60S ribosomal protein L7a

Overview
Name60S ribosomal protein L7a
Smed IDSMED30001701
Length (bp)930
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 60S ribosomal protein L7a (SMED30001701) t-SNE clustered cells

Violin plots show distribution of expression levels for 60S ribosomal protein L7a (SMED30001701) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 60S ribosomal protein L7a (SMED30001701) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 60S ribosomal protein L7a (SMED30001701) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001701

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30001701SMESG000020535.1 SmedASXL_018688SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30001701SMESG000020535.1 dd_Smed_v4_296_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30001701SMESG000020535.1 dd_Smed_v4_296_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30001701SMESG000020535.1 dd_Smed_v4_296_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30001701SMESG000020535.1 dd_Smed_v4_296_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001701SMESG000020535.1 dd_Smed_v4_296_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001701SMESG000020535.1 dd_Smed_v4_296_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001701SMESG000020535.1 dd_Smed_v4_296_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001701SMESG000020535.1 dd_Smed_v4_296_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30001701SMESG000020535.1 dd_Smed_v4_296_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001701SMESG000020535.1 dd_Smed_v4_296_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30001701SMESG000020535.1 dd_Smed_v4_296_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30001701SMESG000020535.1 dd_Smed_v4_296_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30001701SMESG000020535.1 dd_Smed_v6_296_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
progenitor cellSMED30001701SMESG000020535.1 dd_Smed_v6_296_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001701SMESG000020535.1 dd_Smed_v6_296_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 60S ribosomal protein L7a vs. Ensembl Human
Match: RPL7A (ribosomal protein L7a [Source:HGNC Symbol;Acc:HGNC:10364])

HSP 1 Score: 313.923 bits (803), Expect = 5.620e-107
Identity = 150/239 (62.76%), Postives = 185/239 (77.41%), Query Frame = 2
Query:  176 VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            VNPLFE RPKNF IGQDIQPKRDLTRFVKWP+Y+RLQRQ++IL KRLK+P  INQF  A+D+  A  ++KL  KYRPE+KQEK  RL  RA ++  GK +    +P ++R GV  +TTLVE KKAQ+VVIAHDVDPIE+V+ LPALCRKMGVPYCI+KGKA LG++V +KTC+ VA   V SEDK  L KL E + TN+N+R DEIR+H GG ++G KS A+I KL+K + +E A KLG
Sbjct:   28 VNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTVAFTQVNSEDKGALAKLVEAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLEKAKAKELATKLG 266          
BLAST of 60S ribosomal protein L7a vs. Ensembl Human
Match: RPL7A (ribosomal protein L7a [Source:HGNC Symbol;Acc:HGNC:10364])

HSP 1 Score: 313.923 bits (803), Expect = 5.620e-107
Identity = 150/239 (62.76%), Postives = 185/239 (77.41%), Query Frame = 2
Query:  176 VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            VNPLFE RPKNF IGQDIQPKRDLTRFVKWP+Y+RLQRQ++IL KRLK+P  INQF  A+D+  A  ++KL  KYRPE+KQEK  RL  RA ++  GK +    +P ++R GV  +TTLVE KKAQ+VVIAHDVDPIE+V+ LPALCRKMGVPYCI+KGKA LG++V +KTC+ VA   V SEDK  L KL E + TN+N+R DEIR+H GG ++G KS A+I KL+K + +E A KLG
Sbjct:   28 VNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTVAFTQVNSEDKGALAKLVEAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLEKAKAKELATKLG 266          
BLAST of 60S ribosomal protein L7a vs. Ensembl Human
Match: RPL7A (ribosomal protein L7a [Source:HGNC Symbol;Acc:HGNC:10364])

HSP 1 Score: 187.578 bits (475), Expect = 1.861e-58
Identity = 89/137 (64.96%), Postives = 107/137 (78.10%), Query Frame = 2
Query:  176 VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPI 586
            VNPLFE RPKNF IGQDIQPKRDLTRFVKWP+Y+RLQRQ++IL KRLK+P  INQF  A+D+  A  ++KL  KYRPE+KQEK  RL  RA ++  GK +    +P ++R GV  +TTLVE KKAQ+VVIAHDVDPI
Sbjct:   55 VNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTVTTLVENKKAQLVVIAHDVDPI 191          
BLAST of 60S ribosomal protein L7a vs. Ensembl Human
Match: RPL7A (ribosomal protein L7a [Source:HGNC Symbol;Acc:HGNC:10364])

HSP 1 Score: 187.578 bits (475), Expect = 1.861e-58
Identity = 89/137 (64.96%), Postives = 107/137 (78.10%), Query Frame = 2
Query:  176 VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPI 586
            VNPLFE RPKNF IGQDIQPKRDLTRFVKWP+Y+RLQRQ++IL KRLK+P  INQF  A+D+  A  ++KL  KYRPE+KQEK  RL  RA ++  GK +    +P ++R GV  +TTLVE KKAQ+VVIAHDVDPI
Sbjct:   55 VNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTVTTLVENKKAQLVVIAHDVDPI 191          
BLAST of 60S ribosomal protein L7a vs. Ensembl Human
Match: RPL7A (ribosomal protein L7a [Source:HGNC Symbol;Acc:HGNC:10364])

HSP 1 Score: 177.178 bits (448), Expect = 5.538e-55
Identity = 86/143 (60.14%), Postives = 109/143 (76.22%), Query Frame = 2
Query:  464 GKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            GK +    +P ++R GV  +TTLVE KKAQ+VVIAHDVDPIE+V+ LPALCRKMGVPYCI+KGKA LG++V +KTC+ VA   V SEDK  L KL E + TN+N+R DEIR+H GG ++G KS A+I KL+K + +E A KLG
Sbjct:    9 GKGDVPTKRPPVLRAGVNTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTVAFTQVNSEDKGALAKLVEAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLEKAKAKELATKLG 151          
BLAST of 60S ribosomal protein L7a vs. Ensembl Celegans
Match: rpl-7A (60S ribosomal protein L7a [Source:UniProtKB/Swiss-Prot;Acc:Q966C6])

HSP 1 Score: 283.108 bits (723), Expect = 2.347e-95
Identity = 141/232 (60.78%), Postives = 176/232 (75.86%), Query Frame = 2
Query:  179 NPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERE 874
            NPLFE R +NF IGQDIQPK+D+TRFVKWPKY+RLQRQ +IL KRLK+P  INQF  A+D  +A+   KLL KYRPES + K  RL+ RA  R  GK E V  +P  +R+GV  IT LVE ++AQ+V+IAHDV+P+EIVLHLPALCRK  VPY I+KGKA LG +VR+KT +AVALV+V  EDK+ LNKL E +  NF+ R +EIRKH GGG+M  KS AK LK+++ + R+
Sbjct:   30 NPLFEKRARNFNIGQDIQPKKDVTRFVKWPKYIRLQRQSAILQKRLKVPPTINQFRTALDSQSARQAFKLLDKYRPESTEAKKNRLRARAEARAAGKKEEVTKRPNTVRHGVNTITRLVETRRAQLVLIAHDVNPLEIVLHLPALCRKYNVPYAIIKGKASLGTVVRRKTTAAVALVDVNPEDKSALNKLVETVNNNFSERHEEIRKHWGGGVMSAKSDAKKLKIERARARD 261          
BLAST of 60S ribosomal protein L7a vs. Ensembl Celegans
Match: rpl-7A (60S ribosomal protein L7a [Source:UniProtKB/Swiss-Prot;Acc:Q966C6])

HSP 1 Score: 270.781 bits (691), Expect = 7.689e-91
Identity = 132/232 (56.90%), Postives = 166/232 (71.55%), Query Frame = 2
Query:  179 NPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERE 874
            NPLFE R +NF IGQDIQPK+D+TRFVKWPKY+RLQRQ +IL KRLK+P  INQF  A+D  +A+   KLL KYRPES +                    V  +P  +R+GV  IT LVE ++AQ+V+IAHDV+P+EIVLHLPALCRK  VPY I+KGKA LG +VR+KT +AVALV+V  EDK+ LNKL E +  NF+ R +EIRKH GGG+M  KS AK LK+++ + R+
Sbjct:   30 NPLFEKRARNFNIGQDIQPKKDVTRFVKWPKYIRLQRQSAILQKRLKVPPTINQFRTALDSQSARQAFKLLDKYRPESTE--------------------VTKRPNTVRHGVNTITRLVETRRAQLVLIAHDVNPLEIVLHLPALCRKYNVPYAIIKGKASLGTVVRRKTTAAVALVDVNPEDKSALNKLVETVNNNFSERHEEIRKHWGGGVMSAKSDAKKLKIERARARD 241          
BLAST of 60S ribosomal protein L7a vs. Ensembl Celegans
Match: Y73B3A.18 (pep chromosome:WBcel235:X:48483:60752:1 gene:WBGene00022219.1 transcript:Y73B3A.18a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y73B3A.18)

HSP 1 Score: 120.168 bits (300), Expect = 2.602e-32
Identity = 64/101 (63.37%), Postives = 75/101 (74.26%), Query Frame = 2
Query:  179 NPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETV 481
            NPLFE R +NF IGQDIQPK+D+TRFVKWPKY+RLQRQ +IL KRLK+P  INQF  A+D  +A+   KLL KYRPES + K  RL+ RA  R  GK E V
Sbjct:  133 NPLFEKRARNFNIGQDIQPKKDVTRFVKWPKYIRLQRQSAILQKRLKVPPTINQFRTALDSHSARQAFKLLDKYRPESSEAKKNRLRARAEARAAGKKEEV 233          
BLAST of 60S ribosomal protein L7a vs. Ensembl Celegans
Match: Y73B3A.18 (pep chromosome:WBcel235:X:48483:60774:1 gene:WBGene00022219.1 transcript:Y73B3A.18b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y73B3A.18)

HSP 1 Score: 98.9821 bits (245), Expect = 9.119e-25
Identity = 44/60 (73.33%), Postives = 51/60 (85.00%), Query Frame = 2
Query:  179 NPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAID 358
            NPLFE R +NF IGQDIQPK+D+TRFVKWPKY+RLQRQ +IL KRLK+P  INQF  A+D
Sbjct:  133 NPLFEKRARNFNIGQDIQPKKDVTRFVKWPKYIRLQRQSAILQKRLKVPPTINQFRTALD 192          
BLAST of 60S ribosomal protein L7a vs. Ensembl Fly
Match: RpL7A (gene:FBgn0014026 transcript:FBtr0345293)

HSP 1 Score: 285.419 bits (729), Expect = 5.282e-96
Identity = 139/238 (58.40%), Postives = 178/238 (74.79%), Query Frame = 2
Query:  179 NPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            N LFE RPKNF IGQ++QPKRDL+RFV+WPKY+R+QRQK++L KRLK+P  I+QF+  +DK  A  + KLL KYRPES   K  RLK  A  + +GK    + KP+ +  G   +T L+EQKKAQ+VVIAHDVDP+E+VL LPALCRKMGVPYCI+KGKA LG++VR+KTC+ +AL  V + DKA   K+ E + TNFN R +EIR+H GGGI+G KS A+I KL++ + RE A K G
Sbjct:   34 NQLFEKRPKNFGIGQNVQPKRDLSRFVRWPKYIRVQRQKAVLQKRLKVPPPIHQFSQTLDKTTAVKLFKLLEKYRPESPLAKKLRLKKIAEAKAKGKDVEPKKKPSYVSAGTNTVTKLIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARLGRLVRRKTCTTLALTTVDNNDKANFGKVLEAVKTNFNERHEEIRRHWGGGILGSKSLARISKLERAKARELAQKQG 271          
BLAST of 60S ribosomal protein L7a vs. Ensembl Fly
Match: RpL7A (gene:FBgn0014026 transcript:FBtr0070916)

HSP 1 Score: 285.419 bits (729), Expect = 5.282e-96
Identity = 139/238 (58.40%), Postives = 178/238 (74.79%), Query Frame = 2
Query:  179 NPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            N LFE RPKNF IGQ++QPKRDL+RFV+WPKY+R+QRQK++L KRLK+P  I+QF+  +DK  A  + KLL KYRPES   K  RLK  A  + +GK    + KP+ +  G   +T L+EQKKAQ+VVIAHDVDP+E+VL LPALCRKMGVPYCI+KGKA LG++VR+KTC+ +AL  V + DKA   K+ E + TNFN R +EIR+H GGGI+G KS A+I KL++ + RE A K G
Sbjct:   34 NQLFEKRPKNFGIGQNVQPKRDLSRFVRWPKYIRVQRQKAVLQKRLKVPPPIHQFSQTLDKTTAVKLFKLLEKYRPESPLAKKLRLKKIAEAKAKGKDVEPKKKPSYVSAGTNTVTKLIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARLGRLVRRKTCTTLALTTVDNNDKANFGKVLEAVKTNFNERHEEIRRHWGGGILGSKSLARISKLERAKARELAQKQG 271          
BLAST of 60S ribosomal protein L7a vs. Ensembl Fly
Match: RpL7A (gene:FBgn0014026 transcript:FBtr0343329)

HSP 1 Score: 285.419 bits (729), Expect = 5.282e-96
Identity = 139/238 (58.40%), Postives = 178/238 (74.79%), Query Frame = 2
Query:  179 NPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            N LFE RPKNF IGQ++QPKRDL+RFV+WPKY+R+QRQK++L KRLK+P  I+QF+  +DK  A  + KLL KYRPES   K  RLK  A  + +GK    + KP+ +  G   +T L+EQKKAQ+VVIAHDVDP+E+VL LPALCRKMGVPYCI+KGKA LG++VR+KTC+ +AL  V + DKA   K+ E + TNFN R +EIR+H GGGI+G KS A+I KL++ + RE A K G
Sbjct:   34 NQLFEKRPKNFGIGQNVQPKRDLSRFVRWPKYIRVQRQKAVLQKRLKVPPPIHQFSQTLDKTTAVKLFKLLEKYRPESPLAKKLRLKKIAEAKAKGKDVEPKKKPSYVSAGTNTVTKLIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARLGRLVRRKTCTTLALTTVDNNDKANFGKVLEAVKTNFNERHEEIRRHWGGGILGSKSLARISKLERAKARELAQKQG 271          
BLAST of 60S ribosomal protein L7a vs. Ensembl Fly
Match: RpL7A (gene:FBgn0014026 transcript:FBtr0343328)

HSP 1 Score: 285.419 bits (729), Expect = 5.282e-96
Identity = 139/238 (58.40%), Postives = 178/238 (74.79%), Query Frame = 2
Query:  179 NPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            N LFE RPKNF IGQ++QPKRDL+RFV+WPKY+R+QRQK++L KRLK+P  I+QF+  +DK  A  + KLL KYRPES   K  RLK  A  + +GK    + KP+ +  G   +T L+EQKKAQ+VVIAHDVDP+E+VL LPALCRKMGVPYCI+KGKA LG++VR+KTC+ +AL  V + DKA   K+ E + TNFN R +EIR+H GGGI+G KS A+I KL++ + RE A K G
Sbjct:   34 NQLFEKRPKNFGIGQNVQPKRDLSRFVRWPKYIRVQRQKAVLQKRLKVPPPIHQFSQTLDKTTAVKLFKLLEKYRPESPLAKKLRLKKIAEAKAKGKDVEPKKKPSYVSAGTNTVTKLIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARLGRLVRRKTCTTLALTTVDNNDKANFGKVLEAVKTNFNERHEEIRRHWGGGILGSKSLARISKLERAKARELAQKQG 271          
BLAST of 60S ribosomal protein L7a vs. Ensembl Fly
Match: RpL7A (gene:FBgn0014026 transcript:FBtr0070915)

HSP 1 Score: 285.419 bits (729), Expect = 5.282e-96
Identity = 139/238 (58.40%), Postives = 178/238 (74.79%), Query Frame = 2
Query:  179 NPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            N LFE RPKNF IGQ++QPKRDL+RFV+WPKY+R+QRQK++L KRLK+P  I+QF+  +DK  A  + KLL KYRPES   K  RLK  A  + +GK    + KP+ +  G   +T L+EQKKAQ+VVIAHDVDP+E+VL LPALCRKMGVPYCI+KGKA LG++VR+KTC+ +AL  V + DKA   K+ E + TNFN R +EIR+H GGGI+G KS A+I KL++ + RE A K G
Sbjct:   34 NQLFEKRPKNFGIGQNVQPKRDLSRFVRWPKYIRVQRQKAVLQKRLKVPPPIHQFSQTLDKTTAVKLFKLLEKYRPESPLAKKLRLKKIAEAKAKGKDVEPKKKPSYVSAGTNTVTKLIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARLGRLVRRKTCTTLALTTVDNNDKANFGKVLEAVKTNFNERHEEIRRHWGGGILGSKSLARISKLERAKARELAQKQG 271          
BLAST of 60S ribosomal protein L7a vs. Ensembl Zebrafish
Match: rpl7a (ribosomal protein L7a [Source:ZFIN;Acc:ZDB-GENE-031001-9])

HSP 1 Score: 311.997 bits (798), Expect = 1.819e-106
Identity = 148/239 (61.92%), Postives = 184/239 (76.99%), Query Frame = 2
Query:  176 VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            VNPLFE RPKNF IGQDIQPKRDLTRFVKWP+YVRLQRQ++IL KRLK+P  INQF  A+D+  A  + KL  KYRPE+K EK  RL  RA ++  GK +T   +P ++R GV  +TTLVE KKAQ+VVIAHDVDPIE+V+ LPALCRKMGVPYCI+KGKA LG++V +KTC+++A      EDKA L KL E + TN+N+R +EIR+H GG ++G KS A+I KL+K + +E A KLG
Sbjct:   28 VNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYVRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLFKLAHKYRPETKHEKKQRLLARAEQKAAGKGDTPTKRPPVLRAGVNTVTTLVESKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIVKGKARLGRLVHRKTCTSIAFTQTNPEDKAALAKLVEAIKTNYNDRYEEIRRHWGGNVLGPKSTARIAKLEKAKAKELATKLG 266          
BLAST of 60S ribosomal protein L7a vs. Ensembl Zebrafish
Match: rpl7a (ribosomal protein L7a [Source:ZFIN;Acc:ZDB-GENE-031001-9])

HSP 1 Score: 311.997 bits (798), Expect = 2.029e-106
Identity = 148/239 (61.92%), Postives = 184/239 (76.99%), Query Frame = 2
Query:  176 VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            VNPLFE RPKNF IGQDIQPKRDLTRFVKWP+YVRLQRQ++IL KRLK+P  INQF  A+D+  A  + KL  KYRPE+K EK  RL  RA ++  GK +T   +P ++R GV  +TTLVE KKAQ+VVIAHDVDPIE+V+ LPALCRKMGVPYCI+KGKA LG++V +KTC+++A      EDKA L KL E + TN+N+R +EIR+H GG ++G KS A+I KL+K + +E A KLG
Sbjct:   28 VNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYVRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLFKLAHKYRPETKHEKKQRLLARAEQKAAGKGDTPTKRPPVLRAGVNTVTTLVESKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIVKGKARLGRLVHRKTCTSIAFTQTNPEDKAALAKLVEAIKTNYNDRYEEIRRHWGGNVLGPKSTARIAKLEKAKAKELATKLG 266          
BLAST of 60S ribosomal protein L7a vs. Ensembl Zebrafish
Match: snu13a (SNU13 homolog, small nuclear ribonucleoprotein a (U4/U6.U5) [Source:ZFIN;Acc:ZDB-GENE-040426-879])

HSP 1 Score: 51.9878 bits (123), Expect = 4.356e-8
Identity = 22/57 (38.60%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  500 IRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQ 670
            +R G  E T  + +  ++ +V+A D +P+EI+LHLP LC    VPY  ++ K  LG+
Sbjct:   35 LRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGR 91          
BLAST of 60S ribosomal protein L7a vs. Ensembl Zebrafish
Match: snu13b (SNU13 homolog, small nuclear ribonucleoprotein b (U4/U6.U5) [Source:ZFIN;Acc:ZDB-GENE-030131-9670])

HSP 1 Score: 51.9878 bits (123), Expect = 4.356e-8
Identity = 22/57 (38.60%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  500 IRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQ 670
            +R G  E T  + +  ++ +V+A D +P+EI+LHLP LC    VPY  ++ K  LG+
Sbjct:   35 LRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGR 91          
BLAST of 60S ribosomal protein L7a vs. Ensembl Zebrafish
Match: nhp2 (NHP2 ribonucleoprotein homolog (yeast) [Source:NCBI gene;Acc:100003787])

HSP 1 Score: 49.6766 bits (117), Expect = 4.102e-7
Identity = 25/85 (29.41%), Postives = 41/85 (48.24%), Query Frame = 2
Query:  500 IRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTE 754
            IR GV+E+   + + +  +VV A D  PI++  HLP +C    +PY  +  K  LG     K  + V ++    E K   ++  E
Sbjct:   57 IRRGVKEVQKFINKGETGIVVFAGDTLPIDVYCHLPIMCEDRSLPYAYVPSKVDLGSSAGSKRPTCVIMIKPHDEYKEAYDECVE 141          
BLAST of 60S ribosomal protein L7a vs. Ensembl Xenopus
Match: rpl7a (ribosomal protein L7a [Source:NCBI gene;Acc:447981])

HSP 1 Score: 316.235 bits (809), Expect = 7.362e-108
Identity = 153/239 (64.02%), Postives = 186/239 (77.82%), Query Frame = 2
Query:  176 VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            VNPLFE RPKNF IGQDIQPKRDLTRFVKWP+Y+RLQRQK+IL KRLK+P  INQF  A+D+  A  + KL  KYRPE+KQEK  RL  RA ++  GK +    +P ++R GV  +TTLVE KKAQ+VVIAHDVDPIE+V+ LPALCRKMGVPYCI+KGKA LG++V +KTC++VAL  V  EDK  L KL E + TN+N+R DEIR+H GGGI+G KS A+I KL+K + +E A KLG
Sbjct:   35 VNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQKAILYKRLKVPPAINQFTQALDRQTATQLFKLAHKYRPETKQEKKKRLLARAEQKAAGKGDVPTKRPPVLRAGVNTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIVKGKARLGRLVHRKTCTSVALTQVNPEDKGALAKLVEAVKTNYNDRFDEIRRHWGGGILGPKSVARIAKLEKAKAKELATKLG 273          
BLAST of 60S ribosomal protein L7a vs. Ensembl Xenopus
Match: snu13 (small nuclear ribonucleoprotein 13 [Source:NCBI gene;Acc:394590])

HSP 1 Score: 52.7582 bits (125), Expect = 3.076e-8
Identity = 23/56 (41.07%), Postives = 34/56 (60.71%), Query Frame = 2
Query:  500 IRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILG 667
            +R G  E T  + +  A+ +V+A D +P+EI+LHLP LC    VPY  ++ K  LG
Sbjct:   35 LRKGANEATKTLNRGIAEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALG 90          
BLAST of 60S ribosomal protein L7a vs. Ensembl Xenopus
Match: nhp2 (NHP2 ribonucleoprotein [Source:NCBI gene;Acc:394586])

HSP 1 Score: 52.373 bits (124), Expect = 7.859e-8
Identity = 24/70 (34.29%), Postives = 39/70 (55.71%), Query Frame = 2
Query:  500 IRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALV 709
            IR GV+E+   + + +  +VV+A D  PIE+  H+P +C   G+PY  +  K+ LG     K  + V L+
Sbjct:   56 IRRGVKEVQKFINKGEKGIVVMAGDTLPIEVYCHIPVMCEDRGIPYSYVPSKSDLGAAAGSKRPTCVILI 125          
BLAST of 60S ribosomal protein L7a vs. Ensembl Mouse
Match: Rpl7a (ribosomal protein L7A [Source:MGI Symbol;Acc:MGI:1353472])

HSP 1 Score: 313.923 bits (803), Expect = 3.574e-107
Identity = 150/239 (62.76%), Postives = 184/239 (76.99%), Query Frame = 2
Query:  176 VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            VNPLFE RPKNF IGQDIQPKRDLTRFVKWP+Y+RLQRQ++IL KRLK+P  INQF  A+D+  A  ++KL  KYRPE+KQEK  RL  RA ++  GK +    +P ++R GV  +TTLVE KKAQ+VVIAHDVDPIE+V+ LPALCRKMGVPYCI+KGKA LG +V +KTC+ VA   V SEDK  L KL E + TN+N+R DEIR+H GG ++G KS A+I KL+K + +E A KLG
Sbjct:   28 VNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGHLVHRKTCTTVAFTQVNSEDKGALAKLVEAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLEKAKAKELATKLG 266          
BLAST of 60S ribosomal protein L7a vs. Ensembl Mouse
Match: Gm14214 (predicted gene 14214 [Source:MGI Symbol;Acc:MGI:3649357])

HSP 1 Score: 252.677 bits (644), Expect = 1.096e-83
Identity = 128/230 (55.65%), Postives = 162/230 (70.43%), Query Frame = 2
Query:  203 KNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            KNF IGQDIQPKRDLT FVKWP Y+ LQ+Q++IL K+L +P  INQF  A+D+  A  ++KL        KQEK  RL  RA ++  GK +    +P ++R GV   TTLVE KKAQ+VVIAHDVDP E V+ LPALCRKMGVPYCI+KGKA LG +V +KT + VA   V SEDK  L KL E + TN+N+R D+IR H GG ++G KS A++ KL+K++ +E A KLG
Sbjct:    2 KNFGIGQDIQPKRDLTHFVKWPCYINLQQQRAILYKQLGVPPAINQFTQALDRQTATQLLKL------AHKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTNTTLVENKKAQLVVIAHDVDPSEPVVFLPALCRKMGVPYCIIKGKARLGHLVHRKTFTTVAFTQVNSEDKGALAKLVESIRTNYNDRYDKIRHHWGGNVLGSKSVARVAKLEKVKAKELATKLG 225          
BLAST of 60S ribosomal protein L7a vs. Ensembl Mouse
Match: Snu13 (SNU13 homolog, small nuclear ribonucleoprotein (U4/U6.U5) [Source:MGI Symbol;Acc:MGI:893586])

HSP 1 Score: 51.2174 bits (121), Expect = 7.802e-8
Identity = 22/57 (38.60%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  500 IRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQ 670
            +R G  E T  + +  ++ +V+A D +P+EI+LHLP LC    VPY  ++ K  LG+
Sbjct:   35 LRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGR 91          
BLAST of 60S ribosomal protein L7a vs. Ensembl Mouse
Match: Nhp2 (NHP2 ribonucleoprotein [Source:MGI Symbol;Acc:MGI:1098547])

HSP 1 Score: 51.2174 bits (121), Expect = 1.568e-7
Identity = 28/85 (32.94%), Postives = 42/85 (49.41%), Query Frame = 2
Query:  500 IRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTE 754
            IR GV+E+   V + +  ++V+A D  PIE+  HLP LC    +PY  +  K  LG     K  + V +V    E +   +K  E
Sbjct:   60 IRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVLCEDQNLPYVYIPSKTDLGAATGSKRPTCVIMVKPHEEYQETYDKCLE 144          
BLAST of 60S ribosomal protein L7a vs. UniProt/SwissProt
Match: sp|Q2TBQ5|RL7A_BOVIN (60S ribosomal protein L7a OS=Bos taurus OX=9913 GN=RPL7A PE=2 SV=3)

HSP 1 Score: 314.309 bits (804), Expect = 1.802e-106
Identity = 150/239 (62.76%), Postives = 186/239 (77.82%), Query Frame = 2
Query:  176 VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            VNPLFE RPKNF IGQDIQPKRDLTRFVKWP+Y+RLQRQ++IL KRLK+P  INQF  A+D+  A  ++KL  KYRPE+KQEK  RL  RA ++  GK +    +P ++R GV  +TTLVE KKAQ+VVIAHDVDPIE+V+ LPALCRKMGVPYCI+KGKA LG++V +KTC+ VA   V SEDK+ L KL E + TN+N+R DEIR+H GG ++G KS A+I KL+K + +E A KLG
Sbjct:   28 VNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTVAFTQVNSEDKSALAKLVEAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLEKAKAKELATKLG 266          
BLAST of 60S ribosomal protein L7a vs. UniProt/SwissProt
Match: sp|P12970|RL7A_MOUSE (60S ribosomal protein L7a OS=Mus musculus OX=10090 GN=Rpl7a PE=1 SV=2)

HSP 1 Score: 313.923 bits (803), Expect = 2.500e-106
Identity = 150/239 (62.76%), Postives = 184/239 (76.99%), Query Frame = 2
Query:  176 VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            VNPLFE RPKNF IGQDIQPKRDLTRFVKWP+Y+RLQRQ++IL KRLK+P  INQF  A+D+  A  ++KL  KYRPE+KQEK  RL  RA ++  GK +    +P ++R GV  +TTLVE KKAQ+VVIAHDVDPIE+V+ LPALCRKMGVPYCI+KGKA LG +V +KTC+ VA   V SEDK  L KL E + TN+N+R DEIR+H GG ++G KS A+I KL+K + +E A KLG
Sbjct:   28 VNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGHLVHRKTCTTVAFTQVNSEDKGALAKLVEAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLEKAKAKELATKLG 266          
BLAST of 60S ribosomal protein L7a vs. UniProt/SwissProt
Match: sp|P62425|RL7A_RAT (60S ribosomal protein L7a OS=Rattus norvegicus OX=10116 GN=Rpl7a PE=1 SV=2)

HSP 1 Score: 313.923 bits (803), Expect = 2.699e-106
Identity = 150/239 (62.76%), Postives = 185/239 (77.41%), Query Frame = 2
Query:  176 VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            VNPLFE RPKNF IGQDIQPKRDLTRFVKWP+Y+RLQRQ++IL KRLK+P  INQF  A+D+  A  ++KL  KYRPE+KQEK  RL  RA ++  GK +    +P ++R GV  +TTLVE KKAQ+VVIAHDVDPIE+V+ LPALCRKMGVPYCI+KGKA LG++V +KTC+ VA   V SEDK  L KL E + TN+N+R DEIR+H GG ++G KS A+I KL+K + +E A KLG
Sbjct:   28 VNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTVAFTQVNSEDKGALAKLVEAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLEKAKAKELATKLG 266          
BLAST of 60S ribosomal protein L7a vs. UniProt/SwissProt
Match: sp|Q4R5C2|RL7A_MACFA (60S ribosomal protein L7a OS=Macaca fascicularis OX=9541 GN=RPL7A PE=2 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 2.699e-106
Identity = 150/239 (62.76%), Postives = 185/239 (77.41%), Query Frame = 2
Query:  176 VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            VNPLFE RPKNF IGQDIQPKRDLTRFVKWP+Y+RLQRQ++IL KRLK+P  INQF  A+D+  A  ++KL  KYRPE+KQEK  RL  RA ++  GK +    +P ++R GV  +TTLVE KKAQ+VVIAHDVDPIE+V+ LPALCRKMGVPYCI+KGKA LG++V +KTC+ VA   V SEDK  L KL E + TN+N+R DEIR+H GG ++G KS A+I KL+K + +E A KLG
Sbjct:   28 VNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTVAFTQVNSEDKGALAKLVEAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLEKAKAKELATKLG 266          
BLAST of 60S ribosomal protein L7a vs. UniProt/SwissProt
Match: sp|P62424|RL7A_HUMAN (60S ribosomal protein L7a OS=Homo sapiens OX=9606 GN=RPL7A PE=1 SV=2)

HSP 1 Score: 313.923 bits (803), Expect = 2.699e-106
Identity = 150/239 (62.76%), Postives = 185/239 (77.41%), Query Frame = 2
Query:  176 VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            VNPLFE RPKNF IGQDIQPKRDLTRFVKWP+Y+RLQRQ++IL KRLK+P  INQF  A+D+  A  ++KL  KYRPE+KQEK  RL  RA ++  GK +    +P ++R GV  +TTLVE KKAQ+VVIAHDVDPIE+V+ LPALCRKMGVPYCI+KGKA LG++V +KTC+ VA   V SEDK  L KL E + TN+N+R DEIR+H GG ++G KS A+I KL+K + +E A KLG
Sbjct:   28 VNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTVAFTQVNSEDKGALAKLVEAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLEKAKAKELATKLG 266          
BLAST of 60S ribosomal protein L7a vs. TrEMBL
Match: E9LR67 (60S ribosomal L7a-like protein OS=Phragmatopoma lapidosa OX=341668 PE=2 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 1.679e-109
Identity = 152/239 (63.60%), Postives = 193/239 (80.75%), Query Frame = 2
Query:  176 VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
             NPLFE RPKNF IGQDIQPKRDL+RFV+WPKY+RLQRQK+IL +RLK+P  INQF  A+D+  A  + +LL KYRPESKQEK +RLK RA ER +GKP+    +P ++R GV  +TTL+EQKKAQ+V+IAHDVDPIEIVL +PALCRKMGVPYCI+KGKA LG++VR+KT + +AL  V SED++ L+KL + + TNFN+R DEIR+H GGG+MG KS AK+ KL+K + +E A ++G
Sbjct:   27 ANPLFEKRPKNFRIGQDIQPKRDLSRFVRWPKYIRLQRQKAILYQRLKVPPPINQFTQAVDRQTASQLFRLLEKYRPESKQEKASRLKARAEERTKGKPDAPTKRPPVVRSGVNTVTTLIEQKKAQLVIIAHDVDPIEIVLFMPALCRKMGVPYCIVKGKARLGRVVRRKTATCLALTTVNSEDRSSLSKLVDSVKTNFNDRVDEIRRHWGGGVMGSKSLAKVAKLEKAKAKELAQRMG 265          
BLAST of 60S ribosomal protein L7a vs. TrEMBL
Match: A0A1S3KA42 (60S ribosomal protein L7a OS=Lingula unguis OX=7574 GN=LOC106179865 PE=4 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 1.032e-107
Identity = 151/239 (63.18%), Postives = 192/239 (80.33%), Query Frame = 2
Query:  176 VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            VNPLFE R KNF IGQDIQPKRDL+RFV+WPKY+RLQRQK+IL +RLK+P  INQF  A+D+  A  + +L+ KYRPE+KQ++  RL+ RA ERV+GK +T   +P ++R GV  +TTL+EQKKAQ+VVIAHDV+PIEIVL LPALCRKM VPYCI+KGKA LG++V +KTCS +AL  V  EDK+ LNKL + + TNFN RGDEIR+H GGG+MG KSQA++ K++K + +E A K+G
Sbjct:   27 VNPLFEKRAKNFGIGQDIQPKRDLSRFVRWPKYIRLQRQKAILQQRLKVPPSINQFKQALDRQTATQLFRLMDKYRPETKQQRKQRLQARAEERVKGKDDTPTKRPPVVRSGVNTVTTLIEQKKAQLVVIAHDVEPIEIVLFLPALCRKMAVPYCIVKGKARLGRVVHRKTCSCLALTLVNPEDKSALNKLIDAVKTNFNERGDEIRRHWGGGVMGAKSQARVAKIEKAKAKELAQKMG 265          
BLAST of 60S ribosomal protein L7a vs. TrEMBL
Match: A0A4W6BLZ0 (Ribosomal_L7Ae domain-containing protein OS=Lates calcarifer OX=8187 GN=RPL7A PE=4 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 1.119e-105
Identity = 151/239 (63.18%), Postives = 186/239 (77.82%), Query Frame = 2
Query:  176 VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            VNPLFE RPKNF IGQDIQPKRDLTRFVKWP+Y+RLQRQ+SIL KRLK+P  INQF  A+D+  A  + KL  KYRPE+KQEK  RL  RA ++  GK +T   +P ++R GV  +TTLVE KKAQ+V+IAHDVDPIE+V+ LPALCRKMGVPYCI+KGKA LG++V +KTC++VA   +  EDK  L KL E + TN+N+R +EIR+H GGGIMG KS A+I KL+K + +E A KLG
Sbjct:   28 VNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRSILYKRLKVPPAINQFTQALDRQTATQLFKLAHKYRPETKQEKKQRLLARAEQKAAGKGDTPTKRPPVLRAGVNTVTTLVENKKAQLVIIAHDVDPIELVVFLPALCRKMGVPYCIVKGKARLGRLVHRKTCTSVAFTQINPEDKGALAKLVEAIKTNYNDRYEEIRRHWGGGIMGPKSTARITKLEKAKAKELATKLG 266          
BLAST of 60S ribosomal protein L7a vs. TrEMBL
Match: A0A3B3QCC5 (Ribosomal_L7Ae domain-containing protein OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 1.940e-105
Identity = 151/239 (63.18%), Postives = 185/239 (77.41%), Query Frame = 2
Query:  176 VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            VNPLFE RPKNF IGQDIQPKRDLTRFVKWP+Y+RLQRQ++IL KRLK+P  INQF  A+D+  A  + KL  KYRPE+KQEK  RL  RA ++  GK +T   +P ++R GV  +TTLVE KKAQ+V IAHDVDPIE+V+ LPALCRKMGVPYCI+KGKA LG++V +KTC++VA   +  EDK  L KL E + TN+N+R DEIR+H GGGIMG KS A+I KL+K + +E A KLG
Sbjct:   31 VNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPSINQFTQALDRQTATQLFKLAHKYRPETKQEKKKRLLARAEQKAAGKGDTPSKRPPVLRAGVNTVTTLVESKKAQLVAIAHDVDPIELVVFLPALCRKMGVPYCIVKGKARLGRLVHRKTCTSVAFTQINPEDKGALAKLVEAIKTNYNDRYDEIRRHWGGGIMGPKSTARIAKLEKAKAKELATKLG 269          
BLAST of 60S ribosomal protein L7a vs. TrEMBL
Match: A0A3B3QA53 (Ribosomal_L7Ae domain-containing protein OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 2.193e-105
Identity = 151/239 (63.18%), Postives = 185/239 (77.41%), Query Frame = 2
Query:  176 VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            VNPLFE RPKNF IGQDIQPKRDLTRFVKWP+Y+RLQRQ++IL KRLK+P  INQF  A+D+  A  + KL  KYRPE+KQEK  RL  RA ++  GK +T   +P ++R GV  +TTLVE KKAQ+V IAHDVDPIE+V+ LPALCRKMGVPYCI+KGKA LG++V +KTC++VA   +  EDK  L KL E + TN+N+R DEIR+H GGGIMG KS A+I KL+K + +E A KLG
Sbjct:   33 VNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPSINQFTQALDRQTATQLFKLAHKYRPETKQEKKKRLLARAEQKAAGKGDTPSKRPPVLRAGVNTVTTLVESKKAQLVAIAHDVDPIELVVFLPALCRKMGVPYCIVKGKARLGRLVHRKTCTSVAFTQINPEDKGALAKLVEAIKTNYNDRYDEIRRHWGGGIMGPKSTARIAKLEKAKAKELATKLG 271          
BLAST of 60S ribosomal protein L7a vs. Ensembl Cavefish
Match: rpl7a (ribosomal protein L7a [Source:NCBI gene;Acc:103021457])

HSP 1 Score: 308.531 bits (789), Expect = 3.002e-105
Identity = 146/239 (61.09%), Postives = 182/239 (76.15%), Query Frame = 2
Query:  176 VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            VNPLFE RPKNF IGQDIQPKRDLTRFVKWP+Y+RLQRQ++IL KRLK+P  INQF  A+D+  A  + KL  KYRPE+KQEK  RL  RA ++  GK +    +P ++R GV  +T+LVE KKAQ+VVIAHDVDPIE+V+ LPALCRKMGVPYCI+KGKA LG++V +KTC++V       ED+A L KL E + TN+N+R +EIR+H GG IMG KS A+  KL+K + +E A KLG
Sbjct:   28 VNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLFKLAHKYRPETKQEKKRRLLARAEQKAAGKGDAPTKRPPVLRAGVNSVTSLVESKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTSVCFTQTNPEDRAALAKLVEAIKTNYNDRYEEIRRHWGGNIMGPKSTARFAKLEKTKAKELAAKLG 266          
BLAST of 60S ribosomal protein L7a vs. Ensembl Cavefish
Match: rpl7a (ribosomal protein L7a [Source:NCBI gene;Acc:103021457])

HSP 1 Score: 308.531 bits (789), Expect = 4.067e-105
Identity = 146/239 (61.09%), Postives = 182/239 (76.15%), Query Frame = 2
Query:  176 VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            VNPLFE RPKNF IGQDIQPKRDLTRFVKWP+Y+RLQRQ++IL KRLK+P  INQF  A+D+  A  + KL  KYRPE+KQEK  RL  RA ++  GK +    +P ++R GV  +T+LVE KKAQ+VVIAHDVDPIE+V+ LPALCRKMGVPYCI+KGKA LG++V +KTC++V       ED+A L KL E + TN+N+R +EIR+H GG IMG KS A+  KL+K + +E A KLG
Sbjct:   36 VNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLFKLAHKYRPETKQEKKRRLLARAEQKAAGKGDAPTKRPPVLRAGVNSVTSLVESKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTSVCFTQTNPEDRAALAKLVEAIKTNYNDRYEEIRRHWGGNIMGPKSTARFAKLEKTKAKELAAKLG 274          
BLAST of 60S ribosomal protein L7a vs. Ensembl Cavefish
Match: rpl7a (ribosomal protein L7a [Source:NCBI gene;Acc:103021457])

HSP 1 Score: 308.531 bits (789), Expect = 4.677e-105
Identity = 146/239 (61.09%), Postives = 182/239 (76.15%), Query Frame = 2
Query:  176 VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            VNPLFE RPKNF IGQDIQPKRDLTRFVKWP+Y+RLQRQ++IL KRLK+P  INQF  A+D+  A  + KL  KYRPE+KQEK  RL  RA ++  GK +    +P ++R GV  +T+LVE KKAQ+VVIAHDVDPIE+V+ LPALCRKMGVPYCI+KGKA LG++V +KTC++V       ED+A L KL E + TN+N+R +EIR+H GG IMG KS A+  KL+K + +E A KLG
Sbjct:   34 VNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLFKLAHKYRPETKQEKKRRLLARAEQKAAGKGDAPTKRPPVLRAGVNSVTSLVESKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTSVCFTQTNPEDRAALAKLVEAIKTNYNDRYEEIRRHWGGNIMGPKSTARFAKLEKTKAKELAAKLG 272          
BLAST of 60S ribosomal protein L7a vs. Ensembl Cavefish
Match: snu13a (NHP2-like protein 1 [Source:NCBI gene;Acc:103040872])

HSP 1 Score: 51.9878 bits (123), Expect = 4.190e-8
Identity = 22/57 (38.60%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  500 IRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQ 670
            +R G  E T  + +  ++ +V+A D +P+EI+LHLP LC    VPY  ++ K  LG+
Sbjct:   35 LRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGR 91          
BLAST of 60S ribosomal protein L7a vs. Ensembl Cavefish
Match: snu13b (small nuclear ribonucleoprotein 13 [Source:NCBI gene;Acc:103032763])

HSP 1 Score: 51.6026 bits (122), Expect = 4.619e-8
Identity = 22/57 (38.60%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  500 IRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQ 670
            +R G  E T  + +  ++ +V+A D +P+EI+LHLP LC    VPY  ++ K  LG+
Sbjct:   35 LRKGANESTKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGR 91          
BLAST of 60S ribosomal protein L7a vs. Ensembl Sea Lamprey
Match: nhp2 (NHP2 ribonucleoprotein homolog (yeast) [Source:NCBI gene;Acc:100003787])

HSP 1 Score: 59.3066 bits (142), Expect = 4.018e-11
Identity = 28/81 (34.57%), Postives = 47/81 (58.02%), Query Frame = 2
Query:  485 TKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASED 727
            +K  ++R GV+E+   +++ +  +VV+A D  P+E++ H+P +C    +PYC   GK+ LG     K  + V LV  A ED
Sbjct:   57 SKQKMLRRGVKEVQKFLKKGEKGIVVLAGDTQPVEVICHIPIMCEDQNLPYCYEGGKSDLGGAAGSKRATCVILVK-AHED 136          
BLAST of 60S ribosomal protein L7a vs. Ensembl Yeast
Match: RPL8B (Ribosomal 60S subunit protein L8B; required for processing of 27SA3 pre-rRNA to 27SB pre-rRNA during assembly of large ribosomal subunit; depletion leads to a turnover of pre-rRNA; L8 binds to Domain I of 25S and 5.8 S rRNAs; mutation results in decreased amounts of free 60S subunits; homologous to mammalian ribosomal protein L7A, no bacterial homolog; RPL8B has a paralog, RPL8A, that arose from the whole genome duplication [Source:SGD;Acc:S000003968])

HSP 1 Score: 249.21 bits (635), Expect = 6.654e-83
Identity = 121/231 (52.38%), Postives = 162/231 (70.13%), Query Frame = 2
Query:  179 NPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKP-ETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQE 868
            NPL  S PKNF IGQ +QPKR+L+R+VKWP+YVRLQRQK IL+ RLK+P  I QF   +D+  A    KL +KYRPE+  EK  RL   A+   EGK  +    KP  ++YG+  + +L+E KKA++V+IA+DVDPIE+V+ LPALC+KMGVPY I+KGKA LG +V +KT +  AL  V +ED+A L KL   +  NF ++ DE++KH GGGI+G K+QAK+ K  K  +
Sbjct:   24 NPLTHSTPKNFGIGQAVQPKRNLSRYVKWPEYVRLQRQKKILSIRLKVPPTIAQFQYTLDRNTAAETFKLFNKYRPETAAEKKERLTKEAAAIAEGKSKQDASPKPYAVKYGLNHVVSLIENKKAKLVLIANDVDPIELVVFLPALCKKMGVPYAIIKGKARLGTLVNQKTSAVAALTEVRAEDEAALAKLVSTIDANFADKYDEVKKHWGGGILGNKAQAKMDKRAKTSD 254          
BLAST of 60S ribosomal protein L7a vs. Ensembl Yeast
Match: RPL8A (Ribosomal 60S subunit protein L8A; required for processing of 27SA3 pre-rRNA to 27SB pre-rRNA during assembly of large ribosomal subunit; depletion leads to a turnover of pre-rRNA; L8 binds to Domain I of 25S and 5.8 S rRNAs; mutation results in decreased amounts of free 60S subunits; homologous to mammalian ribosomal protein L7A, no bacterial homolog; RPL8A has a paralog, RPL8B, that arose from the whole genome duplication [Source:SGD;Acc:S000001025])

HSP 1 Score: 246.128 bits (627), Expect = 1.077e-81
Identity = 120/228 (52.63%), Postives = 160/228 (70.18%), Query Frame = 2
Query:  179 NPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKP-ETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKK 859
            NPL  S PKNF IGQ +QPKR+L+R+VKWP+YVR+QRQK IL+ RLK+P  I QF   +D+  A    KL +KYRPE+  EK  RL   A+   EGK  +    KP  ++YG+  +  L+E KKA++V+IA+DVDPIE+V+ LPALC+KMGVPY I+KGKA LG +V +KT +  AL  V +ED+A L KL   +  NF ++ DE++KH GGGI+G K+QAK+ K  K
Sbjct:   24 NPLTHSTPKNFGIGQAVQPKRNLSRYVKWPEYVRVQRQKKILSIRLKVPPTIAQFQYTLDRNTAAETFKLFNKYRPETAAEKKERLTKEAAAVAEGKSKQDASPKPYAVKYGLNHVVALIENKKAKLVLIANDVDPIELVVFLPALCKKMGVPYAIVKGKARLGTLVNQKTSAVAALTEVRAEDEAALAKLVSTIDANFADKYDEVKKHWGGGILGNKAQAKMDKRAK 251          
BLAST of 60S ribosomal protein L7a vs. Ensembl Yeast
Match: YLL044W_mRNA (Dubious open reading frame; unlikely to encode a functional protein, based on available experimental and comparative sequence data; transcription of both YLL044W and the overlapping gene RPL8B is reduced in the gcr1 null mutant [Source:SGD;Acc:S000003967])

HSP 1 Score: 56.6102 bits (135), Expect = 1.631e-10
Identity = 38/106 (35.85%), Postives = 60/106 (56.60%), Query Frame = -3
Query:  110 AFRSIFTQKFNNRFSIRLVNSIIKLIDYSWHFQSFIKN*LLSLKSDIFWPFDKSS*VTFWLNILTNCKIFRSRFEKRIYNLL-FDGL----*FYNFRYWSYLFDRL 412
             F S+  ++     S   V S+++L +   + QS  ++ LLSL+SDIFWPFD S  V+ WL+ L N ++  SR  + + +L+   GL     + NF  WS+LF +L
Sbjct:   38 GFWSVLVEQLEGFSSGVSVQSVLELSNGWRNLQSDGQDLLLSLQSDIFWPFDVSGQVSLWLDSLANTEVLWSRVSQWVLSLVRLSGLSTEWSWSNFLTWSHLFFQL 143          
BLAST of 60S ribosomal protein L7a vs. Ensembl Yeast
Match: NHP2 (Protein related to mammalian high mobility group (HMG) proteins; nuclear protein; essential for function of H/ACA-type snoRNPs, which are involved in 18S rRNA processing [Source:SGD;Acc:S000002367])

HSP 1 Score: 50.8322 bits (120), Expect = 2.305e-8
Identity = 27/99 (27.27%), Postives = 47/99 (47.47%), Query Frame = 2
Query:  500 IRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIR 796
            ++ GV+E+   + + +  +VVIA D+ P +++ H+P LC    VPY  +  K  LG     K  ++V  +   S  K       E    +FN    E++
Sbjct:   56 VKRGVKEVVKALRKGEKGLVVIAGDISPADVISHIPVLCEDHSVPYIFIPSKQDLGAAGATKRPTSVVFIVPGSNKKKDGKNKEEEYKESFNEVVKEVQ 154          
BLAST of 60S ribosomal protein L7a vs. Ensembl Yeast
Match: SNU13 (RNA binding protein; part of U3 snoRNP involved in rRNA processing, part of U4/U6-U5 tri-snRNP involved in mRNA splicing, similar to human 15.5K protein [Source:SGD;Acc:S000000752])

HSP 1 Score: 48.1358 bits (113), Expect = 1.032e-7
Identity = 20/57 (35.09%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  500 IRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQ 670
            ++ G  E T  + +  ++ +++A D +PIEI+LHLP LC    VPY  +  +  LG+
Sbjct:   33 LKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGR 89          
BLAST of 60S ribosomal protein L7a vs. Ensembl Nematostella
Match: EDO47245 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN14])

HSP 1 Score: 293.893 bits (751), Expect = 6.055e-100
Identity = 143/233 (61.37%), Postives = 176/233 (75.54%), Query Frame = 2
Query:  176 VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERE 874
            VNPL E RP+NF IG DIQPKRDL+RFV+WP+YV+LQRQKS+L +RLK+P  INQF  A+D+ +   + KLL KYRPE+K EK ARL  +A ++ EGK E    KP L++YG+  IT+LVE KKAQ+VVIAHDVDPIEIV+ LPALCRKM VPYCI+KGKA LG++V KK  +A+ +  V  EDK  LN L E + TN+N R DEIRKH GGGIMG KS A   K++K + RE
Sbjct:   28 VNPLIEKRPRNFGIGGDIQPKRDLSRFVRWPRYVKLQRQKSLLYQRLKVPPAINQFTQALDRQSTVQLFKLLHKYRPETKAEKKARLSAKAEKKAEGKEEAPGKKPMLVKYGINHITSLVENKKAQLVVIAHDVDPIEIVVWLPALCRKMQVPYCIVKGKARLGKVVHKKNATALCITGVRQEDKNSLNNLIESVKTNYNERFDEIRKHWGGGIMGPKSLAATAKVEKAKLRE 260          
BLAST of 60S ribosomal protein L7a vs. Ensembl Nematostella
Match: EDO48688 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RID9])

HSP 1 Score: 46.9802 bits (110), Expect = 1.076e-6
Identity = 21/75 (28.00%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  485 TKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALV 709
            +K   +R GV+E+   + + +   V++A DV PI+++ H+P +C    +PY  +  K  LG     K  +++ L+
Sbjct:   54 SKAKTLRRGVKEVVKALRKGEKGFVILAGDVSPIDVISHIPVMCEDSKIPYAYVPSKVDLGASSLTKRPTSIVLI 128          
BLAST of 60S ribosomal protein L7a vs. Ensembl Medaka
Match: RPL7A (ribosomal protein L7a [Source:NCBI gene;Acc:101163674])

HSP 1 Score: 316.235 bits (809), Expect = 2.975e-108
Identity = 152/239 (63.60%), Postives = 185/239 (77.41%), Query Frame = 2
Query:  176 VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            VNPLFE RPKNF IGQDIQPKRDLTRFVKWP+YVRLQRQ+SIL KRLK+P  INQF  A+D+  A  + KL  KYRPE+KQEK  RL  RA ++  GK +T   +P ++R GV  +TTLVE KKAQ+VVIAHDVDPIE+V+ LPALCRKMGVPYCI+KGKA LG++V +KTC++VA   V  EDK  L KL E + TN+N+R +EIR+H GG +MG KS A+I KL+K + +E A KLG
Sbjct:   28 VNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYVRLQRQRSILYKRLKVPPAINQFTQALDRQTATQLFKLAHKYRPETKQEKKQRLLARAEQKAAGKGDTPTKRPPVLRAGVNTVTTLVESKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIVKGKARLGRLVHRKTCTSVAFTQVNPEDKGALAKLVEAIKTNYNDRFEEIRRHWGGNLMGPKSTARIAKLEKAKAKELATKLG 266          
BLAST of 60S ribosomal protein L7a vs. Ensembl Medaka
Match: snu13a (small nuclear ribonucleoprotein 13 [Source:NCBI gene;Acc:101175271])

HSP 1 Score: 53.1434 bits (126), Expect = 1.481e-8
Identity = 23/57 (40.35%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  500 IRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQ 670
            +R G  E T  + +  A+ +V+A D +P+EI+LHLP LC    VPY  ++ K  LG+
Sbjct:   35 LRKGANEATKTLNRGIAEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGR 91          
BLAST of 60S ribosomal protein L7a vs. Ensembl Medaka
Match: nhp2 (NHP2 ribonucleoprotein [Source:NCBI gene;Acc:101168479])

HSP 1 Score: 50.0618 bits (118), Expect = 2.352e-7
Identity = 24/69 (34.78%), Postives = 38/69 (55.07%), Query Frame = 2
Query:  500 IRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVAL 706
            IR GV+E+   + + +  +VV+A D  PIE+  HLP +C    +PY  +  K +  Q+    TC+ V L
Sbjct:   58 IRRGVKEVQKFINKGEKGIVVLAGDTLPIEVYCHLPVMCEDRSLPYAYIPSKVVSQQL----TCAGVHL 122          
BLAST of 60S ribosomal protein L7a vs. Ensembl Medaka
Match: nhp2 (NHP2 ribonucleoprotein [Source:NCBI gene;Acc:101168479])

HSP 1 Score: 50.0618 bits (118), Expect = 2.657e-7
Identity = 24/70 (34.29%), Postives = 37/70 (52.86%), Query Frame = 2
Query:  500 IRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALV 709
            IR GV+E+   + + +  +VV+A D  PIE+  HLP +C    +PY  +  K  LG     K  + V L+
Sbjct:   58 IRRGVKEVQKFINKGEKGIVVLAGDTLPIEVYCHLPVMCEDRSLPYAYIPSKVDLGSAAGSKRPTCVILI 127          
BLAST of 60S ribosomal protein L7a vs. Planmine SMEST
Match: SMESG000020535.1 (SMESG000020535.1)

HSP 1 Score: 484.182 bits (1245), Expect = 1.300e-174
Identity = 238/239 (99.58%), Postives = 239/239 (100.00%), Query Frame = 2
Query:  176 VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 892
            VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVA+EDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG
Sbjct:   36 VNPLFESRPKNFAIGQDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNAKSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVAAEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIMGLKSQAKILKLKKIQERENAVKLG 274          
BLAST of 60S ribosomal protein L7a vs. Planmine SMEST
Match: SMESG000027686.1 (SMESG000027686.1)

HSP 1 Score: 57.3806 bits (137), Expect = 3.554e-9
Identity = 26/82 (31.71%), Postives = 45/82 (54.88%), Query Frame = 2
Query:  509 GVREITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQIVRKKTCSAVALVNVASEDKAPLNKLTE 754
            GV+ +   + +K+  +V+IA DV PI++V+H+P LC    VPYC L  +  +G     K   A+ ++       +  NKL++
Sbjct:   61 GVKSVPKAIRKKRKGIVIIAGDVTPIDVVIHIPKLCETANVPYCFLPCRRDVGIACGSKKSIAIVMIECDDAYASKFNKLSK 142          
The following BLAST results are available for this feature:
BLAST of 60S ribosomal protein L7a vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPL7A5.620e-10762.76ribosomal protein L7a [Source:HGNC Symbol;Acc:HGNC... [more]
RPL7A5.620e-10762.76ribosomal protein L7a [Source:HGNC Symbol;Acc:HGNC... [more]
RPL7A1.861e-5864.96ribosomal protein L7a [Source:HGNC Symbol;Acc:HGNC... [more]
RPL7A1.861e-5864.96ribosomal protein L7a [Source:HGNC Symbol;Acc:HGNC... [more]
RPL7A5.538e-5560.14ribosomal protein L7a [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of 60S ribosomal protein L7a vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rpl-7A2.347e-9560.7860S ribosomal protein L7a [Source:UniProtKB/Swiss... [more]
rpl-7A7.689e-9156.9060S ribosomal protein L7a [Source:UniProtKB/Swiss... [more]
Y73B3A.182.602e-3263.37pep chromosome:WBcel235:X:48483:60752:1 gene:WBGen... [more]
Y73B3A.189.119e-2573.33pep chromosome:WBcel235:X:48483:60774:1 gene:WBGen... [more]
back to top
BLAST of 60S ribosomal protein L7a vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RpL7A5.282e-9658.40gene:FBgn0014026 transcript:FBtr0345293[more]
RpL7A5.282e-9658.40gene:FBgn0014026 transcript:FBtr0070916[more]
RpL7A5.282e-9658.40gene:FBgn0014026 transcript:FBtr0343329[more]
RpL7A5.282e-9658.40gene:FBgn0014026 transcript:FBtr0343328[more]
RpL7A5.282e-9658.40gene:FBgn0014026 transcript:FBtr0070915[more]
back to top
BLAST of 60S ribosomal protein L7a vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpl7a1.819e-10661.92ribosomal protein L7a [Source:ZFIN;Acc:ZDB-GENE-03... [more]
rpl7a2.029e-10661.92ribosomal protein L7a [Source:ZFIN;Acc:ZDB-GENE-03... [more]
snu13a4.356e-838.60SNU13 homolog, small nuclear ribonucleoprotein a (... [more]
snu13b4.356e-838.60SNU13 homolog, small nuclear ribonucleoprotein b (... [more]
nhp24.102e-729.41NHP2 ribonucleoprotein homolog (yeast) [Source:NCB... [more]
back to top
BLAST of 60S ribosomal protein L7a vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rpl7a7.362e-10864.02ribosomal protein L7a [Source:NCBI gene;Acc:447981... [more]
snu133.076e-841.07small nuclear ribonucleoprotein 13 [Source:NCBI ge... [more]
nhp27.859e-834.29NHP2 ribonucleoprotein [Source:NCBI gene;Acc:39458... [more]
back to top
BLAST of 60S ribosomal protein L7a vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Rpl7a3.574e-10762.76ribosomal protein L7A [Source:MGI Symbol;Acc:MGI:1... [more]
Gm142141.096e-8355.65predicted gene 14214 [Source:MGI Symbol;Acc:MGI:36... [more]
Snu137.802e-838.60SNU13 homolog, small nuclear ribonucleoprotein (U4... [more]
Nhp21.568e-732.94NHP2 ribonucleoprotein [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of 60S ribosomal protein L7a vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2TBQ5|RL7A_BOVIN1.802e-10662.7660S ribosomal protein L7a OS=Bos taurus OX=9913 GN... [more]
sp|P12970|RL7A_MOUSE2.500e-10662.7660S ribosomal protein L7a OS=Mus musculus OX=10090... [more]
sp|P62425|RL7A_RAT2.699e-10662.7660S ribosomal protein L7a OS=Rattus norvegicus OX=... [more]
sp|Q4R5C2|RL7A_MACFA2.699e-10662.7660S ribosomal protein L7a OS=Macaca fascicularis O... [more]
sp|P62424|RL7A_HUMAN2.699e-10662.7660S ribosomal protein L7a OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of 60S ribosomal protein L7a vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E9LR671.679e-10963.6060S ribosomal L7a-like protein OS=Phragmatopoma la... [more]
A0A1S3KA421.032e-10763.1860S ribosomal protein L7a OS=Lingula unguis OX=757... [more]
A0A4W6BLZ01.119e-10563.18Ribosomal_L7Ae domain-containing protein OS=Lates ... [more]
A0A3B3QCC51.940e-10563.18Ribosomal_L7Ae domain-containing protein OS=Paramo... [more]
A0A3B3QA532.193e-10563.18Ribosomal_L7Ae domain-containing protein OS=Paramo... [more]
back to top
BLAST of 60S ribosomal protein L7a vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpl7a3.002e-10561.09ribosomal protein L7a [Source:NCBI gene;Acc:103021... [more]
rpl7a4.067e-10561.09ribosomal protein L7a [Source:NCBI gene;Acc:103021... [more]
rpl7a4.677e-10561.09ribosomal protein L7a [Source:NCBI gene;Acc:103021... [more]
snu13a4.190e-838.60NHP2-like protein 1 [Source:NCBI gene;Acc:10304087... [more]
snu13b4.619e-838.60small nuclear ribonucleoprotein 13 [Source:NCBI ge... [more]
back to top
BLAST of 60S ribosomal protein L7a vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nhp24.018e-1134.57NHP2 ribonucleoprotein homolog (yeast) [Source:NCB... [more]
back to top
BLAST of 60S ribosomal protein L7a vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RPL8B6.654e-8352.38Ribosomal 60S subunit protein L8B; required for pr... [more]
RPL8A1.077e-8152.63Ribosomal 60S subunit protein L8A; required for pr... [more]
YLL044W_mRNA1.631e-1035.85Dubious open reading frame; unlikely to encode a f... [more]
NHP22.305e-827.27Protein related to mammalian high mobility group (... [more]
SNU131.032e-735.09RNA binding protein; part of U3 snoRNP involved in... [more]
back to top
BLAST of 60S ribosomal protein L7a vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO472456.055e-10061.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486881.076e-628.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 60S ribosomal protein L7a vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
RPL7A2.975e-10863.60ribosomal protein L7a [Source:NCBI gene;Acc:101163... [more]
snu13a1.481e-840.35small nuclear ribonucleoprotein 13 [Source:NCBI ge... [more]
nhp22.352e-734.78NHP2 ribonucleoprotein [Source:NCBI gene;Acc:10116... [more]
nhp22.657e-734.29NHP2 ribonucleoprotein [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of 60S ribosomal protein L7a vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000020535.11.300e-17499.58SMESG000020535.1[more]
SMESG000027686.13.554e-931.71SMESG000027686.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001701 ID=SMED30001701|Name=60S ribosomal protein L7a|organism=Schmidtea mediterranea sexual|type=transcript|length=930bp
TAACTACTTATTTAAACTTTGTTTAAATTGTTAAAATTATTAAAATATAA
ATTTTTTAAAATTAGATAAGATGCCTAACAACAAAGCCAAACTTTTAGCT
AAGAAGAAGAAGTCTGTCAAAAAGGTAGCTCCAGTACCTGAAATTATAAA
ATCAAAGACCATCAAAAAGAAGATTGTAAATCCTCTTTTCGAATCTAGAC
CTAAAAATTTTGCAATTGGTCAAGATATTCAACCAAAACGTGACTTAACT
AGATTTGTCAAATGGCCAAAATATGTCAGACTTCAAAGACAAAAGTCAAT
TCTTAATAAAAGATTGAAAATGCCAGCTGTAATCAATCAATTTAATAATG
CTATTGACAAGCCTAATGCTAAATCGATTGTTAAACTTTTGAGTAAATAT
AGACCTGAAAGCAAGCAAGAAAAAGTCGCAAGACTTAAATTAAGAGCTTC
AGAAAGAGTTGAAGGAAAGCCTGAAACTGTTGAAACTAAACCAGCTCTTA
TCAGATATGGTGTCAGAGAAATCACTACATTAGTTGAGCAAAAGAAAGCT
CAAATGGTTGTGATTGCTCATGATGTTGACCCTATTGAAATTGTTTTGCA
CTTGCCAGCATTGTGCAGAAAAATGGGTGTACCTTATTGCATTCTTAAAG
GAAAAGCTATTCTTGGTCAAATTGTTAGAAAGAAGACTTGCTCTGCTGTG
GCTTTGGTCAACGTAGCCTCTGAAGATAAAGCCCCATTGAACAAATTAAC
GGAAATAATGATGACTAACTTCAATAACAGAGGTGATGAAATCAGAAAAC
ACGTTGGTGGTGGAATTATGGGACTTAAATCACAAGCTAAGATTTTGAAA
TTGAAAAAAATTCAAGAAAGAGAAAATGCAGTTAAACTTGGTTGAGTTGT
ATTTAAATAAACTTTGGAATTAAAAAAAAA
back to top

protein sequence of SMED30001701-orf-1

>SMED30001701-orf-1 ID=SMED30001701-orf-1|Name=SMED30001701-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=275bp
MPNNKAKLLAKKKKSVKKVAPVPEIIKSKTIKKKIVNPLFESRPKNFAIG
QDIQPKRDLTRFVKWPKYVRLQRQKSILNKRLKMPAVINQFNNAIDKPNA
KSIVKLLSKYRPESKQEKVARLKLRASERVEGKPETVETKPALIRYGVRE
ITTLVEQKKAQMVVIAHDVDPIEIVLHLPALCRKMGVPYCILKGKAILGQ
IVRKKTCSAVALVNVASEDKAPLNKLTEIMMTNFNNRGDEIRKHVGGGIM
GLKSQAKILKLKKIQERENAVKLG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000101muscle cell
PLANA:0000120progenitor cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR038524Ribosomal_L7A/L8_sf
IPR018492Ribosomal_L7Ae/L8/Nhp2
IPR001921Ribosomal_L7A/L8
IPR029064L30e-like
IPR004038Ribosomal_L7Ae/L30e/S12e/Gad45
IPR004037Ribosomal_L7Ae_CS
Vocabulary: cellular component
TermDefinition
GO:1990904ribonucleoprotein complex
GO:0030529intracellular ribonucleoprotein complex
GO:0005634nucleus
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005840ribosome
GO:0005925focal adhesion
GO:0016020membrane
GO:0022625cytosolic large ribosomal subunit
GO:0042788polysomal ribosome
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0042254ribosome biogenesis
GO:0000470maturation of LSU-rRNA
GO:0006412translation
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0045296cadherin binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001921Ribosomal protein L7A/L8PRINTSPR00882RIBOSOMALL7Acoord: 105..118
score: 68.83
coord: 140..160
score: 48.92
coord: 81..100
score: 51.82
coord: 61..78
score: 77.27
coord: 201..225
score: 45.09
coord: 44..61
score: 77.78
coord: 233..253
score: 59.74
IPR018492Ribosomal protein L7Ae/L8/Nhp2 familyPRINTSPR00881L7ARS6FAMILYcoord: 163..176
score: 69.48
coord: 189..203
score: 45.45
coord: 144..158
score: 37.88
coord: 179..189
score: 73.14
IPR004038Ribosomal protein L7Ae/L30e/S12e/Gadd45PFAMPF01248Ribosomal_L7Aecoord: 142..217
e-value: 2.0E-21
score: 75.5
IPR038524Ribosomal protein L7A/L8 superfamilyGENE3DG3DSA:3.30.1330.210coord: 65..249
e-value: 5.1E-78
score: 262.9
NoneNo IPR availablePANTHERPTHR23105RIBOSOMAL PROTEIN L7AE FAMILY MEMBERcoord: 16..273
NoneNo IPR availablePANTHERPTHR23105:SF14160S RIBOSOMAL PROTEIN L7A-RELATEDcoord: 16..273
IPR004037Ribosomal protein L7Ae conserved sitePROSITEPS01082RIBOSOMAL_L7AEcoord: 182..199
IPR02906450S ribosomal protein L30e-likeSUPERFAMILYSSF55315L30e-likecoord: 104..244