C2H2-type domain-containing protein

Overview
NameC2H2-type domain-containing protein
Smed IDSMED30001706
Length (bp)5153
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of C2H2-type domain-containing protein (SMED30001706) t-SNE clustered cells

Violin plots show distribution of expression levels for C2H2-type domain-containing protein (SMED30001706) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of C2H2-type domain-containing protein (SMED30001706) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for C2H2-type domain-containing protein (SMED30001706) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001706

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30001706h1SMcG0004821 Contig5531GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30001706h1SMcG0004821 Contig53669uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001706h1SMcG0004821 Contig53669newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30001706h1SMcG0004821 dd_Smed_v4_11532_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001706h1SMcG0004821 dd_Smed_v4_11532_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001706h1SMcG0004821 dd_Smed_v4_23154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30001706h1SMcG0004821 dd_Smed_v4_1738_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30001706h1SMcG0004821 dd_Smed_v4_1738_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30001706h1SMcG0004821 dd_Smed_v4_1738_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001706h1SMcG0004821 dd_Smed_v4_1738_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001706h1SMcG0004821 dd_Smed_v4_1738_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001706h1SMcG0004821 dd_Smed_v4_1738_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001706h1SMcG0004821 dd_Smed_v4_1738_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30001706h1SMcG0004821 dd_Smed_v4_1738_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30001706h1SMcG0020377 dd_Smed_v4_11532_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001706h1SMcG0020377 dd_Smed_v4_11532_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30001706h1SMcG0004821 dd_Smed_v6_11532_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30001706h1SMcG0020377 dd_Smed_v6_11532_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Match: SLC12A9 (solute carrier family 12 member 9 [Source:HGNC Symbol;Acc:HGNC:17435])

HSP 1 Score: 86.2705 bits (212), Expect = 4.433e-16
Identity = 62/236 (26.27%), Postives = 105/236 (44.49%), Query Frame = 1
Query: 4351 EYVGIIADCMKMQKNICLCRHFENM--DLIGLKASNSSECQYIDVWPINFFQP-GSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYY-TIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLE---------TNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEV 5019
            +YV  +AD +KM KN+ L R    +  + +   +  +S+  ++DVWP+N  +P G   Y+D   +F+LQ++ IL M   W S  ++R+++CL      G     ++ L ++L    RI+AE++ V W +     E          N GR      A++     +                        + TA+ F YLP  P       + +Y+  L  LT DL P++ V G+  V
Sbjct:  682 DYVATVADALKMNKNVVLARASGALPPERLSRGSGGTSQLHHVDVWPLNLLRPRGGPGYVDVCGLFLLQMATILGMVPAWHS-ARLRIFLCLGPREAPGAAEGRLRALLSQL----RIRAEVQEVVWGEGAGAGEPEAEEEGDFVNSGRGDAEAEALARSANALVRAQQGRGTGGGPGGPEGGDAEGPI-TALTFLYLPRPP--ADPARYPRYLALLETLTRDLGPTLLVHGVTPV 909          

HSP 2 Score: 56.225 bits (134), Expect = 6.624e-7
Identity = 21/57 (36.84%), Postives = 39/57 (68.42%), Query Frame = 3
Query: 3756 FRNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPK 3926
            +  +  + D  ++KAF+D+T++P++R G + L  + GLGG+  NT+ +GF DD+ P+
Sbjct:  582 YGAWLSLVDRAQVKAFVDLTLSPSVRQGAQHLLRISGLGGMKPNTLVLGFYDDAPPQ 638          
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Match: ZC53.4 (pep chromosome:WBcel235:X:1925750:1937689:1 gene:WBGene00022511.1 transcript:ZC53.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZC53.4)

HSP 1 Score: 100.138 bits (248), Expect = 3.370e-43
Identity = 106/410 (25.85%), Postives = 175/410 (42.68%), Query Frame = 1
Query:  862 PYHEFENFNFKYKVPFVCYSDFEA--WN-KVAEYN-------DIKGEQIGFCFSIYIKSNYPNLLEDRHIVYKGEDVAFKFTETINELSEKLKIKLKTNYPIDVNESQQKEYDNCKMC-----FYRNKELVNDKVIDHDHYLEKENYSGASHADCN-LKTKNNLVPIYFLNGTGYDNHLIFLPLAPN---------ITKIIPSTDEKYISFSVGYLRFLDSYKMMPLPLEYLASLLKPEDLKIFNKFYP-EFNLKIRKGIYPYEYMSGKNYEDIEQKLSESQLPEISKFYNHLKTYKLSEVDYKYAQESWELLDCKNMEEYTIHYLNMDVFLLADLFENFRNVCLENFGIDPRYCYSQSGLTWVNGMKFTQVKLKNFNKKSYDQLLMIEKGVKGGFSGVLGDRLEEVNER 2013
            P       N + K  ++ Y+DFE+  W    A Y        D+ GE +   F + +  ++   + +    Y G +   +F + I ++S+++ + L +     + + +  E++  + C      Y  +++   KV DHDH+  +  Y G     CN L+ KNN +P++F N  GYD+HLI   L            I KI  +T EK+ISFS                                  + P +F L  +KG+YPYEYM      D  ++  +++LP   KFY+ L   K                 CK                +AD+FENFR + L  + +DP + ++  GL W   +K T+V+L   +    +  LMIEKG++GG    +  R  +VN +
Sbjct:  861 PSRRMTTDNSRVKHRYIIYADFESIIWKFSNAHYKPNESWTMDV-GEHVASRFCVVVVDSFTKKIHNMK-SYIGYNATLEFNKYIIKISQEI-MSLPSVRMKKLTQDEWTEFNKNQECPHCQVQYNTEDMKTTKVRDHDHWTGE--YRGPFCGSCNILRRKNNFIPVFFHNLKGYDSHLIVGCLESTKYLNEHEIEIEKISSNT-EKFISFS----------------------------------YNPHQFQLMRKKGVYPYEYM------DSFKRFDKTKLPNRDKFYDKLNNKK-----------------CKRKG-------------IADVFENFRALSLRVYQLDPCWYFTSPGLAWDAMLKKTKVELDKLH--DVEMYLMIEKGIRGGIVNAVK-RYSKVNNK 1191          

HSP 2 Score: 96.6709 bits (239), Expect = 3.370e-43
Identity = 69/200 (34.50%), Postives = 104/200 (52.00%), Query Frame = 2
Query: 2033 F*CQLIVSNING**TPNREMEFCKDNK-YTNTILNHSIGYMYIVDLKYPEELHDKTQYFPFSPRKVKVQEESLSQWQKENNHYGYKSTEKLIQFQNDLKEYVIEGRCLNWYLVNGMVLEKLHKKIMSNKSYWLKPYIELNIKKRTGAKQEEDKFGDIFYKLLNNAFYGKTLENVRNRQSIEIVGTKEKLKSIAAKAGYQR 2629
            F  Q ++S +NG      E E   D K Y N +     G ++ VDL+YP+E+H +    P  P  VK+           +NH      +KL     D ++YVI    L   L  G+ L+K+H+ I   +S WL  YIE+N   R  AK +   F   FYKL+NN+ +GKT+ENVR R  + +V  ++K+K +A+K  ++R
Sbjct: 1229 FETQSLISILNG------EAEVKSDLKDYINYLKKLDRGCIFEVDLEYPKEIHSRHNDSPLCPENVKI-----------DNHV----IKKLCNTLFDREKYVIHYENLLQCLQLGLKLKKIHRIITFKESNWLASYIEMNTNPRKNAKND---FEKDFYKLMNNSVFGKTMENVRERVDVRLVTDEDKIKKLASKPNFKR 1404          
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Match: T04B8.5 (pep chromosome:WBcel235:II:614770:621330:-1 gene:WBGene00020207.1 transcript:T04B8.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T04B8.5)

HSP 1 Score: 129.028 bits (323), Expect = 1.225e-29
Identity = 78/237 (32.91%), Postives = 133/237 (56.12%), Query Frame = 1
Query: 4327 NNDQVSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPG-SGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 5034
            N ++++ V+YV ++ D + M KN+C+ RHF  +D   L    + + +YIDVWP++  +P  +G   DN+ +F+LQLSCIL+MSS+W S  K+RV+IC++  ++    +  ++L N +L   RI+ E   V WD +  + +         N   S    T S+    LP  YV   N+++K ++  + A+    LP+ P+       R Y+  +  LT+ LPP++ V G+  VI++AL
Sbjct:  718 NLERLTPVDYVNVLKDVLHMTKNLCVARHFSKLDKEALARGWNGQKRYIDVWPVDLQKPQETGLGWDNSSLFLLQLSCILSMSSRWRSYTKLRVFICVN--SLQDMHRRERQLKN-MLQTLRIEGESSVVPWDHVVCHYQP-------PNATASANTATPSV---DLPPAYVSAFNDMVKRYSE-DAAITLLNLPVPPDNADIDADR-YLEMVRNLTDALPPTLLVHGVSSVISTAL 939          

HSP 2 Score: 54.6842 bits (130), Expect = 6.907e-7
Identity = 24/59 (40.68%), Postives = 39/59 (66.10%), Query Frame = 3
Query: 3753 IFRNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKV 3929
            +F  +  + D+LK+KAF+++T++  IR G +QL  L GLG +  NTV IGF + +  +V
Sbjct:  622 VFPYWLSLIDYLKLKAFVELTMSNNIRHGIQQLMRLSGLGAMKPNTVVIGFHELAPSQV 680          
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Match: T04B8.5 (pep chromosome:WBcel235:II:614770:624543:-1 gene:WBGene00020207.1 transcript:T04B8.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T04B8.5)

HSP 1 Score: 129.028 bits (323), Expect = 1.230e-29
Identity = 78/237 (32.91%), Postives = 133/237 (56.12%), Query Frame = 1
Query: 4327 NNDQVSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPG-SGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 5034
            N ++++ V+YV ++ D + M KN+C+ RHF  +D   L    + + +YIDVWP++  +P  +G   DN+ +F+LQLSCIL+MSS+W S  K+RV+IC++  ++    +  ++L N +L   RI+ E   V WD +  + +         N   S    T S+    LP  YV   N+++K ++  + A+    LP+ P+       R Y+  +  LT+ LPP++ V G+  VI++AL
Sbjct:  731 NLERLTPVDYVNVLKDVLHMTKNLCVARHFSKLDKEALARGWNGQKRYIDVWPVDLQKPQETGLGWDNSSLFLLQLSCILSMSSRWRSYTKLRVFICVN--SLQDMHRRERQLKN-MLQTLRIEGESSVVPWDHVVCHYQP-------PNATASANTATPSV---DLPPAYVSAFNDMVKRYSE-DAAITLLNLPVPPDNADIDADR-YLEMVRNLTDALPPTLLVHGVSSVISTAL 952          

HSP 2 Score: 54.6842 bits (130), Expect = 7.235e-7
Identity = 24/59 (40.68%), Postives = 39/59 (66.10%), Query Frame = 3
Query: 3753 IFRNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKV 3929
            +F  +  + D+LK+KAF+++T++  IR G +QL  L GLG +  NTV IGF + +  +V
Sbjct:  635 VFPYWLSLIDYLKLKAFVELTMSNNIRHGIQQLMRLSGLGAMKPNTVVIGFHELAPSQV 693          
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Match: T04B8.5 (pep chromosome:WBcel235:II:614767:620909:-1 gene:WBGene00020207.1 transcript:T04B8.5d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T04B8.5)

HSP 1 Score: 127.872 bits (320), Expect = 2.139e-29
Identity = 78/237 (32.91%), Postives = 133/237 (56.12%), Query Frame = 1
Query: 4327 NNDQVSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPG-SGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 5034
            N ++++ V+YV ++ D + M KN+C+ RHF  +D   L    + + +YIDVWP++  +P  +G   DN+ +F+LQLSCIL+MSS+W S  K+RV+IC++  ++    +  ++L N +L   RI+ E   V WD +  + +         N   S    T S+    LP  YV   N+++K ++  + A+    LP+ P+       R Y+  +  LT+ LPP++ V G+  VI++AL
Sbjct:  659 NLERLTPVDYVNVLKDVLHMTKNLCVARHFSKLDKEALARGWNGQKRYIDVWPVDLQKPQETGLGWDNSSLFLLQLSCILSMSSRWRSYTKLRVFICVN--SLQDMHRRERQLKN-MLQTLRIEGESSVVPWDHVVCHYQP-------PNATASANTATPSV---DLPPAYVSAFNDMVKRYSE-DAAITLLNLPVPPDNADIDADR-YLEMVRNLTDALPPTLLVHGVSSVISTAL 880          

HSP 2 Score: 54.6842 bits (130), Expect = 6.487e-7
Identity = 24/59 (40.68%), Postives = 39/59 (66.10%), Query Frame = 3
Query: 3753 IFRNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKV 3929
            +F  +  + D+LK+KAF+++T++  IR G +QL  L GLG +  NTV IGF + +  +V
Sbjct:  563 VFPYWLSLIDYLKLKAFVELTMSNNIRHGIQQLMRLSGLGAMKPNTVVIGFHELAPSQV 621          
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Match: H12I13.3 (pep chromosome:WBcel235:II:6071386:6073251:-1 gene:WBGene00019192.1 transcript:H12I13.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H12I13.3)

HSP 1 Score: 68.1662 bits (165), Expect = 3.488e-11
Identity = 41/133 (30.83%), Postives = 72/133 (54.14%), Query Frame = 2
Query: 2276 YGYKSTEKLIQFQNDLKEYVIEGRCLNWYLVNGMVLEKLHKKIMSNKSYWLKPYIELNIKKRTGAKQEEDKFGDIFYKLLNNAFYGKTLENVRNRQSIEIVGTKEKLKSIAAKAGYQRMKIFSEECDTVHFKK 2674
            Y + S     ++ N L+  +   + L   L +G+ L+K+H+ +   +S W+K YI LN   R   KQ ++ F   F+KL+NN+ +GKT+EN+RNR +I +V   +    +  K  ++   I +E+  +V   K
Sbjct:  267 YCFNSFRSKTKYDNHLEIMLNLIKALIQALNHGLKLKKIHRILTFKESAWMKKYIMLNTNLR---KQAKNDFEKDFFKLMNNSVFGKTMENIRNRVNIRLVTDDDSALKLIRKPNFKNSTIITEDLLSVELTK 396          
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Match: CG10413 (gene:FBgn0032689 transcript:FBtr0343829)

HSP 1 Score: 108.227 bits (269), Expect = 3.630e-23
Identity = 80/247 (32.39%), Postives = 132/247 (53.44%), Query Frame = 1
Query: 4351 EYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICL--DYYTIGT--NRKNVQELWNEL-----LIQWRIQAEIKTVG-WD---DITMNLETNLGRKIMSNNAM---SDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRK---YINQLTLLTNDLPPSVFVRGLHEVITSAL 5034
            EYV I+ D ++M+KN+CLCR+F+ +D   +  S S   +YIDVWPIN F P SG   D   +FM+QL+ I  M ++W    ++R+++C   D  T+GT   +    E+++++     L + RI A+I  +  W    D + +  T       ++N +    DE+   +L    L   Y++  N +I+   S  TA+ F YL   P ++   F ++   Y+  LT LT DLPP++ V G+  V ++ L
Sbjct:  704 EYVQILCDTLRMKKNLCLCRNFQRLDKNFI--SMSKHVKYIDVWPINIFNPTSGDPFDMVSLFMMQLAVI--MLAKW-KHLRVRIFLCEANDERTVGTFDTQTPQMEIFSKMKLEQSLKELRITADIVEIQEWSRDTDFSRHARTLKQFTAQADNVVLEDDDEVGEETLNRSLL---YMQRANQIIR-ERSDQTALSFIYLAAPPKLSAPDFAQRSASYMELLTELTADLPPTILVHGVSTVTSTTL 941          
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Match: CG10413 (gene:FBgn0032689 transcript:FBtr0081080)

HSP 1 Score: 108.227 bits (269), Expect = 3.630e-23
Identity = 80/247 (32.39%), Postives = 132/247 (53.44%), Query Frame = 1
Query: 4351 EYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICL--DYYTIGT--NRKNVQELWNEL-----LIQWRIQAEIKTVG-WD---DITMNLETNLGRKIMSNNAM---SDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRK---YINQLTLLTNDLPPSVFVRGLHEVITSAL 5034
            EYV I+ D ++M+KN+CLCR+F+ +D   +  S S   +YIDVWPIN F P SG   D   +FM+QL+ I  M ++W    ++R+++C   D  T+GT   +    E+++++     L + RI A+I  +  W    D + +  T       ++N +    DE+   +L    L   Y++  N +I+   S  TA+ F YL   P ++   F ++   Y+  LT LT DLPP++ V G+  V ++ L
Sbjct:  704 EYVQILCDTLRMKKNLCLCRNFQRLDKNFI--SMSKHVKYIDVWPINIFNPTSGDPFDMVSLFMMQLAVI--MLAKW-KHLRVRIFLCEANDERTVGTFDTQTPQMEIFSKMKLEQSLKELRITADIVEIQEWSRDTDFSRHARTLKQFTAQADNVVLEDDDEVGEETLNRSLL---YMQRANQIIR-ERSDQTALSFIYLAAPPKLSAPDFAQRSASYMELLTELTADLPPTILVHGVSTVTSTTL 941          
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Match: slc12a9 (solute carrier family 12 member 9 [Source:NCBI gene;Acc:793341])

HSP 1 Score: 130.568 bits (327), Expect = 5.678e-30
Identity = 79/231 (34.20%), Postives = 120/231 (51.95%), Query Frame = 1
Query: 4351 EYVGIIADCMKMQKNICLCRHFENMDLIGLKAS---NSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 5034
            EYV II D +KM KNICL R+F  +      A+          IDVWP N   PGS SY D   +F+LQ++C+LNM+S W  + ++R+++C++  +        +E + ELL + RI+A IK V WD        N+ R +   N  S  +           + ++  VN L+K H+S   AV F YLP  P  +  +  ++Y+ QL  LT DL P++ + G+  V  + L
Sbjct:  691 EYVSIIQDAIKMGKNICLARYFFQLPPESKGATYMWGKDSMDTIDVWPTNLLTPGSASYADVGSLFLLQMACVLNMASGW-RRARLRIFVCVESESEDQGWLAKEEQFRELLGKLRIRAAIKIVAWD--------NVARMVRGPNTESQPVS----------EDFLCAVNGLLKEHSS-TAAVRFLYLPDPP--SSCELSQQYLTQLDTLTRDLGPTLLIHGVTPVTCTEL 899          

HSP 2 Score: 55.4546 bits (132), Expect = 7.026e-7
Identity = 22/57 (38.60%), Postives = 39/57 (68.42%), Query Frame = 3
Query: 3756 FRNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPK 3926
            +  +  + D L +KAF+D+T++P++R G + L  + GLGG+  NT+ +GF D+S P+
Sbjct:  588 YNFWLSLVDKLGVKAFVDLTLSPSVRQGTQHLLRITGLGGMKPNTLVLGFYDNSYPE 644          
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Match: slc12a9 (solute carrier family 12 member 9 [Source:NCBI gene;Acc:793341])

HSP 1 Score: 130.568 bits (327), Expect = 5.678e-30
Identity = 79/231 (34.20%), Postives = 120/231 (51.95%), Query Frame = 1
Query: 4351 EYVGIIADCMKMQKNICLCRHFENMDLIGLKAS---NSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 5034
            EYV II D +KM KNICL R+F  +      A+          IDVWP N   PGS SY D   +F+LQ++C+LNM+S W  + ++R+++C++  +        +E + ELL + RI+A IK V WD        N+ R +   N  S  +           + ++  VN L+K H+S   AV F YLP  P  +  +  ++Y+ QL  LT DL P++ + G+  V  + L
Sbjct:  691 EYVSIIQDAIKMGKNICLARYFFQLPPESKGATYMWGKDSMDTIDVWPTNLLTPGSASYADVGSLFLLQMACVLNMASGW-RRARLRIFVCVESESEDQGWLAKEEQFRELLGKLRIRAAIKIVAWD--------NVARMVRGPNTESQPVS----------EDFLCAVNGLLKEHSS-TAAVRFLYLPDPP--SSCELSQQYLTQLDTLTRDLGPTLLIHGVTPVTCTEL 899          

HSP 2 Score: 55.4546 bits (132), Expect = 7.026e-7
Identity = 22/57 (38.60%), Postives = 39/57 (68.42%), Query Frame = 3
Query: 3756 FRNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPK 3926
            +  +  + D L +KAF+D+T++P++R G + L  + GLGG+  NT+ +GF D+S P+
Sbjct:  588 YNFWLSLVDKLGVKAFVDLTLSPSVRQGTQHLLRITGLGGMKPNTLVLGFYDNSYPE 644          
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Match: zgc:153039 (zgc:153039 [Source:ZFIN;Acc:ZDB-GENE-060929-736])

HSP 1 Score: 129.413 bits (324), Expect = 1.498e-29
Identity = 85/243 (34.98%), Postives = 127/243 (52.26%), Query Frame = 1
Query: 4351 EYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQ---YIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDD---ITMNLETNLGRKIMSNNAMSDEIKTIS--LFDCTLP-------DTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 5034
            EYV IIAD +KM KN+ L R+F   D       ++   Q   ++DVWP+N  +P S +Y+D   +F+LQL+CILNM+  W  K ++R+++C++    G + K  ++    LL   R++A+I TV WD    +    +T L R        S+E    +   F  + P       D Y++ VN LI        AV F YLP  P  T    +  Y+NQL LLT DL P++ + G+  VIT+ L
Sbjct:  713 EYVCIIADAVKMLKNVALARYFGQFD-------HTHALQGPIFVDVWPVNLLRPDSAAYVDTCSLFLLQLACILNMTRAW-QKARLRLFLCVEE---GRSLKGTEQKLGHLLKDLRMKADICTVPWDSEVALHWQRQTRLDRNEKEEELESEEGGVEADKFFSNSFPSNTSRVSDEYLQAVNKLILEQKLRPPAVRFLYLPRPPADTSR--YSDYLNQLELLTRDLGPTLLIHGVTPVITTDL 942          

HSP 2 Score: 56.9954 bits (136), Expect = 2.107e-7
Identity = 23/57 (40.35%), Postives = 39/57 (68.42%), Query Frame = 3
Query: 3756 FRNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPK 3926
            + ++  + D L IKAF+++T+A +IR G + L  + GLGG+  NT+ +GF DD+ P+
Sbjct:  600 YDSWLSLVDHLNIKAFVNLTLADSIRHGVQHLLFISGLGGMRPNTLVLGFYDDASPQ 656          
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045625.1 (solute carrier family 12 member 9-like [Source:NCBI gene;Acc:100498108])

HSP 1 Score: 119.013 bits (297), Expect = 3.288e-26
Identity = 74/235 (31.49%), Postives = 125/235 (53.19%), Query Frame = 1
Query: 4351 EYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQ------YIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLN-TAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 5034
            EYV II+D +KM KN+ L R+F   D        SS C+      YIDVWP+N  +P S +Y+D   +F+LQ++C+LNM   W  K K+R+++C++  + G   + V+    +LL   RI+A I TV WD +       L +  + + A  +           + + Y++ VN +I +   L+  AV F YLP  P    +  + ++++QL  +T +L P++ + G+  V ++ L
Sbjct:  677 EYVAIISDTIKMSKNVALARYFSEFD-------KSSVCKLRGKETYIDVWPLNLLRPDSTAYVDTCSLFLLQMACVLNMVRSW-KKAKLRLFLCIEAES-GLQGQEVK--LKQLLKDLRIKASINTVAWDSVVA--LHWLKQGTVDSEAAEEVYLNFPNNSIRISEEYLEAVNQMILMQNPLSPPAVRFLYLPRPP--ADTAVYNRFLHQLEAVTRNLGPTLLIHGVSAVTSTEL 896          
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045638.1 (solute carrier family 12 member 9-like [Source:NCBI gene;Acc:100498108])

HSP 1 Score: 118.627 bits (296), Expect = 3.609e-26
Identity = 74/235 (31.49%), Postives = 125/235 (53.19%), Query Frame = 1
Query: 4351 EYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQ------YIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLN-TAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 5034
            EYV II+D +KM KN+ L R+F   D        SS C+      YIDVWP+N  +P S +Y+D   +F+LQ++C+LNM   W  K K+R+++C++  + G   + V+    +LL   RI+A I TV WD +       L +  + + A  +           + + Y++ VN +I +   L+  AV F YLP  P    +  + ++++QL  +T +L P++ + G+  V ++ L
Sbjct:  666 EYVAIISDTIKMSKNVALARYFSEFD-------KSSVCKLRGKETYIDVWPLNLLRPDSTAYVDTCSLFLLQMACVLNMVRSW-KKAKLRLFLCIEAES-GLQGQEVK--LKQLLKDLRIKASINTVAWDSVVA--LHWLKQGTVDSEAAEEVYLNFPNNSIRISEEYLEAVNQMILMQNPLSPPAVRFLYLPRPP--ADTAVYNRFLHQLEAVTRNLGPTLLIHGVSAVTSTEL 885          
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Match: SLC12A9 (solute carrier family 12, member 9 [Source:NCBI gene;Acc:100493856])

HSP 1 Score: 115.161 bits (287), Expect = 3.585e-25
Identity = 69/233 (29.61%), Postives = 117/233 (50.21%), Query Frame = 1
Query: 4351 EYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRK-----NVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 5034
            +YV +I D +KM KNI L R+F  +    ++   SS   YIDVWP++  +P + +Y+D   +F+LQ++CILNM++ W  + ++RV++C++    G +         +  + ELL + RI+A I+ V WD +      N   + ++   +S E              Y+K  N  ++      T V F YLP  P        ++Y+ +L  LT  L P++ + GL  V  + L
Sbjct:  518 DYVAMICDALKMHKNIVLARNFPLL----VRPEASSPAMYIDVWPLDLLRPQASAYVDVCSLFLLQMACILNMAASW-RRFQLRVFLCVESRGGGGSDGASGWIAAEAKFRELLSKLRIRALIRVVAWDRVAALRGPNAEGQALNREPISCE--------------YLKAANRAVEEEGGAETGVRFLYLPRPP--ADPALHQRYLEELDTLTAGLGPTLLIHGLTPVTCTEL 729          

HSP 2 Score: 55.0694 bits (131), Expect = 1.322e-6
Identity = 22/56 (39.29%), Postives = 37/56 (66.07%), Query Frame = 3
Query: 3756 FRNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEP 3923
            +  +  + D L +KAF+D+T+ P++R G + L  + GLGG+  NT+ +GF DD+ P
Sbjct:  415 YSFWLSLVDKLNVKAFVDLTLCPSVRQGAQHLLRITGLGGMKPNTLVLGFYDDASP 470          
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Match: SLC12A9 (solute carrier family 12, member 9 [Source:NCBI gene;Acc:100493856])

HSP 1 Score: 114.775 bits (286), Expect = 4.542e-25
Identity = 69/233 (29.61%), Postives = 117/233 (50.21%), Query Frame = 1
Query: 4351 EYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRK-----NVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 5034
            +YV +I D +KM KNI L R+F  +    ++   SS   YIDVWP++  +P + +Y+D   +F+LQ++CILNM++ W  + ++RV++C++    G +         +  + ELL + RI+A I+ V WD +      N   + ++   +S E              Y+K  N  ++      T V F YLP  P        ++Y+ +L  LT  L P++ + GL  V  + L
Sbjct:  537 DYVAMICDALKMHKNIVLARNFPLL----VRPEASSPAMYIDVWPLDLLRPQASAYVDVCSLFLLQMACILNMAASW-RRFQLRVFLCVESRGGGGSDGASGWIAAEAKFRELLSKLRIRALIRVVAWDRVAALRGPNAEGQALNREPISCE--------------YLKAANRAVEEEGGAETGVRFLYLPRPP--ADPALHQRYLEELDTLTAGLGPTLLIHGLTPVTCTEL 748          

HSP 2 Score: 55.0694 bits (131), Expect = 1.359e-6
Identity = 22/56 (39.29%), Postives = 37/56 (66.07%), Query Frame = 3
Query: 3756 FRNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEP 3923
            +  +  + D L +KAF+D+T+ P++R G + L  + GLGG+  NT+ +GF DD+ P
Sbjct:  434 YSFWLSLVDKLNVKAFVDLTLCPSVRQGAQHLLRITGLGGMKPNTLVLGFYDDASP 489          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Slc12a9 (solute carrier family 12 (potassium/chloride transporters), member 9 [Source:MGI Symbol;Acc:MGI:1933532])

HSP 1 Score: 87.8113 bits (216), Expect = 9.031e-17
Identity = 63/250 (25.20%), Postives = 110/250 (44.00%), Query Frame = 1
Query: 4336 QVSEVEYVGIIADCMKMQKNICLCRHFENM--DLIGLKASNSSECQYIDVWPINFFQP-GSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYY-TIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSL------------------NTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEV 5019
             +S  +YV  +AD +KM KN+ L R    +  + +   +S+S++  ++DVWP+N  +P G   Y+D   +F+LQ++ IL+M   W S  ++R+++CL      G     ++ L ++L    RI+AE++ V W +     E         N    DE            +      N L++                        TA+ F YLP  P       + +Y+  L  L+ DL P++ + G+  V
Sbjct:  677 ALSPQDYVATVADALKMNKNVVLARACGALPPERLSRGSSSSAQLHHVDVWPLNLLRPRGGPGYVDVCGLFLLQMATILSMVPAWHS-ARLRIFLCLGPREAPGAAEGRLRALLSQL----RIRAEVQEVVWGEGAETGEPEEEEGDFVNGGRGDEEA----------EALACSANALVRAQQGRGTVGGPGGPEGRDGEEGPTTALTFLYLPRPP--ADPARYPRYLALLETLSRDLGPTLLIHGVTPV 909          

HSP 2 Score: 57.7658 bits (138), Expect = 1.660e-7
Identity = 21/57 (36.84%), Postives = 39/57 (68.42%), Query Frame = 3
Query: 3756 FRNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPK 3926
            +  +  + D  ++KAF+D+T++P++R G + L  + GLGG+  NT+ +GF DD+ P+
Sbjct:  582 YGAWLSLVDLAQVKAFVDLTLSPSVRQGAQHLLRISGLGGMKPNTLVLGFYDDAPPQ 638          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|A2BFP5|S12A9_DANRE (Solute carrier family 12 member 9 OS=Danio rerio OX=7955 GN=slc12a9 PE=3 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 4.286e-29
Identity = 79/231 (34.20%), Postives = 120/231 (51.95%), Query Frame = 1
Query: 4351 EYVGIIADCMKMQKNICLCRHFENMDLIGLKAS---NSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 5034
            EYV II D +KM KNICL R+F  +      A+          IDVWP N   PGS SY D   +F+LQ++C+LNM+S W  + ++R+++C++  +        +E + ELL + RI+A IK V WD        N+ R +   N  S  +           + ++  VN L+K H+S   AV F YLP  P  +  +  ++Y+ QL  LT DL P++ + G+  V  + L
Sbjct:  691 EYVSIIQDAIKMGKNICLARYFFQLPPESKGATYMWGKDSMDTIDVWPTNLLTPGSASYADVGSLFLLQMACVLNMASGW-RRARLRIFVCVESESEDQGWLAKEEQFRELLGKLRIRAAIKIVAWD--------NVARMVRGPNTESQPVS----------EDFLCAVNGLLKEHSS-TAAVRFLYLPDPP--SSCELSQQYLTQLDTLTRDLGPTLLIHGVTPVTCTEL 899          

HSP 2 Score: 55.4546 bits (132), Expect = 5.304e-6
Identity = 22/57 (38.60%), Postives = 39/57 (68.42%), Query Frame = 3
Query: 3756 FRNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPK 3926
            +  +  + D L +KAF+D+T++P++R G + L  + GLGG+  NT+ +GF D+S P+
Sbjct:  588 YNFWLSLVDKLGVKAFVDLTLSPSVRQGTQHLLRITGLGGMKPNTLVLGFYDNSYPE 644          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0VGW6|S12A9_XENLA (Solute carrier family 12 member 9 OS=Xenopus laevis OX=8355 GN=slc12a9 PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.651e-27
Identity = 74/236 (31.36%), Postives = 127/236 (53.81%), Query Frame = 1
Query: 4339 VSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKN----VQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 5034
            +S  +YV +I D +KM KNI L R+F    L+  +AS+SS   YIDVWP++  +P + +Y+D   +F+LQ++CILNM++ W  + ++RV++C++    G++  +     +  + ELL + RI+A I+ V WD +      N+G ++++   +S E              Y+    + +       TAV F YLP  P    S    +Y+ +L  LT+ L P++ + GL  V  + L
Sbjct:  684 LSAKDYVSMICDALKMHKNIVLARNFPL--LVRPEASSSSPATYIDVWPLDLLRPQASAYVDVCSLFLLQMACILNMAASW-RRYQLRVFLCVESRG-GSDGASGWLAAEAKFRELLSKLRIRALIRVVAWDRVAAFRVQNMGGQVLNREPISSE--------------YLNAAKSAVTDEGGTETAVRFLYLPRPP--ADSSLHERYLEELDTLTSGLGPTLLIHGLTPVTCTEL 899          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99MR3|S12A9_MOUSE (Solute carrier family 12 member 9 OS=Mus musculus OX=10090 GN=Slc12a9 PE=1 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 6.317e-16
Identity = 63/250 (25.20%), Postives = 110/250 (44.00%), Query Frame = 1
Query: 4336 QVSEVEYVGIIADCMKMQKNICLCRHFENM--DLIGLKASNSSECQYIDVWPINFFQP-GSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYY-TIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSL------------------NTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEV 5019
             +S  +YV  +AD +KM KN+ L R    +  + +   +S+S++  ++DVWP+N  +P G   Y+D   +F+LQ++ IL+M   W S  ++R+++CL      G     ++ L ++L    RI+AE++ V W +     E         N    DE            +      N L++                        TA+ F YLP  P       + +Y+  L  L+ DL P++ + G+  V
Sbjct:  677 ALSPQDYVATVADALKMNKNVVLARACGALPPERLSRGSSSSAQLHHVDVWPLNLLRPRGGPGYVDVCGLFLLQMATILSMVPAWHS-ARLRIFLCLGPREAPGAAEGRLRALLSQL----RIRAEVQEVVWGEGAETGEPEEEEGDFVNGGRGDEEA----------EALACSANALVRAQQGRGTVGGPGGPEGRDGEEGPTTALTFLYLPRPP--ADPARYPRYLALLETLSRDLGPTLLIHGVTPV 909          

HSP 2 Score: 57.7658 bits (138), Expect = 1.161e-6
Identity = 21/57 (36.84%), Postives = 39/57 (68.42%), Query Frame = 3
Query: 3756 FRNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPK 3926
            +  +  + D  ++KAF+D+T++P++R G + L  + GLGG+  NT+ +GF DD+ P+
Sbjct:  582 YGAWLSLVDLAQVKAFVDLTLSPSVRQGAQHLLRISGLGGMKPNTLVLGFYDDAPPQ 638          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q66HR0|S12A9_RAT (Solute carrier family 12 member 9 OS=Rattus norvegicus OX=10116 GN=Slc12a9 PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.503e-15
Identity = 62/250 (24.80%), Postives = 109/250 (43.60%), Query Frame = 1
Query: 4336 QVSEVEYVGIIADCMKMQKNICLCRHFENM--DLIGLKASNSSECQYIDVWPINFFQP-GSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYY-TIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSL------------------NTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEV 5019
             +S  +YV  +AD +KM KN+ L R    +  + +   + +S++  ++DVWP+N  +P G   Y+D   +F+LQ++ IL+M   W S  ++R+++CL      G     ++ L ++L    RI+AE++ V W +     E         N    DE            +      N L++                        TA+ F YLP  P       + +Y+  L  L+ DL P++ + G+  V
Sbjct:  677 ALSPQDYVATVADALKMNKNVVLARACGALPPERLSRGSGSSAQLHHVDVWPLNLLRPRGGPGYVDVCGLFLLQMATILSMVPAWHS-ARLRIFLCLGPREAPGAAEGRLRALLSQL----RIRAEVQEVVWGEGAEAGEPEEEEGDFVNGGRGDEEA----------EALACSANALVRAQQGRGTGGGPGGPEGRDGEEGPTTALTFLYLPRPP--ADPARYPRYLALLETLSRDLGPTLLIHGVTPV 909          

HSP 2 Score: 57.3806 bits (137), Expect = 1.181e-6
Identity = 21/57 (36.84%), Postives = 39/57 (68.42%), Query Frame = 3
Query: 3756 FRNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPK 3926
            +  +  + D  ++KAF+D+T++P++R G + L  + GLGG+  NT+ +GF DD+ P+
Sbjct:  582 YGAWLSLVDLAQVKAFVDLTLSPSVRQGAQHLLRISGLGGMKPNTLVLGFYDDAPPQ 638          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9BXP2|S12A9_HUMAN (Solute carrier family 12 member 9 OS=Homo sapiens OX=9606 GN=SLC12A9 PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.129e-15
Identity = 62/236 (26.27%), Postives = 105/236 (44.49%), Query Frame = 1
Query: 4351 EYVGIIADCMKMQKNICLCRHFENM--DLIGLKASNSSECQYIDVWPINFFQP-GSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYY-TIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLE---------TNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEV 5019
            +YV  +AD +KM KN+ L R    +  + +   +  +S+  ++DVWP+N  +P G   Y+D   +F+LQ++ IL M   W S  ++R+++CL      G     ++ L ++L    RI+AE++ V W +     E          N GR      A++     +                        + TA+ F YLP  P       + +Y+  L  LT DL P++ V G+  V
Sbjct:  682 DYVATVADALKMNKNVVLARASGALPPERLSRGSGGTSQLHHVDVWPLNLLRPRGGPGYVDVCGLFLLQMATILGMVPAWHS-ARLRIFLCLGPREAPGAAEGRLRALLSQL----RIRAEVQEVVWGEGAGAGEPEAEEEGDFVNSGRGDAEAEALARSANALVRAQQGRGTGGGPGGPEGGDAEGPI-TALTFLYLPRPP--ADPARYPRYLALLETLTRDLGPTLLVHGVTPV 909          

HSP 2 Score: 56.225 bits (134), Expect = 3.181e-6
Identity = 21/57 (36.84%), Postives = 39/57 (68.42%), Query Frame = 3
Query: 3756 FRNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPK 3926
            +  +  + D  ++KAF+D+T++P++R G + L  + GLGG+  NT+ +GF DD+ P+
Sbjct:  582 YGAWLSLVDRAQVKAFVDLTLSPSVRQGAQHLLRISGLGGMKPNTLVLGFYDDAPPQ 638          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A0H3YIX7 (Slc12a-2 OS=Schmidtea mediterranea OX=79327 GN=slc12a-2 PE=2 SV=1)

HSP 1 Score: 551.592 bits (1420), Expect = 1.010e-176
Identity = 279/365 (76.44%), Postives = 304/365 (83.29%), Query Frame = 1
Query: 3970 DILKKIFNQSNKCNPHQFIRARNNSLFAGDVQSFTNQSSES--------FDKSKIVQQSASRI-DNENTNLISKGKNKIFN-LLKSPVDPEFIDKLPPIRRTRHATYGTINANSDHQQQADEVVECNHINNDQVSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 5034
            DIL+KI  Q N    +   + R+   FA     FT + S S         D S  +  ++S I  +ENT L++K + K  N +L+  VDP+FID+LPPIR TR   +G IN  S +++  ++    N+I+NDQ+SEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL
Sbjct:  646 DILQKINCQMNNLKSNWPFKPRHIPAFAELSSDFTGEQSTSKRLCHNISVDNS--INSTSSHICVDENTRLVTKDRMKFLNRILRPSVDPKFIDELPPIRSTRQELFGEINELSANRETRED----NYISNDQISEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 1004          

HSP 2 Score: 102.064 bits (253), Expect = 1.010e-176
Identity = 48/56 (85.71%), Postives = 50/56 (89.29%), Query Frame = 3
Query: 3759 RNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPK 3926
            + F  MKDFL IKAFIDVTIAPTIRDGCRQLS LCGLGGL INTVCIGFRDDSEP+
Sbjct:  590 KKFIIMKDFLDIKAFIDVTIAPTIRDGCRQLSRLCGLGGLMINTVCIGFRDDSEPQ 645          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A4Y2GG32 (PR domain zinc finger protein 4 (Fragment) OS=Araneus ventricosus OX=182803 GN=Prdm4_4 PE=4 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 1.400e-106
Identity = 188/608 (30.92%), Postives = 303/608 (49.84%), Query Frame = 1
Query:  286 SGWIFDRITSSSLTICQFRSPHGGTYKKLPFK---SNAILNIQNKNDNKYFLYSVLEYLHAVITTEHPCNPWKYKKYERELNLDGINVPINLNGIKKFAKQNINRVKINVFSINDKKKLGIIYRGQIDHKGCNLLLYKD----HYVLRKNVGVFLRN-----SKIDVCFPCLNCFASFKA*NALKTNQHFCINHEEWIASFPH--DPYHEFENFNFKYKVPFVCYSDFEAWNKVAEYNDIKGEQIG---FCFSIYIKSNYPNLLEDRHI-VYKGEDVAFKFTETINELSEKLKIKLKTNYPIDVNESQQKEYDNCKMCFYRNKELVNDKVIDHDHYLEKENYSGASHADCNLKTK-NNLVPIYFLNGTGYDNHLIFLP---LAPNITKIIPSTDEKYISFSVG--------YLRFLDSYKMMPLPLEYLASLLKPEDLKIFNKFYPEFNLKI--RKGIYPYEYMSGKNYEDIEQKLSESQLPEISKFYNHLKTYKLSEVDYKYAQESWELLDCKNMEEYTIHYLNMDVFLLADLFENFRNVCLENFGIDPRYCYSQSGLTWVNGMKFTQVKLKNFNKKSYDQLLMIEKGVKGGFSGVLGDRLEEVNER 2013
            SGWI D+I    L + +++     +Y  LP K     A+LNIQN+ D K  ++ ++ +   ++  +       Y  +E+E+ LDG+  P+ LN I     + +N ++INVF   + +   +    ++D +  NLLL  +    HY L +N+   L +     +K   C+ CL+ FA  +    LK +  +C +H       P   + + +F+N ++++ +P++ Y+DFE+      +     E I     C   YI    P+    + I VY+G++    F E I +  E+L  KL +  PI +    + ++ +   C    K L  D+V DHDH  +   Y  A H+ CNLK + +  +PI F N   YD HLI      L      ++P+T EKY++FS+          L F+DS++ +   LE L   L P+   I N+ +P  NL +  RKG+YPYEYM      D  QK  E +LP I  F + L    +S+ DY++AQ  W   + KNM EY   Y+  DV  LAD+FENFR +C   +G+D  + ++  GL W + +K T   L+ F     +  + IEKG++GG S V+  R  + N +
Sbjct:  343 SGWILDKIVHFELCVAKYQPLRASSYIILPKKLADKKAVLNIQNE-DQKCLVWCLIAHKLNILAHD-SYRVSHYTPHEQEIKLDGVECPVPLNKIPIV--ERLNNLRINVFGYEENEVFPLYVSKRVDEECVNLLLIANEETQHYCLIRNMSRLLGDLTKHKTKHHYCYRCLHRFAKVEI---LKEHLQYCNDHSPQHIKMPAKGENFIKFQNVHYQHPLPYIIYADFESLIVKEVHTSGNTEIIARHEACGYAYIIIG-PDGRSVKPISVYRGKNAVQHFMENILKEKEELAAKLTSIAPISMTPQDELDFRSATHCSICKKALKGDRVRDHDH--QTGRYRAALHSSCNLKFRLSKKIPIVFHNLKNYDGHLIMQEIGKLKDYEISVVPTTMEKYVTFSLSKRYHKFKVSLNFVDSFQFLSTSLEKLVQNLTPDKFNILNENFPHHNLSLLLRKGVYPYEYM------DSHQKFEEERLPSIDSFESTLTGNGISDDDYRHAQTVWNYFNLKNMGEYHDLYVKCDVLQLADVFENFRKLCQHYYGLDCVHLFTAPGLAWQSSLKITDQPLELFT--DINMHMFIEKGIRGGIS-VITKRFSQANNK 931          

HSP 2 Score: 123.635 bits (309), Expect = 1.400e-106
Identity = 68/172 (39.53%), Postives = 103/172 (59.88%), Query Frame = 2
Query: 2138 SIGYMYIVDLKYPEELHDKTQYFPFSPRKVKVQEESLSQWQKEN-NHYGYKSTEKLIQFQNDLKEYVIEGRCLNWYLVNGMVLEKLHKKIMSNKSYWLKPYIELNIKKRTGAKQEEDKFGDIFYKLLNNAFYGKTLENVRNRQSIEIVGTKEKLKSIAAKAGYQRMKIFSEE 2650
            S GY++ VDLKYPEELHD    +P +P K+ ++ E LS++ K   N   Y  + KL+    D K Y+   + L +YL  G+ LEK+HK +   +  WLK YI  N ++R  +K     F   F+KL+NN+ YGKT+EN+RNR  +++V  ++K + + A   ++R KIF  E
Sbjct:  987 SEGYIFEVDLKYPEELHDLHNDYPLAPEKMDIKFEDLSEFSKAVLNGMKYTPSTKLVPNLKDKKNYITYYKNLQFYLKQGLKLEKVHKILKFQQKPWLKKYIMFNTEQRKNSKS---AFEKDFFKLMNNSVYGKTMENIRNRVDVQLVNDEKKAQKLVAAPTFKRFKIFDNE 1155          

HSP 3 Score: 50.8322 bits (120), Expect = 1.400e-106
Identity = 26/54 (48.15%), Postives = 34/54 (62.96%), Query Frame = 1
Query: 2671 KNTIKFDKFNYIGFVFLELSKLYMYKFIYNVLYKTYENNYKIHFWDIDSINLEL 2832
            K  +  DK  Y+GFV LELSKL MY F YNV+ K Y +  ++ F D DS+  E+
Sbjct: 1163 KKCLTLDKPIYVGFVILELSKLIMYNFHYNVMKKEYGDKAELLFTDTDSLTYEV 1216          

HSP 4 Score: 28.1054 bits (61), Expect = 1.400e-106
Identity = 11/25 (44.00%), Postives = 17/25 (68.00%), Query Frame = 3
Query: 2025 LYYFDANSLYPTSMVDELPTGKWNF 2099
            + Y D+N+LY  SMV+ LP G + +
Sbjct:  945 IIYLDSNNLYGASMVESLPYGGFEW 969          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A4Y2NLI4 (Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Araneus ventricosus OX=182803 GN=ZG57_8 PE=4 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 3.359e-106
Identity = 185/608 (30.43%), Postives = 300/608 (49.34%), Query Frame = 1
Query:  286 SGWIFDRITSSSLTICQFRSPHGGTYKKLPFK---SNAILNIQNKNDNKYFLYSVLEYLHAVITTEHPCNPWKYKKYERELNLDGINVPINLNGIKKFAKQNINRVKINVFSINDKKKLGIIYRGQIDHKGCNLLLYKD----HYVLRKNVGVFL-----RNSKIDVCFPCLNCFASFKA*NALKTNQHFCINHEEWIASFPH--DPYHEFENFNFKYKVPFVCYSDFEAWNKVAEYNDIKGEQIG---FCFSIYIKSNYPNLLEDRHI-VYKGEDVAFKFTETINELSEKLKIKLKTNYPIDVNESQQKEYDNCKMCFYRNKELVNDKVIDHDHYLEKENYSGASHADCNLKTK-NNLVPIYFLNGTGYDNHLIFLP---LAPNITKIIPSTDEKYISFSVG--------YLRFLDSYKMMPLPLEYLASLLKPEDLKIFNKFYPEFNLKI--RKGIYPYEYMSGKNYEDIEQKLSESQLPEISKFYNHLKTYKLSEVDYKYAQESWELLDCKNMEEYTIHYLNMDVFLLADLFENFRNVCLENFGIDPRYCYSQSGLTWVNGMKFTQVKLKNFNKKSYDQLLMIEKGVKGGFSGVLGDRLEEVNER 2013
            SGWI D+I    L + +++     +Y  LP K     A+LNIQN+ D K  ++ ++ +   ++  +       Y  +E+ + LDG+  P+ LN I     + +N ++INVF  ++ +   +    ++D +  NLLL  +    HY L +N+   L      N K   C+ CL+ FA  +    LK +  +C  H       P   + + +F+N ++++ +P++ Y+DFE+      +     E I     C   YI    P+    + I VY+GE+    F E I +  E+L  KL +  PI +    + ++ +   C    K L  D+V DHDH  +   Y  A H+ CNLK + +  +P+ F N   YD HLI      L      ++P+T EKY++FS+          L F+DS++ +   LE L   L P+   I  + +P  N+ +  RKG+YPYEYM      D  QK  E +LP I  F + L    +S+ DY++AQ  W   + KNM EY   Y+  DV  LAD+FENFR +C   +G+D  + ++  GL W + +K T   L+ F     +  + +EKG++GG S V+  R  + N +
Sbjct:  281 SGWILDKIVHFELCVAKYQPLRASSYIILPKKLADKKAVLNIQNE-DQKCLVWCLIAHKLNILAHD-SYRVSHYTPHEQAIKLDGVECPVPLNKIPIV--ERLNNLRINVFGYDENEVFPLYVSKRVDEECVNLLLIANEETQHYCLIRNMSRLLGDLTKHNGKHHYCYRCLHRFAKVEI---LKEHLQYCSEHSPQHIKMPEKGENFIKFQNVHYQHPLPYIIYADFESLIVKEVHTSGNTEIIARHEACGYAYIIIG-PDGRSVKPISVYRGENAVQHFMENILKEKEELAAKLTSIVPISMTPQDELDFRSATHCSICKKALKGDRVRDHDH--KTGRYRAALHSSCNLKFRLSKKIPVVFHNLKNYDGHLIMQEIGKLKDYEISVVPTTMEKYVTFSLSKRYHKFKVSLNFVDSFQFLSTSLEKLVQNLTPDKFNILKENFPHHNMSLLLRKGVYPYEYM------DSHQKFEEERLPSIDSFESTLTGSGISDEDYRHAQTVWNYFNLKNMGEYHDLYVKCDVLQLADVFENFRKLCQHCYGLDCVHLFTAPGLAWQSSLKMTDQPLELFT--DINMHMFVEKGIRGGIS-VITKRFSQANNK 869          

HSP 2 Score: 123.25 bits (308), Expect = 3.359e-106
Identity = 68/172 (39.53%), Postives = 103/172 (59.88%), Query Frame = 2
Query: 2138 SIGYMYIVDLKYPEELHDKTQYFPFSPRKVKVQEESLSQWQKEN-NHYGYKSTEKLIQFQNDLKEYVIEGRCLNWYLVNGMVLEKLHKKIMSNKSYWLKPYIELNIKKRTGAKQEEDKFGDIFYKLLNNAFYGKTLENVRNRQSIEIVGTKEKLKSIAAKAGYQRMKIFSEE 2650
            S GY++ VDLKYPEELHD    +P +P K+ ++ E LS++ K   N   Y  + KL+    D K Y+   + L +YL  G+ LEK+HK +   +  WLK YI  N ++R  +K     F   F+KL+NN+ YGKT+EN+RNR  +++V  ++K + + A   ++R KIF  E
Sbjct:  925 SEGYIFEVDLKYPEELHDLHNDYPLAPEKMDIKFEDLSEFSKAVLNGMKYTPSTKLVPNLKDKKNYITYYKNLQFYLKQGLKLEKVHKILKFQQKPWLKKYIMFNTEQRKNSKS---AFEKDFFKLMNNSVYGKTMENIRNRVDVQLVNDEKKAQKLVAAPTFKRFKIFDNE 1093          

HSP 3 Score: 51.2174 bits (121), Expect = 3.359e-106
Identity = 26/54 (48.15%), Postives = 34/54 (62.96%), Query Frame = 1
Query: 2671 KNTIKFDKFNYIGFVFLELSKLYMYKFIYNVLYKTYENNYKIHFWDIDSINLEL 2832
            K  +  DK  Y+GFV LELSKL MY F YNV+ K Y +  ++ F D DS+  E+
Sbjct: 1101 KKCLTLDKPIYVGFVILELSKLIMYNFHYNVMKKEYGDKAELLFTDTDSLTYEV 1154          

HSP 4 Score: 27.335 bits (59), Expect = 3.359e-106
Identity = 11/25 (44.00%), Postives = 16/25 (64.00%), Query Frame = 3
Query: 2025 LYYFDANSLYPTSMVDELPTGKWNF 2099
            + Y D N+LY  SMV+ LP G + +
Sbjct:  883 IIYLDCNNLYGASMVESLPYGGFEW 907          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A4Y2WQ60 (Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Araneus ventricosus OX=182803 GN=ZG57_0 PE=4 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 3.676e-104
Identity = 185/612 (30.23%), Postives = 301/612 (49.18%), Query Frame = 1
Query:  286 SGWIFDRITSSSLTICQFRSPHGGTYKKLPFK---SNAILNIQNKNDNKYFLYSVLEYLHAVITTEHPCNPWKYKKYERELNLDGINVPINLNGIKKFAKQNINRVKINVFSINDKKKLGIIYRGQIDHKGCNLLLYKD----HYVLRKNVGVFL-----RNSKIDVCFPCLNCFASFKA*NALKTNQHFCINHEEWIASFPH--DPYHEFENFNFKYKVPFVCYSDFEAWNKVAEYND-------IKGEQIGFCFSIYIKSNYPNLLEDRHI-VYKGEDVAFKFTETINELSEKLKIKLKTNYPIDVNESQQKEYDNCKMCFYRNKELVNDKVIDHDHYLEKENYSGASHADCNLKTK-NNLVPIYFLNGTGYDNHLIFLP---LAPNITKIIPSTDEKYISFSVG--------YLRFLDSYKMMPLPLEYLASLLKPEDLKIFNKFYPEFNLKI--RKGIYPYEYMSGKNYEDIEQKLSESQLPEISKFYNHLKTYKLSEVDYKYAQESWELLDCKNMEEYTIHYLNMDVFLLADLFENFRNVCLENFGIDPRYCYSQSGLTWVNGMKFTQVKLKNFNKKSYDQLLMIEKGVKGGFSGVLGDRLEEVNER 2013
            SGWI D+I    L + +++     +Y  LP K     A+LNIQN++    F   +   L+ +    +  +   Y  +E+E+ L+G+  P+ LN I     + +N ++INVF   + +   +    ++D +  NLLL  +    HY L +N+   L      N K   C+ CL+ FA  +    LK +  +C +H       P   + + +F N ++++ +P+V Y+DFE+   V E +         + E  G+ + I      P+    + I VY+GE+    F E I +  E+L  KL +  PI +    + ++ +   C    K L  D+V DHDH  +   Y  A H+ CNLK + +  +P+ F N   YD HLI      L      ++P+T EKY++FS+          L F+DS++ +   LE L   L P+   I  + +P  N+ +  RKG+YPYEYM      D  QK  E +LP I+ F + L    +S+ DY++AQ  W   + KNM EY   Y+  DV  LAD+FENFR +    +G+D  + ++  GL W + +K T   L+ F     +  + +EKG++GG S V+  R  + N +
Sbjct:  376 SGWILDKIDHFELCVAKYQPLRASSYIILPKKLADKKAVLNIQNEDQKCLFWCLIAHKLNILAHDSYRVS--HYTPHEQEIKLNGLECPVPLNKIPIV--ERLNNLRINVFGYEENEVFPLYVSKRVDEECVNLLLIANEETQHYCLIRNMSRLLGDLTKHNGKHHYCYRCLHRFAKVEV---LKDHLQYCNDHSPQHIKMPAKGENFIKFVNVHYQHPLPYVIYADFESL-IVKEVHTSGNTEIVARHEACGYAYVII----GPDGRSVKPISVYRGENAVQHFMENILKEKEELAAKLTSIVPIQMTPQDELDFRSATHCSICKKALKGDRVRDHDH--QTGRYRAALHSSCNLKFRLSKKIPVVFHNLKNYDGHLIMQEIGKLKDYEISVVPTTMEKYVTFSLSKRYHKFKVSLNFVDSFQFLSTSLEKLVQNLTPDKFNILKENFPHHNISLLLRKGVYPYEYM------DSHQKFDEERLPSINSFESTLTGSGISDEDYRHAQTVWNYFNLKNMGEYHDLYVKCDVLQLADVFENFRKLYQHYYGLDCVHLFTAPGLAWQSSLKMTDQPLELFT--DINMHMFVEKGIRGGIS-VITKRFSQANNK 964          

HSP 2 Score: 122.479 bits (306), Expect = 3.676e-104
Identity = 68/172 (39.53%), Postives = 102/172 (59.30%), Query Frame = 2
Query: 2138 SIGYMYIVDLKYPEELHDKTQYFPFSPRKVKVQEESLSQWQKEN-NHYGYKSTEKLIQFQNDLKEYVIEGRCLNWYLVNGMVLEKLHKKIMSNKSYWLKPYIELNIKKRTGAKQEEDKFGDIFYKLLNNAFYGKTLENVRNRQSIEIVGTKEKLKSIAAKAGYQRMKIFSEE 2650
            S GY++ VDLKYPEELHD    +P +P K+ ++ E LS++ K   N   Y  + KL+    D K Y+   + L +YL  G+ LEK HK +   +  WLK YI  N ++R  +K     F   F+KL+NN+ YGKT+EN+RNR  +++V  ++K + + A   ++R KIF  E
Sbjct: 1020 SEGYIFEVDLKYPEELHDLHNDYPLAPEKMDIKFEDLSEFSKAVLNGMKYTPSTKLVPNLKDKKNYITYYKNLQFYLKQGLKLEKAHKILKFQQKPWLKKYIMFNTEQRKNSKS---AFEKDFFKLMNNSVYGKTMENIRNRVDVQLVNDEKKAQKLVAAPTFKRFKIFDNE 1188          

HSP 3 Score: 50.447 bits (119), Expect = 3.676e-104
Identity = 26/54 (48.15%), Postives = 34/54 (62.96%), Query Frame = 1
Query: 2671 KNTIKFDKFNYIGFVFLELSKLYMYKFIYNVLYKTYENNYKIHFWDIDSINLEL 2832
            K  +  DK  Y+GFV LELSKL MY F YNV+ K Y +  ++ F D DS+  E+
Sbjct: 1196 KKFLTLDKPIYVGFVILELSKLIMYNFHYNVMKKEYGDKAELLFTDTDSLTYEV 1249          

HSP 4 Score: 28.8758 bits (63), Expect = 3.676e-104
Identity = 11/23 (47.83%), Postives = 15/23 (65.22%), Query Frame = 3
Query: 2025 LYYFDANSLYPTSMVDELPTGKW 2093
            + Y D N+LY  SMV+ LP G +
Sbjct:  978 IIYLDCNNLYGASMVESLPYGGF 1000          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A4Y2E019 (PR domain zinc finger protein 4 OS=Araneus ventricosus OX=182803 GN=Prdm4_3 PE=4 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 2.314e-103
Identity = 184/608 (30.26%), Postives = 295/608 (48.52%), Query Frame = 1
Query:  286 SGWIFDRITSSSLTICQFRSPHGGTYKKLPFK---SNAILNIQNKNDNKYFLYSVLEYLHAVITTEHPC-NPWKYKKYERELNLDGINVPINLNGIKKFAKQNINRVKINVFSINDKKKLGIIYRGQIDHKGCNLLLYKD----HYVLRKNVGVFL-----RNSKIDVCFPCLNCFASFKA*NALKTNQHFCINHEEWIASFPH--DPYHEFENFNFKYKVPFVCYSDFEAWNKVAEYNDIKGEQIG---FCFSIYIKSNYPNLLEDRHIVYKGEDVAFKFTETINELSEKLKIKLKTNYPIDVNESQQKEYDNCKMCFYRNKELVNDKVIDHDHYLEKENYSGASHADCNLKTK-NNLVPIYFLNGTGYDNHLIFLP---LAPNITKIIPSTDEKYISFSVG--------YLRFLDSYKMMPLPLEYLASLLKPEDLKIF--NKFYPEFNLKIRKGIYPYEYMSGKNYEDIEQKLSESQLPEISKFYNHLKTYKLSEVDYKYAQESWELLDCKNMEEYTIHYLNMDVFLLADLFENFRNVCLENFGIDPRYCYSQSGLTWVNGMKFTQVKLKNFNKKSYDQLLMIEKGVKGGFSGVLGDRLEEVNER 2013
            SGWI D+I    L + +++     +Y  LP K     A+LNIQN+ D K  ++ ++   H + +  H       Y  +E+E+ LD +  P+ LN I     + +N ++INVF   + +   +    ++D +  NLLL  +    HY L +N+   L      N K   C+ CL+ FA  +    LK +  +C +H       P   + + +F N ++++ +P++ Y+DFE+      +     E +     C   YI             +Y+G++    F E I +  E+L  KL +  PI +    + ++ +   C    K L  D+V DHDH  +   Y  A H+ CNLK + +  +PI F N   YD HLI      L      ++P+T EKY++FS+          L F+DS++ +   LE L   L P+   I   N  +   +L +RKG+YPYEYM      D  QK  E +LP I  F + L    +S+ DY++AQ  W   + KNM EY   Y+  DV  LAD+FENFRN+C   +G+D  + ++  GL W + +K T   L+ F     +  + +EKG++GG S V+  R  + N +
Sbjct:  433 SGWILDKIVHFELCVAKYQPLRASSYIILPKKLADKKAVLNIQNE-DQKCLVWCLI--AHKLNSLAHDSYRVSHYTPHEQEIKLDCVECPVPLNKIPII--ERLNNLRINVFGYEENEVFPLYVSKRVDEECVNLLLIANEETQHYCLIRNMSRLLGDLTKHNGKHHYCYRCLHRFAKVEI---LKDHLQYCNDHSPQHIKMPEKGENFIKFVNVHYQHPLPYIIYADFESLIVKEVHTSGNTEIVARHEACGYAYIIIGPDGRSVKPIAIYRGKNAVQHFMENILKEKEELAAKLTSIVPISMTPQDELDFRSATHCSICKKALKGDRVRDHDH--QTGRYRAALHSSCNLKFRLSKKIPIVFHNLKNYDGHLIMQEIGKLKDYEISVVPTTMEKYVTFSLSKRYHKFKVSLNFVDSFQFLSTSLEKLVQNLTPDKFNILKENFLHHNISLLLRKGVYPYEYM------DSHQKFDEERLPSIDSFESTLTGSGISDEDYRHAQTVWNYFNLKNMGEYHDLYVKCDVLQLADVFENFRNLCQHYYGLDCVHLFTAPGLAWQSSLKMTDQPLELFT--DINMHMFVEKGIRGGIS-VITKRFSQANNK 1021          

HSP 2 Score: 119.783 bits (299), Expect = 2.314e-103
Identity = 67/174 (38.51%), Postives = 102/174 (58.62%), Query Frame = 2
Query: 2132 NHSIGYMYIVDLKYPEELHDKTQYFPFSPRKVKVQEESLSQWQKEN-NHYGYKSTEKLIQFQNDLKEYVIEGRCLNWYLVNGMVLEKLHKKIMSNKSYWLKPYIELNIKKRTGAKQEEDKFGDIFYKLLNNAFYGKTLENVRNRQSIEIVGTKEKLKSIAAKAGYQRMKIFSEE 2650
            + S GY++ VDLKYPEELHD    +P +P K+ ++ E LS++ K   N   Y  + KL+      K Y+   + L +YL  G+ LEK+HK +   +  WLK YI  N +KR  +K     F   F+KL+NN+ YGKT+EN+RN   +++V  ++K + + A   ++R KIF  E
Sbjct: 1075 DSSEGYIFEVDLKYPEELHDHHNDYPLAPEKMDIKFEDLSEFSKAVLNGMKYTPSTKLVPNLKAKKNYITYYKNLQFYLKQGLKLEKVHKILKFQQKPWLKKYIMFNTEKRKNSKS---AFEKDFFKLMNNSVYGKTMENIRNPVDVQLVNDEKKAQKLVAAPTFKRFKIFDNE 1245          

HSP 3 Score: 51.2174 bits (121), Expect = 2.314e-103
Identity = 26/54 (48.15%), Postives = 34/54 (62.96%), Query Frame = 1
Query: 2671 KNTIKFDKFNYIGFVFLELSKLYMYKFIYNVLYKTYENNYKIHFWDIDSINLEL 2832
            K  +  DK  Y+GFV LELSKL MY F YNV+ K Y +  ++ F D DS+  E+
Sbjct: 1253 KKCLTLDKPIYVGFVILELSKLIMYNFHYNVMKKEYGDKAELLFTDTDSLTYEV 1306          

HSP 4 Score: 28.8758 bits (63), Expect = 2.314e-103
Identity = 11/23 (47.83%), Postives = 15/23 (65.22%), Query Frame = 3
Query: 2025 LYYFDANSLYPTSMVDELPTGKW 2093
            + Y D N+LY  SMV+ LP G +
Sbjct: 1035 IIYLDCNNLYGASMVESLPYGGF 1057          
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Match: zgc:153039 (solute carrier family 12 member 9-like [Source:NCBI gene;Acc:103030875])

HSP 1 Score: 126.716 bits (317), Expect = 8.160e-29
Identity = 90/321 (28.04%), Postives = 147/321 (45.79%), Query Frame = 1
Query: 4213 FIDKLPPIRRTRHATYGTINANSDHQQQADEVVECNHINNDQ--------------VSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDD------------ITMNLETNLGRKIM---------------------SNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 5034
            F D  PP  + +  T+ +++  +  + Q D +     +                  +S  EYV IIAD +KM KN+ L R+F   D    +        ++DVWP+N  +P S SY+D   +F+LQL+CILNM+  W  K K+R+++C++    G + K  ++   +LL   R++A+I TV WD+            + +  E   G +                       +N+  S+ ++        L D Y+  VN LI        AV F YLP  P  T+   +  Y++QL LL+ DL P++ + G+  VIT+ L
Sbjct:  643 FYDDAPPQDQLQDRTFRSLDDPALTEDQEDPLYHFPPLRGSTPDNKNRGGACGGKVLSPQEYVCIIADAVKMLKNVALARYFGQFD----RQRALQSPVFVDVWPVNLLRPDSSSYVDTCSLFLLQLACILNMTRSW-QKAKLRLFLCVE---AGRSLKGAEQKLKQLLKDLRMKADIHTVPWDEQVALHWQRQQVGVAIEAEAEKGEREAGEKEEEQVMIEEEEPEEEEEYANSFPSNTVR--------LSDDYLHAVNRLILDQPFSPPAVRFLYLPRPPADTRR--YNNYLHQLELLSRDLGPTMLIHGVTPVITTDL 945          

HSP 2 Score: 56.225 bits (134), Expect = 3.233e-7
Identity = 22/57 (38.60%), Postives = 39/57 (68.42%), Query Frame = 3
Query: 3756 FRNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPK 3926
            + ++  + D L IKAF+++T+A ++R G + L  + GLGG+  NT+ +GF DD+ P+
Sbjct:  594 YDSWLSLVDHLNIKAFVNLTLADSVRHGVQHLLFISGLGGMRPNTLVLGFYDDAPPQ 650          
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Match: zgc:153039 (solute carrier family 12 member 9-like [Source:NCBI gene;Acc:103030875])

HSP 1 Score: 126.331 bits (316), Expect = 1.066e-28
Identity = 90/321 (28.04%), Postives = 147/321 (45.79%), Query Frame = 1
Query: 4213 FIDKLPPIRRTRHATYGTINANSDHQQQADEVVECNHINNDQ--------------VSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDD------------ITMNLETNLGRKIM---------------------SNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 5034
            F D  PP  + +  T+ +++  +  + Q D +     +                  +S  EYV IIAD +KM KN+ L R+F   D    +        ++DVWP+N  +P S SY+D   +F+LQL+CILNM+  W  K K+R+++C++    G + K  ++   +LL   R++A+I TV WD+            + +  E   G +                       +N+  S+ ++        L D Y+  VN LI        AV F YLP  P  T+   +  Y++QL LL+ DL P++ + G+  VIT+ L
Sbjct:  556 FYDDAPPQDQLQDRTFRSLDDPALTEDQEDPLYHFPPLRGSTPDNKNRGGACGGKVLSPQEYVCIIADAVKMLKNVALARYFGQFD----RQRALQSPVFVDVWPVNLLRPDSSSYVDTCSLFLLQLACILNMTRSW-QKAKLRLFLCVE---AGRSLKGAEQKLKQLLKDLRMKADIHTVPWDEQVALHWQRQQVGVAIEAEAEKGEREAGEKEEEQVMIEEEEPEEEEEYANSFPSNTVR--------LSDDYLHAVNRLILDQPFSPPAVRFLYLPRPPADTRR--YNNYLHQLELLSRDLGPTMLIHGVTPVITTDL 858          

HSP 2 Score: 56.225 bits (134), Expect = 3.322e-7
Identity = 22/57 (38.60%), Postives = 39/57 (68.42%), Query Frame = 3
Query: 3756 FRNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPK 3926
            + ++  + D L IKAF+++T+A ++R G + L  + GLGG+  NT+ +GF DD+ P+
Sbjct:  507 YDSWLSLVDHLNIKAFVNLTLADSVRHGVQHLLFISGLGGMRPNTLVLGFYDDAPPQ 563          
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Match: slc12a9 (solute carrier family 12 member 9 [Source:NCBI gene;Acc:793341])

HSP 1 Score: 125.561 bits (314), Expect = 1.801e-28
Identity = 81/234 (34.62%), Postives = 130/234 (55.56%), Query Frame = 1
Query: 4351 EYVGIIADCMKMQKNICLCRHFENMDLIG----LKASNSSECQYIDVWPINFFQP-GSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIP-NITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 5034
            EYVGII+D +KM KN+CL R+F  +   G    LK+ +S +   IDVWP N     GSGS+ D   +F+LQ++C+LNM++ W  K ++R+++C++  +        +E + +LL + RI+A IK V WD +   L    G    +  ++S+E              ++ +VN L+K H+S   AV F YLP  P + ++SQ   +Y+ QL  +T  L P++ + GL  V  + L
Sbjct:  723 EYVGIISDAIKMGKNVCLARYFHQLPPEGKGMTLKSRDSMDT--IDVWPFNLLSAQGSGSFADVCSLFLLQMACVLNMAAGW-RKARVRIFLCVEAESGDQGWLAKEERFRDLLGKLRIRATIKIVAWDSVMRMLR---GTDPTAPPSVSEE--------------FLNKVNLLLKEHSS-TGAVRFLYLPGPPADSSQSQ---QYLAQLDAITQGLGPTLLIHGLTPVTCTEL 932          
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Match: slc12a9 (solute carrier family 12 member 9 [Source:NCBI gene;Acc:793341])

HSP 1 Score: 122.865 bits (307), Expect = 2.166e-28
Identity = 76/238 (31.93%), Postives = 124/238 (52.10%), Query Frame = 1
Query: 4351 EYVGIIADCMKMQKNICLCRHFENMDLIGLKASN-SSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTL-----PDTYVKEVNNLI---KLHTSLNT------AVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEV 5019
            EYV +++D +KM+KN+CL R+F  +D+  ++     +    IDVWP+N  +P S  Y+D   +F+LQ++CILNM S W    K+R+++C++    G   + ++EL ++L    RI+A I TV WD               S    S+E  + S    TL      D Y++ VN L+   +L     T      AV F YLP  P       + +Y++QL  +T+ L P++ + G+ +V
Sbjct:  665 EYVAVVSDAIKMKKNVCLSRYFHELDMALVRGKRRGAPSVSIDVWPLNLLRPDSAYYVDVCSLFLLQMACILNMVSSW-RHAKLRIFLCVESSLSGDKEEKLRELLSQL----RIKASIHTVHWDQ-------------GSGGGSSEEDHSRSSLKATLNWMAMSDEYLRAVNRLVLGQELVEQTGTADGRQCAVRFLYLPRPP--ADPAGYERYLHQLETITDGLGPTLLIHGVSQV 882          

HSP 2 Score: 54.6842 bits (130), Expect = 2.232e-7
Identity = 23/53 (43.40%), Postives = 36/53 (67.92%), Query Frame = 3
Query: 3765 FAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEP 3923
            +  + D L +KAF+D+T++PT+R G + L  + GLGG+  NT+ +GF DD  P
Sbjct:  567 WLSLVDKLNVKAFVDITLSPTVRQGVQNLLRIAGLGGMKPNTLFLGFYDDCVP 619          
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Match: EDO46109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR56])

HSP 1 Score: 276.559 bits (706), Expect = 2.653e-102
Identity = 206/621 (33.17%), Postives = 306/621 (49.28%), Query Frame = 1
Query:  286 SGWIFDRITSSSLTICQFRSPHGGTYKKLPFK---SNAILNIQNKNDNKYFLYSVLEYLHAVITTEHPCNPWKYKKYERELNLDGINVPINLNGIKKFAKQNINRVKINVFSINDKKKLGIIYRGQIDHKGCNLLLYKD----HYVLRKNVGVFLRNSKID----VCFPCLNCFASFKA*NALKTNQHFCINHEEWIASFPHDP-----YHEFENFNFKYKVPFVCYSDFEAWNK-------------VAEYNDIKGEQIGFCFSIYIKSN----YPNLLEDRHIVYKGEDVAFKFTETINELSEKLKIKLKTNYPIDVNESQQKEYDNCKMCFYRNKELVNDKVIDHDHYLEKENYSGASHADCNLKTKN-NLVPIYFLNGTGYDNHLIFLPLAPNITKI--IPSTDEKYISFSVGY------------------LRFLDSYKMMPLPLEYLASLLKPEDLKIFNKFY--PEFNLKIRKGIYPYEYMSGKNYEDIEQKLSESQLPEISKFYNHLKTYKLSEVDYKYAQESWELLDCKNMEEYTIHYLNMDVFLLADLFENFRNVCLENFGIDPRYCYSQSGLTWVNGMKFTQVKLKNFNKKSYDQLLMIEKGVKGGFSGV 1980
            SGW FDR+    + I  F    G +Y +LP +     AI+N++N+ND+K F ++V   ++         +    +  ER  +  GI  P++L  I KF +QN + V  NVF+  +KK   +   G+      NLLL  +    HY   K+V + L +S+ID      F C  C  SF+   AL+ +  +C  +E      P D      Y  F NFN K +VPFV Y+DFE++ +               +Y   K +  GFC+ I    +     P L++ R +    EDVA  F E++    +++  K K    +++    +  YDN   C     EL  DKV+DH H   K  Y GA+H  CNL+ +     P+ F N +GYD+HL    L  +  KI  IP+ +EKYISF+                     +RF+DS+K M   L+ L   L  E  K     Y   +  L +RKG++PY++    N++    +L   QLP    FY+ L    +SE DY++AQ+ WE      M +Y   YL  DV LLAD+FENFR+VCLEN+G+DP + Y+  GL W   +K T+V+L+       D LLM E+G++GG S +
Sbjct:  593 SGWQFDRVEYFDINIDPFDPLSGSSYVELPKELAVKKAIINVRNENDHKCFKWAVTSAVYPKRDNPQRLSRKMMENSER-FDWSGIEFPVSLRQIDKFERQNPHTV--NVFTYEEKKICPLRISGKDPFNAINLLLISNGETSHYCWIKDV-MSLVSSQIDKYHHTRFLCFRCLNSFRCKKALEKHYEYCSKNESVRIEMPMDKDGKPLYTRFVNFNRKMRVPFVVYADFESFTENIDTCSPDESRSFTKQYQ--KHKPSGFCYLIKCSIDDGVFSPKLVQ-RTVQGSAEDVAQLFVESLESDIKEIYNKFKFPKEVEMTREDEMNYDNATHCHICGGELGEDKVLDHCHLTGK--YRGAAHNACNLRFRAPKFFPVLFHNLSGYDSHLFVKNLGTSEGKINCIPNNEEKYISFTKQVVVDRFTNKEGKQVDVKRDIRFIDSFKFMSASLDSLVKNLPRESFKNLTIHYKGEQLQLLLRKGVFPYDWFC--NFD----QLDAIQLPPKEAFYSTLNDTDISEEDYQHAQKVWETFKMSTMRDYHDLYLESDVLLLADVFENFRDVCLENYGLDPAWYYTAPGLAWDAALKITRVELELLT--DCDMLLMFEEGIRGGVSMI 1196          

HSP 2 Score: 100.138 bits (248), Expect = 2.653e-102
Identity = 57/172 (33.14%), Postives = 88/172 (51.16%), Query Frame = 2
Query: 2159 VDLKYPEELHDKTQYFPFSPRKVKVQEESLSQWQKENNHYGYKSTEKLIQFQNDLKEYVIEGRCLNWYLVNGMVLEKLHKKIMSNKSYWLKPYIELNIKKRTGAKQEEDKFGDIFYKLLNNAFYGKTLENVRNRQSIEIVGTKEKLKSIAAKAGYQRMKIFSEECDTVHFKK 2674
            VD+ YP  LHD    +P +P  +K+            N  G     KLI   ND  +YV+    L  Y   G+ + K+H+ I   +S WLK YI+LN   R  A  +   F   F+KL+NN+ +GKT+EN+RNR  I ++  +++ + + +K  Y+   IF E    +H +K
Sbjct: 1262 VDMAYPRHLHDSHDDYPLAPESIKI------------NKVG-----KLIPNLNDKTKYVVHHETLKLYESLGLKVTKVHRGITFEESGWLKTYIDLNTSLRAKATND---FEKDFFKLMNNSVFGKTMENIRNRVDIRLITNEKQARKLISKPNYKHRTIFCENLAAIHMRK 1413          

HSP 3 Score: 36.5798 bits (83), Expect = 2.653e-102
Identity = 20/54 (37.04%), Postives = 29/54 (53.70%), Query Frame = 1
Query: 2671 KNTIKFDKFNYIGFVFLELSKLYMYKFIYNVLYKTYENNYKIHFWDIDSINLEL 2832
            K  + F+K  Y+G   L+LSK  MY F Y  +   Y +  K+ F D DS+  E+
Sbjct: 1413 KTRLVFNKPVYLGMCILDLSKNLMYDFHYGYVKPKYGDKAKLLFTDTDSLMYEI 1466          

HSP 4 Score: 22.7126 bits (47), Expect = 2.653e-102
Identity = 10/18 (55.56%), Postives = 12/18 (66.67%), Query Frame = 3
Query: 2031 YFDANSLYPTSMVDELPT 2084
            Y DAN+LY  +M   LPT
Sbjct: 1222 YLDANNLYGWAMSKPLPT 1239          
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Match: EDO34977 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMS5])

HSP 1 Score: 101.679 bits (252), Expect = 1.326e-21
Identity = 91/299 (30.43%), Postives = 140/299 (46.82%), Query Frame = 1
Query:  286 SGWIFDRITSSSLTICQFRSPHGGTYKKLPFK---SNAILNIQNKNDNKYFLYSVLEYLHAVITTEHPCNPWKYKKYERELNLDGINVPINLNGIKKFAKQNINRVKINVFSINDKKKLGIIYRGQIDHKGCNLLLYKD----HYVLRKNVGVFLRNSKID----VCFPCLNCFASFKA*NALKTNQHFCINHEEWIASFPHDP-----YHEFENFNFKYKVPFVCYSDFEAWNK-------------VAEYNDIKGEQIGFCFSIYIKSN---YPNLLEDRHIVYKGEDVAFKFTETI 1086
            SGW FDR+    + I  F    G +Y +LP +     AI+N++N+ND+K F ++V   ++         +    +  ER  +  GI  P++L  I KF +QN + V  NVF+  +KK   +   G+      NLLL  +    HY   K+V + L +S+ID      F C  C  SF+   AL+ +  +C  +E      P D      Y  F NFN K +VPFV Y+DFE++ +               +Y   K +  GFC+ I    +    P L++ R +    EDVA  F E++
Sbjct:  166 SGWQFDRVEYFDINIDPFDPLSGSSYVELPKELAVKKAIINVRNENDHKCFKWAVTSAVYPKRDNPQRLSRKMMENSER-FDWSGIEFPVSLRQIDKFERQNPHTV--NVFTYEEKKICPLRISGKDPFNAINLLLISNGETSHYCWIKDV-MSLVSSQIDKYHHTRFLCFRCLNSFRCEMALEKHYEYCSKNESVRIEMPMDKDGKPLYTRFVNFNRKMRVPFVVYADFESFTENIDTCSPDESRSFTKQYQ--KHKPSGFCYLIKCIDDGVFSPKLVQ-RTVQGSAEDVAQLFVESL 457          
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Match: EDO44110 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWZ0])

HSP 1 Score: 93.5893 bits (231), Expect = 3.720e-20
Identity = 91/334 (27.25%), Postives = 149/334 (44.61%), Query Frame = 1
Query:  286 SGWIFDRITSSSLTICQFRSPHGGTYKKLPFK---SNAILNIQNKNDNKYFLYSVLEYLHAVITTEHPCNPWKYKKYERELNLDGINVPINLNGIKKFAKQNINRVKINVFSINDKKKLGIIYRGQI----DHKGCNLLLYKD----HYVLRKNVGVFLRNSKID---VCFPCLNCFASFKA*NALKTNQHFCINHEEWIASFPHDP-----YHEFENFNFKYKVPFVCYSDFEAWNK-------------VAEYNDIKGEQIGFCFSI--YIKSNYPNLLEDRHIVYKGEDVAFKFTETINELSEKLKIKLKTNYPIDVNESQQKEYDNCKMC 1185
            SGW FD++    + I   +   G +Y  LP +     AI+N++N++D++ F ++V   ++   T     N  +  +  +  N  GI  PI+L  I +F KQN + V  NV+        G +Y  +I    D +  NLLL  D    HY   KN+   L +   D       C  C  SF    AL+ +  +C  +EE     P D      Y +F +FN K +VPFV Y+DFE + +               +Y   K +  GFC+ I  +  S +P  L    +    EDVA  F E++    +++  K + +  +++ +  + +Y N   C
Sbjct:   17 SGWRFDQVEYFDINIDPXKPLSGSSYIPLPSELASKKAIINVKNESDHECFKWAVTSAIYPKETHPERLNK-QMTESSKNFNWSGIEFPISLKQIDEFEKQNPHAV--NVYGYE-----GSVYPLRISKRHDTRTINLLLISDDETNHYCWIKNMSRLLSSQIGDHQHASEFCPRCLNSFWCKEALERHSEYCSKNEEVKIEMPRDIDGNPLYTKFRSFNRKMRVPFVVYADFECFTENIDTCSPDESKSFTKQYQ--KHKPSGFCYLIKCFDDSIFPPTLVRETLQGPTEDVAQMFVESLESDIKEIYDKFRFSKRVEMTQRDRIDYSNATHC 340          
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Match: EDO48021 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKP4])

HSP 1 Score: 88.5817 bits (218), Expect = 8.057e-18
Identity = 89/338 (26.33%), Postives = 150/338 (44.38%), Query Frame = 1
Query:  286 SGWIFDRITSSSLTICQFRSPHGGTYKKLPFK---SNAILNIQNKNDNKYFLYSVLEYLHAVITTEHPCNPWKYKKYERELNLDGINVPINLNGIKKFAKQNINRVKINVFSINDKKKLGIIYRGQIDHKG----CNLLLYKD----HYVLRKNVGVFLRNS------KIDVCFPCLNCFASFKA*NALKTNQHFCINHEEWIASFP------HDPYHEFENFNFKYKVPFVCYSDFEAWNK-------------VAEYNDIKGEQIGFCFSI--YIKSNYPNLLEDRHIVYKGEDVAFKFTETINELSEKLKIKLKTNYPIDVNESQQKEYDNCKMC 1185
            SGW FD++    + I  F    G +Y +LP K     AI+N++NKND++ F ++V   ++         N  + ++  ++ +  GI  P++L  I KF KQN     +NVF  N     G ++  +I  K      NLLL  +    HY   K++   L +         + C  CLN F   KA   L+ +  +C NHE      P      + P+ +F+N+N K +VPFV Y+DFE++ +               +Y + K    GFC+ I  +  + +P+ L         ED+   F +++    + +  K K    + +    + +Y N   C
Sbjct:  213 SGWRFDQVEYFDINIDPFEPLSGSSYIQLPSKLASKQAIINVKNKNDHECFKWAVTSAMYPRGKDPQRLNE-QIRESSKKFDWAGIEFPVSLKQIDKFEKQNP--YTVNVFGYN-----GEVFPRRISKKRNARVINLLLISNDETNHYCWIKDMSRLLSSQINNHQHATEFCPRCLNPFWCKKA---LEKHSEYCDNHEAVRIEMPKIDKDGNLPHIKFKNYNRKMRVPFVVYADFESFTENIDTCSPDESKSFTKQYQEHKPS--GFCYLIKCFDDNIFPSELVRYTAESPDEDIPQMFVDSLESDIKDIYNKFKFPKKVKMTLRDRTDYKNATHC 537          
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Match: EDO34080 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQD5])

HSP 1 Score: 87.4261 bits (215), Expect = 2.617e-17
Identity = 88/300 (29.33%), Postives = 132/300 (44.00%), Query Frame = 1
Query:  286 SGWIFDRITSSSLTICQFRSPHGGTYKKLPFKSN-----AILNIQNKNDNKYFLYSVLEYLHAVITTEHPCNPWKYKKYERELNLDGINVPINLNGIKKFAKQNINRVKINVFSINDKKKLGIIYRGQI----DHKGCNLLLYKD----HYVLRKNVGVFLRNSKID---VCFPCLNCFASFKA*NALKTNQHFCINHEEWIASFPHDP-----YHEFENFNFKYKVPFVCYSDFEAWNK-------------VAEYNDIKGEQIGFCFSI--YIKSNYPNLLEDRHIVYKGEDVAFKFT 1077
            SGW FD++    + I  F+   G +Y  +P  S      AI+N++N+ND++ F ++V   ++   T     N  +  +  +  N  GI  PI+L  I +F KQN + V  NV+        G +Y  +I    D +  NLLL  D    HY   KN+   L +   D       C  C  SF    AL+ +  +C  +EE     P D      Y +F +FN K +VPFV Y+DFE + +               +Y   K +  GFC+ I  +  S +P  L    +    EDVA   T
Sbjct:  370 SGWRFDQVEYFDINIDPFKPLSGSSY--IPLLSELASKKAIINVKNENDHECFKWAVTSAIYPKETHPERLNK-QMTESSKNFNWSGIEFPISLKQIDEFEKQNPHAV--NVYGYE-----GSVYPLRISKRHDTRTINLLLISDDETNHYCWIKNMSRLLSSQIGDHQHASEFCPRCLNSFWCKKALERHSEYCSKNEEVKIEMPRDIDGNPLYTKFRSFNRKMRVPFVVYADFECFTENIDTCSPDESKSFTKQYQ--KHKPSGFCYLIKCFDDSIFPPTLVRETLQGPTEDVAQMLT 657          
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Match: zgc:153039 (solute carrier family 12 member 9 [Source:NCBI gene;Acc:101160334])

HSP 1 Score: 141.354 bits (355), Expect = 2.069e-33
Identity = 88/249 (35.34%), Postives = 127/249 (51.00%), Query Frame = 1
Query: 4351 EYVGIIADCMKMQKNICLCRHFENMD----LIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITM---NLETNLGRKIMSNNAMSDEIKTISLFD--------------CTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 5034
            EYV +IAD MKM KN+ L R+F N D    L+   +S      ++DVWP+N  +P S SY+D   +F+LQL+CILNM   W  K  +R+++C++    G + K  +E   +LL   RI+A++  V WD +       +    RK  S +  +DE    +  D                L D Y+  VN LI   T    AV F YLP  P  T+   +  Y+ QL LLT DL P++ + G+  VIT+ L
Sbjct:  663 EYVAVIADAMKMLKNVVLARYFNNFDRSQALLPSSSSPGKGGVFVDVWPVNLLRPDSSSYVDTCSLFLLQLACILNMVRAW-RKATLRLFLCVEE---GRSVKGSEEKLGQLLKDLRIKAQVYPVPWDQVVALHWQRQGGWSRKQQSTDPSTDESAARAEEDENQDDYVNSFPSNATRLSDDYLSAVNKLILDQTRQPPAVRFLYLPRPPADTRG--YTAYLQQLDLLTQDLGPTLLIHGVTPVITTDL 905          
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Match: zgc:153039 (solute carrier family 12 member 9 [Source:NCBI gene;Acc:101160334])

HSP 1 Score: 141.354 bits (355), Expect = 2.376e-33
Identity = 88/249 (35.34%), Postives = 127/249 (51.00%), Query Frame = 1
Query: 4351 EYVGIIADCMKMQKNICLCRHFENMD----LIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITM---NLETNLGRKIMSNNAMSDEIKTISLFD--------------CTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 5034
            EYV +IAD MKM KN+ L R+F N D    L+   +S      ++DVWP+N  +P S SY+D   +F+LQL+CILNM   W  K  +R+++C++    G + K  +E   +LL   RI+A++  V WD +       +    RK  S +  +DE    +  D                L D Y+  VN LI   T    AV F YLP  P  T+   +  Y+ QL LLT DL P++ + G+  VIT+ L
Sbjct:  712 EYVAVIADAMKMLKNVVLARYFNNFDRSQALLPSSSSPGKGGVFVDVWPVNLLRPDSSSYVDTCSLFLLQLACILNMVRAW-RKATLRLFLCVEE---GRSVKGSEEKLGQLLKDLRIKAQVYPVPWDQVVALHWQRQGGWSRKQQSTDPSTDESAARAEEDENQDDYVNSFPSNATRLSDDYLSAVNKLILDQTRQPPAVRFLYLPRPPADTRG--YTAYLQQLDLLTQDLGPTLLIHGVTPVITTDL 954          
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000020773.2 (solute carrier family 12 member 9 [Source:NCBI gene;Acc:101161090])

HSP 1 Score: 123.25 bits (308), Expect = 9.408e-28
Identity = 78/248 (31.45%), Postives = 136/248 (54.84%), Query Frame = 1
Query: 4354 YVGIIADCMKMQKNICLCRHFENMD---LIGL----KASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQEL-WNELLIQWRIQAEIKTVGWDDIT-MNLETNLGRKIMSNNAMSDEIKT-----------ISLFDCT-LPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 5034
            YV IIAD +KM KN+ L R+F   D   ++GL    +     +  +IDVWP+N  QPGS  Y++ + +F+LQL+ +L     W  +  +R+++C++    G   +  +EL    +L + RI A+++ V WD++  ++ +   G + +     +DE +              L D +  PD Y+  VN+LI  H+S  TAV F +LP  P  + ++ +R Y++Q+ LL+ DL P++ + G+  V+T+ L
Sbjct:  692 YVSIIADALKMGKNVILARYFNQFDRQEVLGLGKGFRDHQKVKGPFIDVWPLNLLQPGSLGYVNISSLFLLQLASVLQEVRAW-KQASLRLFLCVE---AGGRLQEEEELRLRSMLKELRISAQVQKVAWDNVVRLHWQRRGGEEDLVEYPQTDEERLRRQSDKDDSVQTRLSDASPTPDEYICAVNSLIFRHSSPQTAVRFLHLPHPP--SDARRYRVYLHQVDLLSRDLGPTLLIHGITPVVTTDL 933          

HSP 2 Score: 53.9138 bits (128), Expect = 1.506e-6
Identity = 23/57 (40.35%), Postives = 37/57 (64.91%), Query Frame = 3
Query: 3756 FRNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPK 3926
            + ++  + D LKIKAF++ T+A ++R G R L  + G GG+  NT+ +GF DD  P+
Sbjct:  588 YDSWLSLVDHLKIKAFVNFTLADSVRHGVRNLLFISGFGGMRPNTLILGFYDDCIPQ 644          
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Match: slc12a9 (solute carrier family 12 member 9-like [Source:NCBI gene;Acc:101175259])

HSP 1 Score: 120.939 bits (302), Expect = 4.244e-27
Identity = 77/254 (30.31%), Postives = 128/254 (50.39%), Query Frame = 1
Query: 4261 GTINANSDHQQQADEVVECNHINNDQ-VSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEV 5019
            G  N   D            H+ + + +S  EYVGII+D +KM KN+CL R+F  +   G  +      + IDVWP+N  QPG   Y D   +F+LQ++C+LNMSS+W +  ++R+++ ++  +        +E + +LL + RI+A IK V WD    +        I      S+ + T+S       + ++  VN ++  H+S   AV F YLP  P   +    ++Y+ QL  +T  L P++ + G+  V
Sbjct:  666 GEYNFGVDLPSLQAHFPPVRHVESPRWLSPEEYVGIISDALKMNKNVCLGRYFFQLQGEGKDSKTDGSERTIDVWPLNLLQPGCRDYQDVCSLFLLQMACVLNMSSKWRNA-RMRIFLNVETASCDQGWVINEETFRDLLKKLRIRASIKIVSWDPAVQH------HTISEEERPSESLPTLS-------EDFLSAVNCMLTEHSS-QAAVRFLYLPRPP--AQGSQAQQYLAQLEAITYGLGPTLLIHGVTPV 902          
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Match: slc12a9 (solute carrier family 12 member 9-like [Source:NCBI gene;Acc:101175259])

HSP 1 Score: 120.939 bits (302), Expect = 4.416e-27
Identity = 77/254 (30.31%), Postives = 128/254 (50.39%), Query Frame = 1
Query: 4261 GTINANSDHQQQADEVVECNHINNDQ-VSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEV 5019
            G  N   D            H+ + + +S  EYVGII+D +KM KN+CL R+F  +   G  +      + IDVWP+N  QPG   Y D   +F+LQ++C+LNMSS+W +  ++R+++ ++  +        +E + +LL + RI+A IK V WD    +        I      S+ + T+S       + ++  VN ++  H+S   AV F YLP  P   +    ++Y+ QL  +T  L P++ + G+  V
Sbjct:  692 GEYNFGVDLPSLQAHFPPVRHVESPRWLSPEEYVGIISDALKMNKNVCLGRYFFQLQGEGKDSKTDGSERTIDVWPLNLLQPGCRDYQDVCSLFLLQMACVLNMSSKWRNA-RMRIFLNVETASCDQGWVINEETFRDLLKKLRIRASIKIVSWDPAVQH------HTISEEERPSESLPTLS-------EDFLSAVNCMLTEHSS-QAAVRFLYLPRPP--AQGSQAQQYLAQLEAITYGLGPTLLIHGVTPV 928          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000033021.1 (SMESG000033021.1)

HSP 1 Score: 690.263 bits (1780), Expect = 0.000e+0
Identity = 329/355 (92.68%), Postives = 337/355 (94.93%), Query Frame = 1
Query: 3970 DILKKIFNQSNKCNPHQFIRARNNSLFAGDVQSFTNQSSESFDKSKIVQQSASRIDNENTNLISKGKNKIFNLLKSPVDPEFIDKLPPIRRTRHATYGTINANSDHQQQADEVVECNHINNDQVSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 5034
            DILKKIFNQSNKCNPHQFIRARNNSLFAGDVQSFTNQSSESFDKSKIVQQSASRIDNENTNLI KGKNKIFNLLKSPVDPEFIDKLPPIRRTRHATYGTINANSDHQQQADEVVECN+INNDQVSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMS+QWSSKCKIRVYICLDYYTIGT   NVQ LWNELL QWRIQAEIKTVGWDDI +NLE NLG KIMS N +SDEIKTISLFDCTLPDTY+KEVNNLIK H S NTAVCFFYLPIIPNI  SQ+W KYI+QLTLLTNDLPPSVFVRG H+VITSAL
Sbjct:  645 DILKKIFNQSNKCNPHQFIRARNNSLFAGDVQSFTNQSSESFDKSKIVQQSASRIDNENTNLIYKGKNKIFNLLKSPVDPEFIDKLPPIRRTRHATYGTINANSDHQQQADEVVECNYINNDQVSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGLWNELLNQWRIQAEIKTVGWDDIMVNLEANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 999          

HSP 2 Score: 116.701 bits (291), Expect = 0.000e+0
Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 3
Query: 3762 NFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPK 3926
            NFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPK
Sbjct:  590 NFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPK 644          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000080616.1 (SMESG000080616.1)

HSP 1 Score: 332.798 bits (852), Expect = 0.000e+0
Identity = 161/199 (80.90%), Postives = 177/199 (88.94%), Query Frame = 2
Query: 2078 PNREMEFCKDNKYTNTILNHSIGYMYIVDLKYPEELHDKTQYFPFSPRKVKVQEESLSQWQKENNHYGYKSTEKLIQFQNDLKEYVIEGRCLNWYLVNGMVLEKLHKKIMSNKSYWLKPYIELNIKKRTGAKQEEDKFGDIFYKLLNNAFYGKTLENVRNRQSIEIVGTKEKLKSIAAKAGYQRMKIFSEECDTVHFKK 2674
            P  EM+ CKD+KY  TILNH IGY+YIVDLKYP ELHDKT+YFPF PRKVKVQEESLSQWQKENN   YK+TE LIQ Q+DLKEYVIEGRCL+WYL NG+VL+K+HKKIM NKSYWLKPYI+ NIKKRT +KQ+ +KFGD+FYKLLNNAFYGKTLENVRNR+SIEIV TKEKLKSIAAKAGYQRMKIFSEEC  VHF K
Sbjct:  211 PTGEMKLCKDSKYVKTILNHLIGYIYIVDLKYPVELHDKTEYFPFCPRKVKVQEESLSQWQKENNPLNYKTTEILIQSQDDLKEYVIEGRCLDWYLENGIVLKKVHKKIMYNKSYWLKPYIKFNIKKRTESKQQGNKFGDVFYKLLNNAFYGKTLENVRNRKSIEIVSTKEKLKSIAAKAGYQRMKIFSEECAAVHFNK 409          

HSP 2 Score: 284.648 bits (727), Expect = 0.000e+0
Identity = 149/214 (69.63%), Postives = 166/214 (77.57%), Query Frame = 1
Query: 1387 IPSTDEKYISFSVGYLRFLDSYKMMPLPLEYLASLLKPEDLKIFNKFYPEFNLKIRKGIYPYEYMSGKNYEDIEQKLSESQLPEISKFYNHLKTYKLSEVDYKYAQESWELLD-CKNMEEYTIHYLNMDVFLLADLFENFRNVCLENFGIDPRYCYSQSGLTWVNGMKFTQVKLKNFNKKSYDQLLMIEKGVKGGFSGVLGDRLEEVNERKGIP 2025
            + STDEKYISFSVG LRFLDSYKMMPLPLEYL SLLKP+DLKIFNKFY + NL IRKGIY YEY+SGKN+ED +QKLSESQL EISKFYNHLK  +L+E DY + QESW LL+  +NMEEYTIHYLNM+VFLLAD+FENFRNVCLENFGIDP YCY  SGLTWV+GMK TQ                       GFSGVLGDRL  V+E++  P
Sbjct:    1 MQSTDEKYISFSVGSLRFLDSYKMMPLPLEYLESLLKPKDLKIFNKFYLQLNLNIRKGIYLYEYISGKNFEDTKQKLSESQLLEISKFYNHLKMTELNEKDYLFGQESWHLLEYGRNMEEYTIHYLNMEVFLLADVFENFRNVCLENFGIDPCYCYFLSGLTWVSGMKVTQ----------------------RGFSGVLGDRLVVVHEKERYP 192          

HSP 3 Score: 55.0694 bits (131), Expect = 0.000e+0
Identity = 27/31 (87.10%), Postives = 28/31 (90.32%), Query Frame = 1
Query: 2665 F*KNTIKFDKFNYIGFVFLELSKLYMYKFIY 2757
            F KNTIKF+KFNY GFV LELSKLYMYKFIY
Sbjct:  407 FNKNTIKFEKFNYTGFVLLELSKLYMYKFIY 437          

HSP 4 Score: 47.7506 bits (112), Expect = 0.000e+0
Identity = 21/32 (65.62%), Postives = 24/32 (75.00%), Query Frame = 3
Query: 2010 KEGNSLYYFDANSLYPTSMVDELPTGKWNFAR 2105
            KE   LYYFDANSLYPT+M DELPTG+    +
Sbjct:  188 KERYPLYYFDANSLYPTAMTDELPTGEMKLCK 219          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000060496.1 (SMESG000060496.1)

HSP 1 Score: 553.518 bits (1425), Expect = 1.416e-180
Identity = 280/365 (76.71%), Postives = 304/365 (83.29%), Query Frame = 1
Query: 3970 DILKKIFNQSNKCNPHQFIRARNNSLFAGDVQSFTNQSSES--------FDKSKIVQQSASRI-DNENTNLISKGKNKIFN-LLKSPVDPEFIDKLPPIRRTRHATYGTINANSDHQQQADEVVECNHINNDQVSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 5034
            DIL+KI  Q N    +   + R+   FA     FT + S S         D S  +  ++S I  +ENT L++K + K  N +L+  VDP+FID+LPPIR TR   +G IN  S +++  ++    N+INNDQ+SEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL
Sbjct:  641 DILQKINCQMNNLKSNWPFKPRHIPAFAELSSDFTGEQSTSKRLCHNISVDNS--INSTSSHICVDENTRLVTKDRMKFLNRILRPSVDPKFIDELPPIRSTRQELFGEINELSANRETRED----NYINNDQISEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 999          

HSP 2 Score: 102.064 bits (253), Expect = 1.416e-180
Identity = 48/56 (85.71%), Postives = 50/56 (89.29%), Query Frame = 3
Query: 3759 RNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPK 3926
            + F  MKDFL IKAFIDVTIAPTIRDGCRQLS LCGLGGL INTVCIGFRDDSEP+
Sbjct:  585 KKFIIMKDFLDIKAFIDVTIAPTIRDGCRQLSRLCGLGGLMINTVCIGFRDDSEPQ 640          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000060496.1 (SMESG000060496.1)

HSP 1 Score: 553.132 bits (1424), Expect = 1.565e-180
Identity = 280/365 (76.71%), Postives = 304/365 (83.29%), Query Frame = 1
Query: 3970 DILKKIFNQSNKCNPHQFIRARNNSLFAGDVQSFTNQSSES--------FDKSKIVQQSASRI-DNENTNLISKGKNKIFN-LLKSPVDPEFIDKLPPIRRTRHATYGTINANSDHQQQADEVVECNHINNDQVSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 5034
            DIL+KI  Q N    +   + R+   FA     FT + S S         D S  +  ++S I  +ENT L++K + K  N +L+  VDP+FID+LPPIR TR   +G IN  S +++  ++    N+INNDQ+SEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL
Sbjct:  646 DILQKINCQMNNLKSNWPFKPRHIPAFAELSSDFTGEQSTSKRLCHNISVDNS--INSTSSHICVDENTRLVTKDRMKFLNRILRPSVDPKFIDELPPIRSTRQELFGEINELSANRETRED----NYINNDQISEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 1004          

HSP 2 Score: 102.064 bits (253), Expect = 1.565e-180
Identity = 48/56 (85.71%), Postives = 50/56 (89.29%), Query Frame = 3
Query: 3759 RNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPK 3926
            + F  MKDFL IKAFIDVTIAPTIRDGCRQLS LCGLGGL INTVCIGFRDDSEP+
Sbjct:  590 KKFIIMKDFLDIKAFIDVTIAPTIRDGCRQLSRLCGLGGLMINTVCIGFRDDSEPQ 645          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000015240.1 (SMESG000015240.1)

HSP 1 Score: 537.724 bits (1384), Expect = 9.832e-174
Identity = 274/388 (70.62%), Postives = 316/388 (81.44%), Query Frame = 1
Query:  496 YKKY--ERELNLDGINVPINLNGIKKFAKQNINRVKINVFSINDKKKLGIIYRGQIDHKGCNLLLYKDHYVLRKNVGVFLRNSKIDVCFPCLNCFASFKA*NALKTNQHFCINHEEWIASFPHDPYHEFENFNFKYKVPFVCYSDFEAWNKVA----EYND-IKGEQIGFCFSIYIKSNYPNLLEDRHIVYKGEDVAFKFTETINELSEKLKIKLKTNYPI-DVNESQQKEYDNCKMCFYRNKEL--VNDKVIDHDHYLEKENYSGASHADCNLKTK-NNLVPIYFLNGTGYDNHLIFLPLAPNITKIIPSTDEKYISFSVGYLRFLDSYKMMPLPLEYLASLLKPEDLKIFNKFYPEFNLKIRKGIYPYEYMSGKNYEDIEQKLSES 1626
            YK+Y    ELN+ GIN PI+LNGI+KFA+QN   VKINVF+IND KKLGI+YR  +D KGCNLLLYKDHYVL KN GVFL+NSK+DV F CLNCFASF   NALK +Q FC+ HEE IASFPH PYHEF+N+N+K KVPFVCYSDFEAWNKVA    + ND I+ EQ GFCFSIY+KSNYP L+EDR+IVY+GED    F ETIN LSE+LK KLKTNY I ++++ Q  EY N  +CFY  KE    NDKV+DHDHYLEK NY GA+H DCNLK + NN +P+YF NG+GYDNHL+FLPLAPNITKIIPSTDEKYISF+VG +RFLDS+K MPL LEYLASLL+PE LK FNKFYP+FNLKIRKGIY YEY+SGKNY +I+QKL E 
Sbjct:  183 YKQYLENGELNISGINFPIHLNGIQKFARQNYTIVKINVFTINDNKKLGILYRDHLDPKGCNLLLYKDHYVLCKNFGVFLKNSKVDVSFLCLNCFASFTVENALKKHQQFCVEHEEGIASFPHVPYHEFQNYNYKNKVPFVCYSDFEAWNKVAGDTLDRNDLIRSEQKGFCFSIYLKSNYPLLVEDRNIVYEGEDATTAFAETINSLSEELKPKLKTNYIISELSDEQLNEYRNEVICFYCGKEFTPTNDKVMDHDHYLEKNNYRGAAHNDCNLKARTNNFIPLYFHNGSGYDNHLVFLPLAPNITKIIPSTDEKYISFTVGCIRFLDSFKTMPLSLEYLASLLEPEHLKTFNKFYPQFNLKIRKGIYNYEYISGKNYTEIQQKLLEQ 570          
The following BLAST results are available for this feature:
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SLC12A94.433e-1626.27solute carrier family 12 member 9 [Source:HGNC Sym... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZC53.43.370e-4325.85pep chromosome:WBcel235:X:1925750:1937689:1 gene:W... [more]
T04B8.51.225e-2932.91pep chromosome:WBcel235:II:614770:621330:-1 gene:W... [more]
T04B8.51.230e-2932.91pep chromosome:WBcel235:II:614770:624543:-1 gene:W... [more]
T04B8.52.139e-2932.91pep chromosome:WBcel235:II:614767:620909:-1 gene:W... [more]
H12I13.33.488e-1130.83pep chromosome:WBcel235:II:6071386:6073251:-1 gene... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG104133.630e-2332.39gene:FBgn0032689 transcript:FBtr0343829[more]
CG104133.630e-2332.39gene:FBgn0032689 transcript:FBtr0081080[more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
slc12a95.678e-3034.20solute carrier family 12 member 9 [Source:NCBI gen... [more]
slc12a95.678e-3034.20solute carrier family 12 member 9 [Source:NCBI gen... [more]
zgc:1530391.498e-2934.98zgc:153039 [Source:ZFIN;Acc:ZDB-GENE-060929-736][more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSXETT00000045625.13.288e-2631.49solute carrier family 12 member 9-like [Source:NCB... [more]
ENSXETT00000045638.13.609e-2631.49solute carrier family 12 member 9-like [Source:NCB... [more]
SLC12A93.585e-2529.61solute carrier family 12, member 9 [Source:NCBI ge... [more]
SLC12A94.542e-2529.61solute carrier family 12, member 9 [Source:NCBI ge... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Slc12a99.031e-1725.20solute carrier family 12 (potassium/chloride trans... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A2BFP5|S12A9_DANRE4.286e-2934.20Solute carrier family 12 member 9 OS=Danio rerio O... [more]
sp|Q0VGW6|S12A9_XENLA1.651e-2731.36Solute carrier family 12 member 9 OS=Xenopus laevi... [more]
sp|Q99MR3|S12A9_MOUSE6.317e-1625.20Solute carrier family 12 member 9 OS=Mus musculus ... [more]
sp|Q66HR0|S12A9_RAT1.503e-1524.80Solute carrier family 12 member 9 OS=Rattus norveg... [more]
sp|Q9BXP2|S12A9_HUMAN2.129e-1526.27Solute carrier family 12 member 9 OS=Homo sapiens ... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YIX71.010e-17676.44Slc12a-2 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A4Y2GG321.400e-10630.92PR domain zinc finger protein 4 (Fragment) OS=Aran... [more]
A0A4Y2NLI43.359e-10630.43Gastrula zinc finger protein XlCGF57.1 (Fragment) ... [more]
A0A4Y2WQ603.676e-10430.23Gastrula zinc finger protein XlCGF57.1 (Fragment) ... [more]
A0A4Y2E0192.314e-10330.26PR domain zinc finger protein 4 OS=Araneus ventric... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zgc:1530398.160e-2928.04solute carrier family 12 member 9-like [Source:NCB... [more]
zgc:1530391.066e-2828.04solute carrier family 12 member 9-like [Source:NCB... [more]
slc12a91.801e-2834.62solute carrier family 12 member 9 [Source:NCBI gen... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc12a92.166e-2831.93solute carrier family 12 member 9 [Source:NCBI gen... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461092.653e-10233.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349771.326e-2130.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO441103.720e-2027.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480218.057e-1826.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340802.617e-1729.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1530392.069e-3335.34solute carrier family 12 member 9 [Source:NCBI gen... [more]
zgc:1530392.376e-3335.34solute carrier family 12 member 9 [Source:NCBI gen... [more]
ENSORLT00000020773.29.408e-2831.45solute carrier family 12 member 9 [Source:NCBI gen... [more]
slc12a94.244e-2730.31solute carrier family 12 member 9-like [Source:NCB... [more]
slc12a94.416e-2730.31solute carrier family 12 member 9-like [Source:NCB... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033021.10.000e+092.68SMESG000033021.1[more]
SMESG000080616.10.000e+080.90SMESG000080616.1[more]
SMESG000060496.11.416e-18076.71SMESG000060496.1[more]
SMESG000060496.11.565e-18076.71SMESG000060496.1[more]
SMESG000015240.19.832e-17470.62SMESG000015240.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001706 ID=SMED30001706|Name=C2H2-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=5153bp
ATTGTTGTTACTTGGAGAAAAGATACAAATTTTGAATCCATCCTCCAAGT
TACTAAACTACATGGGCTATCCAAATTCTCAACAAAGATGGAGAAAAAAA
TTAAGGATTGAAAGAATAAAAAGAGAACAGAAAGAAGAAAAAGAAATAAA
AAATAATTATGAAACAATCAAAATGTATTTCACATCCCCAGTTTCAGTGA
TTGTGAAGAAAGACCAAATTCCTACTGAAATTTTATCAATTATTGAACAT
TTAACAAATAGAATATATAATGAGCAACTACAAGGAGTGGTTGGATATTT
GACAGAATTACAAGTAGTAGTTTGACTATTTGTCAATTTAGATCACCACA
TGGTGGAACATATAAAAAGCTCCCATTTAAATCTAACGCCATTTTGAATA
TACAAAATAAGAATGATAATAAATATTTCTTATATTCTGTATTGGAATAT
TTGCACGCGGTAATTACAACTGAACATCCATGTAATCCCTGGAAATACAA
AAAATATGAAAGGGAATTAAACCTGGATGGTATAAATGTTCCTATAAATT
TGAATGGGATTAAAAAATTCGCTAAGCAGAACATTAATAGAGTAAAAATC
AATGTATTTAGTATAAATGATAAAAAGAAACTTGGAATAATTTATAGGGG
TCAAATAGATCATAAAGGATGTAATTTATTATTGTACAAAGATCATTATG
TCCTTCGTAAAAATGTTGGAGTGTTTTTAAGAAATAGTAAGATAGATGTA
TGCTTTCCTTGTCTTAACTGTTTCGCGTCCTTTAAAGCATAGAATGCATT
GAAAACCAACCAACATTTTTGTATTAATCATGAAGAATGGATTGCATCTT
TCCCTCATGACCCATATCATGAATTTGAAAACTTTAATTTTAAATACAAA
GTCCCCTTTGTATGTTATTCCGACTTTGAAGCTTGGAACAAGGTTGCGGA
ATATAACGATATAAAAGGGGAACAAATTGGATTTTGCTTTAGTATTTATA
TAAAAAGCAATTATCCTAATTTATTGGAAGATCGACATATAGTGTATAAA
GGGGAAGATGTAGCATTTAAATTCACTGAAACAATTAATGAATTATCAGA
GAAATTAAAGATAAAATTAAAGACAAATTACCCGATAGATGTTAATGAAT
CTCAACAAAAGGAATATGATAATTGTAAGATGTGTTTCTATCGTAATAAA
GAACTAGTGAATGATAAAGTAATAGATCATGACCATTACTTAGAAAAAGA
AAATTATAGCGGAGCATCACATGCTGATTGTAATTTAAAAACCAAAAATA
ACTTAGTTCCAATTTATTTTCTCAATGGAACTGGGTATGACAATCATTTG
ATTTTCCTCCCATTAGCTCCAAATATCACGAAAATCATACCAAGTACAGA
TGAGAAATATATTTCATTTAGTGTTGGATATTTAAGGTTTTTAGATTCGT
ATAAGATGATGCCTTTACCACTTGAGTATTTAGCATCTCTTTTAAAACCG
GAAGATCTTAAAATCTTTAATAAATTCTATCCTGAATTTAATTTAAAGAT
TCGTAAAGGAATATATCCTTATGAATATATGAGTGGAAAAAATTATGAAG
ATATAGAACAGAAATTATCAGAATCTCAATTACCAGAAATTTCGAAATTT
TATAATCATCTGAAAACGTACAAATTATCAGAAGTAGATTATAAGTACGC
GCAGGAATCATGGGAATTATTAGATTGTAAGAATATGGAAGAGTATACAA
TCCATTACTTGAACATGGACGTATTCTTATTAGCCGATCTTTTCGAGAAT
TTTAGAAATGTTTGTCTTGAAAACTTCGGTATTGACCCACGTTACTGCTA
CTCCCAATCAGGATTAACTTGGGTGAATGGAATGAAATTCACTCAAGTTA
AATTAAAAAATTTCAACAAAAAATCATACGACCAGTTATTAATGATTGAA
AAGGGAGTTAAAGGCGGATTCTCAGGAGTACTTGGGGATCGATTGGAAGA
AGTGAATGAAAGGAAGGGAATTCCCTCTACTATTTTGATGCCAACTCATT
GTATCCAACATCAATGGTTGATGAACTCCCAACAGGGAAATGGAATTTTG
CAAGGACAATAAATATACCAATACAATATTGAATCATTCAATTGGGTATA
TGTATATTGTAGATCTCAAGTACCCTGAAGAACTCCATGATAAAACCCAA
TACTTCCCCTTCAGCCCAAGAAAAGTTAAAGTCCAAGAAGAATCACTTTC
TCAGTGGCAGAAAGAAAATAATCATTATGGGTATAAATCCACTGAAAAAT
TGATTCAGTTCCAAAATGATTTAAAGGAATATGTCATTGAAGGACGATGT
CTTAACTGGTACTTAGTGAATGGTATGGTTCTTGAGAAATTACATAAAAA
GATCATGTCCAATAAATCATATTGGCTCAAGCCATACATCGAATTAAATA
TAAAAAAGAGGACAGGGGCAAAACAAGAAGAAGATAAATTCGGAGATATC
TTTTATAAGCTGCTGAATAATGCATTTTATGGAAAGACTCTCGAAAATGT
AAGGAATAGACAATCAATAGAGATTGTTGGCACAAAAGAAAAATTAAAGA
GTATAGCAGCAAAAGCTGGTTATCAGAGAATGAAAATCTTCTCTGAAGAA
TGTGATACTGTACATTTTAAAAAAATACTATAAAGTTTGACAAGTTCAAC
TACATAGGATTTGTATTCCTAGAATTGTCAAAACTTTATATGTATAAATT
TATATATAATGTTTTGTATAAAACATATGAAAATAATTATAAAATACATT
TCTGGGATATCGATTCAATAAACCTCGAATTGTTCTTAGGTTTTCATCAA
TTCATTCACTCGAGTGCGATTACTATCTACAATGTGATTACTATCTAGAA
CACGATTACCATCTATAACATAAGAAATCCATCGAGCACATCTAACATCT
TAAACATTAATGACATTAACGATATTAACGACAAATATGATATTAACGAC
ATTAATGGCATTAATAACATTAGATAACAATAGAACATGTTTTTCCTCAA
TTTTCTCGTTTCGTCAGATTTCATCAGATTTTTTATCGATCATTTTATTC
ATTTTACAAGTAGTATAAAAAAGGTAAACCACACGCTTTCGGGGCCTACA
TTCGCTAATAACACCAACCAATATATTTTCAGCAACTAAAATATTTCCAT
TTCAACTATTTTCAATTTATTTCAATTTAATACAGTGGGTTTATACTTAC
TTATGTTTTAGTGGCAGATATAAGCATTATGTGTGTATGTATGTATCACT
TGTATGTGTGTATCACATGTATTATGTATAATTATAAGCCCTCTGCTTCA
AGTAATGTGGCGTTTCGTCGGTAAAATCTTTCAATATCAGTTTTTATTGA
TTGTAGCGCTATTACAATGGTTATTAGTAAATATTCTTGCTCTGAAATGT
TGTCAATATTGAGAGATCTCAAATTTAAGTTCATTAAAGTTTTCAATATG
CAAGTTTATAAGGCAATAAATCTTTCGAGCATTGCAAGAAGGTTGTTCCA
TTTTGTTTTTACATCCAGTATAATCTTAAGTTCCTTATAGTACTCAATTC
TAACGTATTTTGACAAAATCTCATCTAATAAAAATGAAGATAAATGAAAA
AAGTTTTGTGGTTTATTTTACATTAAAAAAATATTTTTTGAGTTTATTAT
TTTTATCCTTTTTATTTTCACTATGTATTTGAATAGTTAAAAAAATCTTT
TCATTTTTAGAAACTTCGCAAAAATGAAAGATTTCCTAAAAATCAAGGCA
TTTATTGATGTAACAATTGCTCCAACTATCAGGGATGGTTGTCGCCAGTT
GTCACTTTTATGTGGTCTTGGTGGATTAACCATCAATACAGTTTGCATAG
GATTTAGGGATGATAGTGAACCTAAAGTTGCTCTTTTGCTATCATAATTA
TTACGCAAAATTTCTTTAGGACATTCTGAAAAAAATTTTTAATCAATCTA
ACAAATGTAATCCACACCAGTTTATTAGGGCTAGAAATAATTCATTATTC
GCTGGTGATGTTCAATCTTTTACCAATCAATCTTCTGAATCGTTTGATAA
AAGTAAAATAGTTCAACAGAGCGCATCACGAATCGATAATGAAAATACAA
ATTTGATATCCAAAGGGAAAAACAAGATCTTTAACCTTCTAAAATCTCCC
GTTGATCCAGAATTCATTGATAAATTGCCACCAATCAGAAGAACTAGACA
CGCAACATACGGCACAATAAATGCTAATTCTGACCATCAACAACAGGCAG
ACGAAGTCGTAGAATGTAATCATATCAACAATGATCAGGTATCGGAGGTA
GAATACGTGGGAATAATTGCCGATTGCATGAAGATGCAGAAAAATATTTG
TTTGTGCCGACATTTTGAGAATATGGATTTGATTGGGTTGAAGGCAAGCA
ATTCCTCTGAGTGTCAATACATTGATGTGTGGCCAATAAACTTTTTCCAG
CCTGGCAGTGGCAGCTATCTGGACAATACATGCATGTTCATGCTTCAGTT
GAGTTGCATCTTGAATATGAGCTCACAATGGAGCTCAAAATGCAAGATTC
GAGTGTATATATGTTTGGATTATTACACAATTGGAACTAACAGAAAGAAC
GTTCAGGAACTCTGGAATGAACTTCTGATTCAATGGCGAATACAAGCGGA
AATCAAGACGGTTGGATGGGACGACATTACAATGAACTTGGAGACAAATT
TGGGTAGGAAAATTATGTCTAACAATGCGATGTCGGACGAAATAAAAACA
ATATCATTGTTCGATTGTACCTTACCGGATACGTATGTGAAGGAGGTGAA
TAATTTAATTAAACTTCATACCTCACTAAATACTGCCGTCTGCTTTTTTT
ATCTTCCAATTATACCAAATATCACCAAGTCACAGTTTTGGAGGAAATAT
ATAAATCAACTAACTTTGCTGACCAATGATCTGCCACCTTCCGTTTTCGT
GAGGGGACTACATGAAGTCATTACGTCAGCGTTGTGATTACGAAATGTTA
TTGAATTTATTTGATCGTTGTTGATTCTCTGCTATATTATATCTTTTACG
ATTACTATTATGATTATTATTATTATTGTGATATAAATCTAATAATTATT
TTA
back to top

protein sequence of SMED30001706-orf-1

>SMED30001706-orf-1 ID=SMED30001706-orf-1|Name=SMED30001706-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=198bp
MEFCKDNKYTNTILNHSIGYMYIVDLKYPEELHDKTQYFPFSPRKVKVQE
ESLSQWQKENNHYGYKSTEKLIQFQNDLKEYVIEGRCLNWYLVNGMVLEK
LHKKIMSNKSYWLKPYIELNIKKRTGAKQEEDKFGDIFYKLLNNAFYGKT
LENVRNRQSIEIVGTKEKLKSIAAKAGYQRMKIFSEECDTVHFKKIL*
back to top

protein sequence of SMED30001706-orf-2

>SMED30001706-orf-2 ID=SMED30001706-orf-2|Name=SMED30001706-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=311bp
MCFYRNKELVNDKVIDHDHYLEKENYSGASHADCNLKTKNNLVPIYFLNG
TGYDNHLIFLPLAPNITKIIPSTDEKYISFSVGYLRFLDSYKMMPLPLEY
LASLLKPEDLKIFNKFYPEFNLKIRKGIYPYEYMSGKNYEDIEQKLSESQ
LPEISKFYNHLKTYKLSEVDYKYAQESWELLDCKNMEEYTIHYLNMDVFL
LADLFENFRNVCLENFGIDPRYCYSQSGLTWVNGMKFTQVKLKNFNKKSY
DQLLMIEKGVKGGFSGVLGDRLEEVNERKGIPSTILMPTHCIQHQWLMNS
QQGNGILQGQ*
back to top

protein sequence of SMED30001706-orf-3

>SMED30001706-orf-3 ID=SMED30001706-orf-3|Name=SMED30001706-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=220bp
MKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDN
TCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELL
IQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLP
DTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTN
DLPPSVFVRGLHEVITSAL*
back to top

protein sequence of SMED30001706-orf-4

>SMED30001706-orf-4 ID=SMED30001706-orf-4|Name=SMED30001706-orf-4|organism=Schmidtea mediterranea sexual|type=polypeptide|length=108bp
LLLLGEKIQILNPSSKLLNYMGYPNSQQRWRKKLRIERIKREQKEEKEIK
NNYETIKMYFTSPVSVIVKKDQIPTEILSIIEHLTNRIYNEQLQGVVGYL
TELQVVV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR012337RNaseH-like_sf
IPR004868DNA-dir_DNA_pol_B_mt/vir
IPR015299Gamete_antigen_PLAspp
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003887DNA-directed DNA polymerase activity
GO:0003677DNA binding
GO:0000166nucleotide binding
GO:00084083'-5' exonuclease activity
GO:0005215transporter activity
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0006810transport
GO:0006811ion transport
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane