCGAAATACGCAAAATTCAGTG
AGTCAATCAGTGACAGCCAATCAGATTCCTCGGACGACAATCGGATGAGC
AACGACGACAACAGTGATAATGAATCTATAACAAGCGACACCGACTCGGT
TGGCAGCGGGCTTGCCCAGTCAGCCAATCAGAAACCAGCCCGATTGAATC
GTCACGAAAGGCGAGAGTTTCGCTGTCCACAAGATGATTTCACTGATTTC
TTCTCGTTACTTCAGCGACTATTTGTTGGTGCACATCAACAGAAACTGAC
CACACATCAGATAGAAGATCGGATCAGACATTGGCATATTGTGCATAAGC
GGAACATCGGAGACAGTTTTAATCGCTGGGCGGTGCTCAGTATTGATTGG
GTTGGTCTGGCTGTGCCTGCACTCACTTATCTCAGCCACAACGAGCTTTC
AATCCTTGAGCACCGCAAGAAGTCGCAGACGTGGCGATGGAAAACTGAGG
TCGATTGTCATGTGTTGCGGAGGCTGTTCAATGATTGGCACCAAATATCA
CAGGGAACCAATTCTGGTGCTAATCGAGCCAATCAATCGGTCGGTATTGA
GTGTGAGCAGATCGCTCCGCCTTTGTTTCAGACCGATTGGAAGGTGCGCC
AATCAACGGCCGAGGAACGAATGCGGTTCCAGATGCAGGAAAGGAAGCGG
TTTATACGCCCGTGGCGGGGGTTCCTCTATAATGTCCACGGATACAATTG
TGCAGTGGCACCCATTCGTGGCTGTCTGCCAGGTCGCGATTACAGCAATG
TTAAGGCGCGCGGTCACCCGTTACTTGTCAATGATCGACCGCCTCATGTA
AACATCGTGGAAATTGTTCGGGATGCGGTTGCTAGACTCCCGAATGGTGA
AGGGTCTCGAGCCGATATTGTTTCTCTGGCAATGGACAGCGCATTCTGGA
GCAACACATCCGGACCCGGCAGCGAGAAAAGCATCAGTCAGTGCATAAGT
TCTGCCCTCGATCGATTGCAAGGCGAAGGTTGCGATCCATCGGTCAAGTA
CAACGCTCGACTCAAACTCTGGTTTTACCGTCACAGGAACAAGAGCCTCG
AAGAACTGGAACAGGCTGTGCACATTCAGCATCAACAGGATGACATGAAA
AGGTACCATCGCAATTCTACCTCATCGAATGCCGGCCCTAGCAACGGTTC
CGGCCATGGACATCGGTCACAACCGTCGTCTGGAACCACCATCACTATGG
CAGGATCTCAACAGCAGCAGTCAGGATCATTGGTATATGGCCAAATATTG
CTAAGTAGTAACACAGGGTACCAGCACGGTTCTGTTTCCCGATATGGCCA
GGTACAGAGCTATCAGCAGTTCTCTCAGGCCGTCAATCACGCGCGTGATC
TCACTTTGCAGCAGCCCATATACATTTCCCGCCCTCTTTCCAGCGCTAAT
TCTGGGCTCCTATACAATCAACACTCCCAGCAACTATTCCCCTCCTCTAC
TAATCATTCATTATCCTCTTCAGCAGTCCCACGTATCATTACCCCAGTTC
CGTCTCAGCAACGCCATCATGATGATTTACCGCTCCCGGAATTCTATGCC
AACCACAATCATCATTATCAACAACAGCAGCAGCAAAATTTCTATTAATA
ACTACCAGCACTCTACTTGATTTATTGGTTATTTTATGTATTTATCATCA
AATATATTATTATGTCTTTATTCTATTATTAATTTTTAAACGACCTTCCA
GTCCGTGAATGTGTACTAAAATCATGGCGGTTTTACTTTGTGTATCGGCT
TCTTTCCCAATCTTTGGTAGCATCTTTCGTAC
back to top

protein sequence of SMED30001713-orf-1

>SMED30001713-orf-1 ID=SMED30001713-orf-1|Name=SMED30001713-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=795bp
MANVMNIQYGSKIYQLPKSLIINEDFVKEIVSANVWNNKLRKSDKMNLLK
FLPDFPNNDTYEKKETLKKLFLGKHINFENQIKTFVRLAKDGDFNSSIKC
QKALDLLLAERNRKINLFKRRLNDLKKIVNTKKSLSMEISEEEEKCLKDF
QYILDADDPLSEVVEARFNKIMRKITCDPDEYKKSEICAEFVANAANIDY
KSMLLCDVINRCQNESDSIQDHQLESVGVVNSNGLGGGPMTRKRRQLQNG
YSNSLSKYAKFSESISDSQSDSSDDNRMSNDDNSDNESITSDTDSVGSGL
AQSANQKPARLNRHERREFRCPQDDFTDFFSLLQRLFVGAHQQKLTTHQI
EDRIRHWHIVHKRNIGDSFNRWAVLSIDWVGLAVPALTYLSHNELSILEH
RKKSQTWRWKTEVDCHVLRRLFNDWHQISQGTNSGANRANQSVGIECEQI
APPLFQTDWKVRQSTAEERMRFQMQERKRFIRPWRGFLYNVHGYNCAVAP
IRGCLPGRDYSNVKARGHPLLVNDRPPHVNIVEIVRDAVARLPNGEGSRA
DIVSLAMDSAFWSNTSGPGSEKSISQCISSALDRLQGEGCDPSVKYNARL
KLWFYRHRNKSLEELEQAVHIQHQQDDMKRYHRNSTSSNAGPSNGSGHGH
RSQPSSGTTITMAGSQQQQSGSLVYGQILLSSNTGYQHGSVSRYGQVQSY
QQFSQAVNHARDLTLQQPIYISRPLSSANSGLLYNQHSQQLFPSSTNHSL
SSSAVPRIITPVPSQQRHHDDLPLPEFYANHNHHYQQQQQQNFY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR038106NFRKB_winged_sf
IPR024867NFRKB
IPR025220NFRKB_winged_dom
Vocabulary: cellular component
TermDefinition
GO:0031011Ino80 complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 125..145
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 283..308
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 262..316
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 634..666
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 620..666
NoneNo IPR availablePANTHERPTHR13052:SF0NUCLEAR FACTOR RELATED TO KAPPA-B-BINDING PROTEINcoord: 340..710
coord: 7..298
IPR038106NFRKB winged helix-like domain superfamilyGENE3DG3DSA:1.10.10.2430coord: 323..442
e-value: 1.6E-7
score: 32.9
IPR025220NFRKB winged helix-like domainPFAMPF14465NFRKB_wingedcoord: 329..410
e-value: 1.3E-7
score: 31.7
IPR024867Nuclear factor related to kappa-B-binding proteinPANTHERPTHR13052NFRKB-RELATEDcoord: 340..710
coord: 7..298