Calcium-transporting ATPase

Overview
NameCalcium-transporting ATPase
Smed IDSMED30001679
Length (bp)5068
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcium-transporting ATPase (SMED30001679) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcium-transporting ATPase (SMED30001679) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcium-transporting ATPase (SMED30001679) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcium-transporting ATPase (SMED30001679) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001679

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 31

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30001679SMESG000014734.1 Contig3487newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001679SMESG000058745.1 Contig3487newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30001679SMESG000014734.1 dd_Smed_v4_1721_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001679SMESG000014734.1 dd_Smed_v4_1721_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30001679SMESG000014734.1 dd_Smed_v4_1721_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30001679SMESG000014734.1 dd_Smed_v4_1721_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30001679SMESG000014734.1 dd_Smed_v4_1721_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001679SMESG000014734.1 dd_Smed_v4_1721_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30001679SMESG000014734.1 dd_Smed_v4_1721_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001679SMESG000014734.1 dd_Smed_v4_1721_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30001679SMESG000014734.1 dd_Smed_v4_1721_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30001679SMESG000014734.1 dd_Smed_v4_1721_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001679SMESG000014734.1 SMESG000014733.1 Contig49384uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001679SMESG000014734.1 SMESG000014733.1 Contig49384newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001679SMESG000020523.1 Contig5216GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001679SMESG000014734.1 Contig5172GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001679SMESG000014734.1 Contig5216GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001679SMESG000014734.1 Contig37177newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001679SMESG000014734.1 Contig42646newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001679SMESG000014734.1 Contig44595uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001679SMESG000014734.1 Contig44595newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001679SMESG000014734.1 Contig37176newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001679SMESG000014734.1 Contig37176uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001679SMESG000014733.1 SMESG000014734.1 Contig39421uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001679SMESG000014733.1 SMESG000014734.1 Contig39421newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001679SMESG000014734.1 Contig42646uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30001679SMESG000014734.1 dd_Smed_v6_1721_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30001679SMESG000014734.1 dd_Smed_v6_1721_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30001679SMESG000014734.1 dd_Smed_v6_1721_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30001679SMESG000014734.1 dd_Smed_v6_1721_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30001679SMESG000014734.1 dd_Smed_v6_1721_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2B3 (ATPase plasma membrane Ca2+ transporting 3 [Source:HGNC Symbol;Acc:HGNC:816])

HSP 1 Score: 1207.2 bits (3122), Expect = 0.000e+0
Identity = 672/1154 (58.23%), Postives = 834/1154 (72.27%), Query Frame = 1
Query:  673 FKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGL--QCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYT-----------MYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEV----TSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQW---KTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEA 4074
            F  ++ EL+ +MELRG EA+  I   Y  +SGLC  L+TSP EGL    +D  +R +IYG N IPPK PKTF QLV+EA+QD+TLI+L +AA++SLGLS Y            +  G   + EAE GWIEG AIL +V+ VV V AFNDW KE+QFRGLQ++IE E KF VIRN Q  ++ V  ++VGDI Q+KYGDLLPADG++IQ+NDLK+DESSLTGESD V+K  + DP++LSGTHVMEGSG++++TAVGVNSQ GIIF LLGA   E E +    + Q+    +S       D  V +E+    ++E GE              E  +KKK  + + KE SVLQ KLTKLA+QIG  G +++ +TV IL++ F    F  +G  W    T V++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+++  +++ ++P  S L+ K   LLV AISINS YT++++ P  +  LP QVGNKTECALLGFVL+L    +Q +R +  EDKL KVYTFNSVRKSMSTVI +    G+ +F+KGASEI++ KC+ I+++NG++  F   D++ +V+ +IEPMA +GLRTI IAY++    S G        +EPD++NE ++V DLTC+A+VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTAR+IA KCGI++PG+DFL LEGKEFN+RIR+ K GE+ Q+ +DKVWP LRVLARSSP DK+TLV GII S     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P E LL R PYGR KPLI+R M+K I+G  +YQL +I  LL  GE   D+DSGR       S P+EH+T IFNTFVMM LFNEINARKIHG+RN+F+G+  N IF  I + T   QIVI++FGG   S S L  + WLWC+F G+G LVWGQV+ +IP +                 +   K+   G   + M  +DE+  E    + + + ++ R GQILW RGL+R+QTQ   ++VV+AF+ +L E 
Sbjct:   27 FGCTLAELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAEGGE-------------MEEREKKKANAPK-KEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYKEIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVLDLK-RDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPD-GGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDF---SAG--------QEPDWDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNEK-GEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTS----------------QLKCLKEAGHGPGKDEM--TDEELAEGEEEIDHAEREL-RRGQILWFRGLNRIQTQ---IRVVKAFRSSLYEG 1128          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2B3 (ATPase plasma membrane Ca2+ transporting 3 [Source:HGNC Symbol;Acc:HGNC:816])

HSP 1 Score: 1207.2 bits (3122), Expect = 0.000e+0
Identity = 672/1154 (58.23%), Postives = 834/1154 (72.27%), Query Frame = 1
Query:  673 FKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGL--QCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYT-----------MYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEV----TSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQW---KTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEA 4074
            F  ++ EL+ +MELRG EA+  I   Y  +SGLC  L+TSP EGL    +D  +R +IYG N IPPK PKTF QLV+EA+QD+TLI+L +AA++SLGLS Y            +  G   + EAE GWIEG AIL +V+ VV V AFNDW KE+QFRGLQ++IE E KF VIRN Q  ++ V  ++VGDI Q+KYGDLLPADG++IQ+NDLK+DESSLTGESD V+K  + DP++LSGTHVMEGSG++++TAVGVNSQ GIIF LLGA   E E +    + Q+    +S       D  V +E+    ++E GE              E  +KKK  + + KE SVLQ KLTKLA+QIG  G +++ +TV IL++ F    F  +G  W    T V++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+++  +++ ++P  S L+ K   LLV AISINS YT++++ P  +  LP QVGNKTECALLGFVL+L    +Q +R +  EDKL KVYTFNSVRKSMSTVI +    G+ +F+KGASEI++ KC+ I+++NG++  F   D++ +V+ +IEPMA +GLRTI IAY++    S G        +EPD++NE ++V DLTC+A+VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTAR+IA KCGI++PG+DFL LEGKEFN+RIR+ K GE+ Q+ +DKVWP LRVLARSSP DK+TLV GII S     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P E LL R PYGR KPLI+R M+K I+G  +YQL +I  LL  GE   D+DSGR       S P+EH+T IFNTFVMM LFNEINARKIHG+RN+F+G+  N IF  I + T   QIVI++FGG   S S L  + WLWC+F G+G LVWGQV+ +IP +                 +   K+   G   + M  +DE+  E    + + + ++ R GQILW RGL+R+QTQ   ++VV+AF+ +L E 
Sbjct:   27 FGCTLAELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAEGGE-------------MEEREKKKANAPK-KEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYKEIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVLDLK-RDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPD-GGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDF---SAG--------QEPDWDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNEK-GEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTS----------------QLKCLKEAGHGPGKDEM--TDEELAEGEEEIDHAEREL-RRGQILWFRGLNRIQTQ---IRVVKAFRSSLYEG 1128          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2B3 (ATPase plasma membrane Ca2+ transporting 3 [Source:HGNC Symbol;Acc:HGNC:816])

HSP 1 Score: 1204.5 bits (3115), Expect = 0.000e+0
Identity = 671/1148 (58.45%), Postives = 829/1148 (72.21%), Query Frame = 1
Query:  673 FKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGL--QCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYT-----------MYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEV----TSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQW---KTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFK 4056
            F  ++ EL+ +MELRG EA+  I   Y  +SGLC  L+TSP EGL    +D  +R +IYG N IPPK PKTF QLV+EA+QD+TLI+L +AA++SLGLS Y            +  G   + EAE GWIEG AIL +V+ VV V AFNDW KE+QFRGLQ++IE E KF VIRN Q  ++ V  ++VGDI Q+KYGDLLPADG++IQ+NDLK+DESSLTGESD V+K  + DP++LSGTHVMEGSG++++TAVGVNSQ GIIF LLGA   E E +    + Q+    +S       D  V +E+    ++E GE              E  +KKK  + + KE SVLQ KLTKLA+QIG  G +++ +TV IL++ F    F  +G  W    T V++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+++  +++ ++P  S L+ K   LLV AISINS YT++++ P  +  LP QVGNKTECALLGFVL+L    +Q +R +  EDKL KVYTFNSVRKSMSTVI +    G+ +F+KGASEI++ KC+ I+++NG++  F   D++ +V+ +IEPMA +GLRTI IAY++    S G        +EPD++NE ++V DLTC+A+VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTAR+IA KCGI++PG+DFL LEGKEFN+RIR+ K GE+ Q+ +DKVWP LRVLARSSP DK+TLV GII S     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P E LL R PYGR KPLI+R M+K I+G  +YQL +I  LL  GE   D+DSGR       S P+EH+T IFNTFVMM LFNEINARKIHG+RN+F+G+  N IF  I + T   QIVI++FGG   S S L  + WLWC+F G+G LVWGQV+ +IP +                 +   K+   G   + M  +DE+  E    + + + ++ R GQILW RGL+R+QTQM   +VV  FK
Sbjct:   27 FGCTLAELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAEGGE-------------MEEREKKKANAPK-KEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYKEIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVLDLK-RDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPD-GGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDF---SAG--------QEPDWDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNEK-GEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTS----------------QLKCLKEAGHGPGKDEM--TDEELAEGEEEIDHAEREL-RRGQILWFRGLNRIQTQM---EVVSTFK 1122          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2B3 (ATPase plasma membrane Ca2+ transporting 3 [Source:HGNC Symbol;Acc:HGNC:816])

HSP 1 Score: 1203.35 bits (3112), Expect = 0.000e+0
Identity = 667/1144 (58.30%), Postives = 826/1144 (72.20%), Query Frame = 1
Query:  673 FKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGL--QCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYT-----------MYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQW---KTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFK 4056
            F  ++ EL+ +MELRG EA+  I   Y  +SGLC  L+TSP EGL    +D  +R +IYG N IPPK PKTF QLV+EA+QD+TLI+L +AA++SLGLS Y            +  G   + EAE GWIEG AIL +V+ VV V AFNDW KE+QFRGLQ++IE E KF VIRN Q  ++ V  ++VGDI Q+KYGDLLPADG++IQ+NDLK+DESSLTGESD V+K  + DP++LSGTHVMEGSG++++TAVGVNSQ GIIF LLGA   E E +    + Q+            + + ++   ++E GE              E  +KKK  + + KE SVLQ KLTKLA+QIG  G +++ +TV IL++ F    F  +G  W    T V++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+++  +++ ++P  S L+ K   LLV AISINS YT++++ P  +  LP QVGNKTECALLGFVL+L    +Q +R +  EDKL KVYTFNSVRKSMSTVI +    G+ +F+KGASEI++ KC+ I+++NG++  F   D++ +V+ +IEPMA +GLRTI IAY++    S G        +EPD++NE ++V DLTC+A+VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTAR+IA KCGI++PG+DFL LEGKEFN+RIR+ K GE+ Q+ +DKVWP LRVLARSSP DK+TLV GII S     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P E LL R PYGR KPLI+R M+K I+G  +YQL +I  LL  GE   D+DSGR       S P+EH+T IFNTFVMM LFNEINARKIHG+RN+F+G+  N IF  I + T   QIVI++FGG   S S L  + WLWC+F G+G LVWGQV+ +IP +                 +   K+   G   + M  +DE+  E    + + + ++ R GQILW RGL+R+QTQM   +VV  FK
Sbjct:   27 FGCTLAELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKAKKQDG----------AVAMEMQPLKSAEGGEM-------------EEREKKKANAPK-KEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYKEIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVLDLK-RDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPD-GGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDF---SAG--------QEPDWDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNEK-GEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTS----------------QLKCLKEAGHGPGKDEM--TDEELAEGEEEIDHAEREL-RRGQILWFRGLNRIQTQM---EVVSTFK 1108          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2B3 (ATPase plasma membrane Ca2+ transporting 3 [Source:HGNC Symbol;Acc:HGNC:816])

HSP 1 Score: 1202.19 bits (3109), Expect = 0.000e+0
Identity = 667/1144 (58.30%), Postives = 826/1144 (72.20%), Query Frame = 1
Query:  673 FKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGL--QCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYT-----------MYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQW---KTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFK 4056
            F  ++ EL+ +MELRG EA+  I   Y  +SGLC  L+TSP EGL    +D  +R +IYG N IPPK PKTF QLV+EA+QD+TLI+L +AA++SLGLS Y            +  G   + EAE GWIEG AIL +V+ VV V AFNDW KE+QFRGLQ++IE E KF VIRN Q  ++ V  ++VGDI Q+KYGDLLPADG++IQ+NDLK+DESSLTGESD V+K  + DP++LSGTHVMEGSG++++TAVGVNSQ GIIF LLGA   E E +    + Q+            + + ++   ++E GE              E  +KKK  + + KE SVLQ KLTKLA+QIG  G +++ +TV IL++ F    F  +G  W    T V++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+++  +++ ++P  S L+ K   LLV AISINS YT++++ P  +  LP QVGNKTECALLGFVL+L    +Q +R +  EDKL KVYTFNSVRKSMSTVI +    G+ +F+KGASEI++ KC+ I+++NG++  F   D++ +V+ +IEPMA +GLRTI IAY++    S G        +EPD++NE ++V DLTC+A+VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTAR+IA KCGI++PG+DFL LEGKEFN+RIR+ K GE+ Q+ +DKVWP LRVLARSSP DK+TLV GII S     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P E LL R PYGR KPLI+R M+K I+G  +YQL +I  LL  GE   D+DSGR       S P+EH+T IFNTFVMM LFNEINARKIHG+RN+F+G+  N IF  I + T   QIVI++FGG   S S L  + WLWC+F G+G LVWGQV+ +IP +                 +   K+   G   + M  +DE+  E    + + + ++ R GQILW RGL+R+QTQM   +VV  FK
Sbjct:   27 FGCTLAELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKAKKQDG----------AVAMEMQPLKSAEGGEM-------------EEREKKKANAPK-KEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYKEIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVLDLK-RDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPD-GGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDF---SAG--------QEPDWDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNEK-GEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTS----------------QLKCLKEAGHGPGKDEM--TDEELAEGEEEIDHAEREL-RRGQILWFRGLNRIQTQM---EVVSTFK 1108          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: mca-3 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:B7CED8])

HSP 1 Score: 1204.5 bits (3115), Expect = 0.000e+0
Identity = 672/1143 (58.79%), Postives = 829/1143 (72.53%), Query Frame = 1
Query:  670 DFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGL--QCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGD---HKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAA-SHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDI-NETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDI--VRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEE 4071
            ++  S++EL+ +ME R  EA   I   Y G +GLC  L+T P  GL    ++  RR  ++G+N IPP PPK F QLV+EA+QD+TL++L+++A++SL LS Y     D     D E + GWIEGVAIL +V++VV V A ND+ KERQFRGLQ KIE+EH+F V+R  QS ++ V +++VGDI QIKYGDL+P+DG+IIQSNDLK+DESSLTGESD ++K    DPI+LSGTHVMEGSGK+L+TAVGVNSQ GII  LLGAA +   E+R  A+    +  + + +      L  K +    +G+ ++  E+D                   KE SVLQ KLT+LAIQIGY G+ VA  TV ILII+FC  R+  DG+ +      Q  INF IIGVTVLVVAVPEGLPLAVT+SLAYSVKKMM DNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+FV   ++   PK   L      L++D ISINS Y+SQ++ P+   E  TQ+GNKTEC +LGFVL LG  +YQEIR++  E+ + KVYTFNSVRKSMSTVI L    GY +F+KGASEIV  +C Y +  NG +  FS  D E +V+ VIEPMAS+GLRTI +AYK+ + +S+    N+   + EPD+ENE  IV D+T +A++GI+DPVRPEVP AI +CQ+AGITVRMVTGDN+NTARSIAT CGILKPG+DF+ LEGKEFN RIR  + GEV Q+ +D +WP LRVLAR+ P DKY LV GII S +  +REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVN+VA+VVAFVGAC I D+PLKAVQMLWVNLIMDTLASLALATE+P EELL R PYGRT PLI+R M K I+G  +YQL+++  L+  GE   ++ SGR       S P++HFT +FNTFVMMTLFNEINARKIHG+RNIF+GL  N I+  IWIAT++SQ+VII+FGG   STSAL+   WLWC+ FG+GTL+WGQ++ SIP   +P  +                          + + +    +P+ P  YED D    RSGQILW+RGL+RLQTQ   L+VV+AF+ +LEE
Sbjct:    3 EYGASLEELRALMEYRSAEAKEKIETDYGGTTGLCERLKTDPNNGLPNNEEELERRRNVFGANEIPPHPPKCFLQLVWEALQDVTLVILLVSAIVSLALSFYRPPGEDTAGSDDSEHDAGWIEGVAILISVIVVVLVTALNDYTKERQFRGLQAKIETEHRFFVLRGGQSVQVVVNELVVGDIAQIKYGDLIPSDGIIIQSNDLKMDESSLTGESDQIRKSPEHDPIILSGTHVMEGSGKMLVTAVGVNSQTGIIMTLLGAAKTVAEEERKTAKREGGDGASGAEEGTAQALLDSKGDEAMANGKAVAAAESDGK-----------------KERSVLQAKLTRLAIQIGYAGSFVAGCTVLILIIRFCISRYAIDGKSFSLA-DFQHFINFLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMLDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSFVNDVHYKDTPKIESLDQNTAKLMMDCISINSSYSSQVIPPKQLGEQATQLGNKTECGMLGFVLALG-KSYQEIRDRHPEETIPKVYTFNSVRKSMSTVINLPD-GGYRVFSKGASEIVTKRCKYFLGKNGTLTKFSSKDAENLVRDVIEPMASDGLRTICVAYKDYVPSSKKTADNQIAYSSEPDWENEEMIVGDMTAIAVLGIQDPVRPEVPAAITRCQEAGITVRMVTGDNINTARSIATACGILKPGEDFIALEGKEFNARIRD-ENGEVSQEKLDLIWPKLRVLARAQPSDKYVLVKGIIDSRVTDSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVVVAFVGACAIQDTPLKAVQMLWVNLIMDTLASLALATEMPTEELLKRKPYGRTSPLISRTMCKNILGHAVYQLVILFTLIFYGEVCFNIPSGRWAPLH--SPPSKHFTIVFNTFVMMTLFNEINARKIHGERNIFKGLFSNPIYYVIWIATMISQVVIIQFGGRWFSTSALNTTEWLWCLAFGVGTLLWGQIVTSIPTGSLPANM-------------------------TIGSGEAPTNDPLMP-DYEDSDTHEKRSGQILWVRGLTRLQTQ---LRVVKAFRSSLEE 1093          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: mca-3 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:B7CED8])

HSP 1 Score: 1204.5 bits (3115), Expect = 0.000e+0
Identity = 672/1143 (58.79%), Postives = 829/1143 (72.53%), Query Frame = 1
Query:  670 DFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGL--QCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGD---HKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAA-SHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDI-NETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDI--VRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEE 4071
            ++  S++EL+ +ME R  EA   I   Y G +GLC  L+T P  GL    ++  RR  ++G+N IPP PPK F QLV+EA+QD+TL++L+++A++SL LS Y     D     D E + GWIEGVAIL +V++VV V A ND+ KERQFRGLQ KIE+EH+F V+R  QS ++ V +++VGDI QIKYGDL+P+DG+IIQSNDLK+DESSLTGESD ++K    DPI+LSGTHVMEGSGK+L+TAVGVNSQ GII  LLGAA +   E+R  A+    +  + + +      L  K +    +G+ ++  E+D                   KE SVLQ KLT+LAIQIGY G+ VA  TV ILII+FC  R+  DG+ +      Q  INF IIGVTVLVVAVPEGLPLAVT+SLAYSVKKMM DNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+FV   ++   PK   L      L++D ISINS Y+SQ++ P+   E  TQ+GNKTEC +LGFVL LG  +YQEIR++  E+ + KVYTFNSVRKSMSTVI L    GY +F+KGASEIV  +C Y +  NG +  FS  D E +V+ VIEPMAS+GLRTI +AYK+ + +S+    N+   + EPD+ENE  IV D+T +A++GI+DPVRPEVP AI +CQ+AGITVRMVTGDN+NTARSIAT CGILKPG+DF+ LEGKEFN RIR  + GEV Q+ +D +WP LRVLAR+ P DKY LV GII S +  +REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVN+VA+VVAFVGAC I D+PLKAVQMLWVNLIMDTLASLALATE+P EELL R PYGRT PLI+R M K I+G  +YQL+++  L+  GE   ++ SGR       S P++HFT +FNTFVMMTLFNEINARKIHG+RNIF+GL  N I+  IWIAT++SQ+VII+FGG   STSAL+   WLWC+ FG+GTL+WGQ++ SIP   +P  +                          + + +    +P+ P  YED D    RSGQILW+RGL+RLQTQ   L+VV+AF+ +LEE
Sbjct:    3 EYGASLEELRALMEYRSAEAKEKIETDYGGTTGLCERLKTDPNNGLPNNEEELERRRNVFGANEIPPHPPKCFLQLVWEALQDVTLVILLVSAIVSLALSFYRPPGEDTAGSDDSEHDAGWIEGVAILISVIVVVLVTALNDYTKERQFRGLQAKIETEHRFFVLRGGQSVQVVVNELVVGDIAQIKYGDLIPSDGIIIQSNDLKMDESSLTGESDQIRKSPEHDPIILSGTHVMEGSGKMLVTAVGVNSQTGIIMTLLGAAKTVAEEERKTAKREGGDGASGAEEGTAQALLDSKGDEAMANGKAVAAAESDGK-----------------KERSVLQAKLTRLAIQIGYAGSFVAGCTVLILIIRFCISRYAIDGKSFSLA-DFQHFINFLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMLDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSFVNDVHYKDTPKIESLDQNTAKLMMDCISINSSYSSQVIPPKQLGEQATQLGNKTECGMLGFVLALG-KSYQEIRDRHPEETIPKVYTFNSVRKSMSTVINLPD-GGYRVFSKGASEIVTKRCKYFLGKNGTLTKFSSKDAENLVRDVIEPMASDGLRTICVAYKDYVPSSKKTADNQIAYSSEPDWENEEMIVGDMTAIAVLGIQDPVRPEVPAAITRCQEAGITVRMVTGDNINTARSIATACGILKPGEDFIALEGKEFNARIRD-ENGEVSQEKLDLIWPKLRVLARAQPSDKYVLVKGIIDSRVTDSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVVVAFVGACAIQDTPLKAVQMLWVNLIMDTLASLALATEMPTEELLKRKPYGRTSPLISRTMCKNILGHAVYQLVILFTLIFYGEVCFNIPSGRWAPLH--SPPSKHFTIVFNTFVMMTLFNEINARKIHGERNIFKGLFSNPIYYVIWIATMISQVVIIQFGGRWFSTSALNTTEWLWCLAFGVGTLLWGQIVTSIPTGSLPANM-------------------------TIGSGEAPTNDPLMP-DYEDSDTHEKRSGQILWVRGLTRLQTQ---LRVVKAFRSSLEE 1093          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: mca-3 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:B7CED8])

HSP 1 Score: 1204.5 bits (3115), Expect = 0.000e+0
Identity = 672/1143 (58.79%), Postives = 829/1143 (72.53%), Query Frame = 1
Query:  670 DFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGL--QCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGD---HKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAA-SHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDI-NETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDI--VRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEE 4071
            ++  S++EL+ +ME R  EA   I   Y G +GLC  L+T P  GL    ++  RR  ++G+N IPP PPK F QLV+EA+QD+TL++L+++A++SL LS Y     D     D E + GWIEGVAIL +V++VV V A ND+ KERQFRGLQ KIE+EH+F V+R  QS ++ V +++VGDI QIKYGDL+P+DG+IIQSNDLK+DESSLTGESD ++K    DPI+LSGTHVMEGSGK+L+TAVGVNSQ GII  LLGAA +   E+R  A+    +  + + +      L  K +    +G+ ++  E+D                   KE SVLQ KLT+LAIQIGY G+ VA  TV ILII+FC  R+  DG+ +      Q  INF IIGVTVLVVAVPEGLPLAVT+SLAYSVKKMM DNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+FV   ++   PK   L      L++D ISINS Y+SQ++ P+   E  TQ+GNKTEC +LGFVL LG  +YQEIR++  E+ + KVYTFNSVRKSMSTVI L    GY +F+KGASEIV  +C Y +  NG +  FS  D E +V+ VIEPMAS+GLRTI +AYK+ + +S+    N+   + EPD+ENE  IV D+T +A++GI+DPVRPEVP AI +CQ+AGITVRMVTGDN+NTARSIAT CGILKPG+DF+ LEGKEFN RIR  + GEV Q+ +D +WP LRVLAR+ P DKY LV GII S +  +REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVN+VA+VVAFVGAC I D+PLKAVQMLWVNLIMDTLASLALATE+P EELL R PYGRT PLI+R M K I+G  +YQL+++  L+  GE   ++ SGR       S P++HFT +FNTFVMMTLFNEINARKIHG+RNIF+GL  N I+  IWIAT++SQ+VII+FGG   STSAL+   WLWC+ FG+GTL+WGQ++ SIP   +P  +                          + + +    +P+ P  YED D    RSGQILW+RGL+RLQTQ   L+VV+AF+ +LEE
Sbjct:    3 EYGASLEELRALMEYRSAEAKEKIETDYGGTTGLCERLKTDPNNGLPNNEEELERRRNVFGANEIPPHPPKCFLQLVWEALQDVTLVILLVSAIVSLALSFYRPPGEDTAGSDDSEHDAGWIEGVAILISVIVVVLVTALNDYTKERQFRGLQAKIETEHRFFVLRGGQSVQVVVNELVVGDIAQIKYGDLIPSDGIIIQSNDLKMDESSLTGESDQIRKSPEHDPIILSGTHVMEGSGKMLVTAVGVNSQTGIIMTLLGAAKTVAEEERKTAKREGGDGASGAEEGTAQALLDSKGDEAMANGKAVAAAESDGK-----------------KERSVLQAKLTRLAIQIGYAGSFVAGCTVLILIIRFCISRYAIDGKSFSLA-DFQHFINFLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMLDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSFVNDVHYKDTPKIESLDQNTAKLMMDCISINSSYSSQVIPPKQLGEQATQLGNKTECGMLGFVLALG-KSYQEIRDRHPEETIPKVYTFNSVRKSMSTVINLPD-GGYRVFSKGASEIVTKRCKYFLGKNGTLTKFSSKDAENLVRDVIEPMASDGLRTICVAYKDYVPSSKKTADNQIAYSSEPDWENEEMIVGDMTAIAVLGIQDPVRPEVPAAITRCQEAGITVRMVTGDNINTARSIATACGILKPGEDFIALEGKEFNARIRD-ENGEVSQEKLDLIWPKLRVLARAQPSDKYVLVKGIIDSRVTDSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVVVAFVGACAIQDTPLKAVQMLWVNLIMDTLASLALATEMPTEELLKRKPYGRTSPLISRTMCKNILGHAVYQLVILFTLIFYGEVCFNIPSGRWAPLH--SPPSKHFTIVFNTFVMMTLFNEINARKIHGERNIFKGLFSNPIYYVIWIATMISQVVIIQFGGRWFSTSALNTTEWLWCLAFGVGTLLWGQIVTSIPTGSLPANM-------------------------TIGSGEAPTNDPLMP-DYEDSDTHEKRSGQILWVRGLTRLQTQ---LRVVKAFRSSLEE 1093          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: mca-3 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:B7CED8])

HSP 1 Score: 1204.5 bits (3115), Expect = 0.000e+0
Identity = 672/1143 (58.79%), Postives = 829/1143 (72.53%), Query Frame = 1
Query:  670 DFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGL--QCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGD---HKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAA-SHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDI-NETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDI--VRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEE 4071
            ++  S++EL+ +ME R  EA   I   Y G +GLC  L+T P  GL    ++  RR  ++G+N IPP PPK F QLV+EA+QD+TL++L+++A++SL LS Y     D     D E + GWIEGVAIL +V++VV V A ND+ KERQFRGLQ KIE+EH+F V+R  QS ++ V +++VGDI QIKYGDL+P+DG+IIQSNDLK+DESSLTGESD ++K    DPI+LSGTHVMEGSGK+L+TAVGVNSQ GII  LLGAA +   E+R  A+    +  + + +      L  K +    +G+ ++  E+D                   KE SVLQ KLT+LAIQIGY G+ VA  TV ILII+FC  R+  DG+ +      Q  INF IIGVTVLVVAVPEGLPLAVT+SLAYSVKKMM DNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+FV   ++   PK   L      L++D ISINS Y+SQ++ P+   E  TQ+GNKTEC +LGFVL LG  +YQEIR++  E+ + KVYTFNSVRKSMSTVI L    GY +F+KGASEIV  +C Y +  NG +  FS  D E +V+ VIEPMAS+GLRTI +AYK+ + +S+    N+   + EPD+ENE  IV D+T +A++GI+DPVRPEVP AI +CQ+AGITVRMVTGDN+NTARSIAT CGILKPG+DF+ LEGKEFN RIR  + GEV Q+ +D +WP LRVLAR+ P DKY LV GII S +  +REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVN+VA+VVAFVGAC I D+PLKAVQMLWVNLIMDTLASLALATE+P EELL R PYGRT PLI+R M K I+G  +YQL+++  L+  GE   ++ SGR       S P++HFT +FNTFVMMTLFNEINARKIHG+RNIF+GL  N I+  IWIAT++SQ+VII+FGG   STSAL+   WLWC+ FG+GTL+WGQ++ SIP   +P  +                          + + +    +P+ P  YED D    RSGQILW+RGL+RLQTQ   L+VV+AF+ +LEE
Sbjct:    3 EYGASLEELRALMEYRSAEAKEKIETDYGGTTGLCERLKTDPNNGLPNNEEELERRRNVFGANEIPPHPPKCFLQLVWEALQDVTLVILLVSAIVSLALSFYRPPGEDTAGSDDSEHDAGWIEGVAILISVIVVVLVTALNDYTKERQFRGLQAKIETEHRFFVLRGGQSVQVVVNELVVGDIAQIKYGDLIPSDGIIIQSNDLKMDESSLTGESDQIRKSPEHDPIILSGTHVMEGSGKMLVTAVGVNSQTGIIMTLLGAAKTVAEEERKTAKREGGDGASGAEEGTAQALLDSKGDEAMANGKAVAAAESDGK-----------------KERSVLQAKLTRLAIQIGYAGSFVAGCTVLILIIRFCISRYAIDGKSFSLA-DFQHFINFLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMLDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSFVNDVHYKDTPKIESLDQNTAKLMMDCISINSSYSSQVIPPKQLGEQATQLGNKTECGMLGFVLALG-KSYQEIRDRHPEETIPKVYTFNSVRKSMSTVINLPD-GGYRVFSKGASEIVTKRCKYFLGKNGTLTKFSSKDAENLVRDVIEPMASDGLRTICVAYKDYVPSSKKTADNQIAYSSEPDWENEEMIVGDMTAIAVLGIQDPVRPEVPAAITRCQEAGITVRMVTGDNINTARSIATACGILKPGEDFIALEGKEFNARIRD-ENGEVSQEKLDLIWPKLRVLARAQPSDKYVLVKGIIDSRVTDSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVVVAFVGACAIQDTPLKAVQMLWVNLIMDTLASLALATEMPTEELLKRKPYGRTSPLISRTMCKNILGHAVYQLVILFTLIFYGEVCFNIPSGRWAPLH--SPPSKHFTIVFNTFVMMTLFNEINARKIHGERNIFKGLFSNPIYYVIWIATMISQVVIIQFGGRWFSTSALNTTEWLWCLAFGVGTLLWGQIVTSIPTGSLPANM-------------------------TIGSGEAPTNDPLMP-DYEDSDTHEKRSGQILWVRGLTRLQTQ---LRVVKAFRSSLEE 1093          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: mca-3 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:B7CED8])

HSP 1 Score: 1197.96 bits (3098), Expect = 0.000e+0
Identity = 669/1142 (58.58%), Postives = 827/1142 (72.42%), Query Frame = 1
Query:  670 DFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGL--QCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGD---HKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAA-SHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDI-NETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDI--VRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLE 4068
            ++  S++EL+ +ME R  EA   I   Y G +GLC  L+T P  GL    ++  RR  ++G+N IPP PPK F QLV+EA+QD+TL++L+++A++SL LS Y     D     D E + GWIEGVAIL +V++VV V A ND+ KERQFRGLQ KIE+EH+F V+R  QS ++ V +++VGDI QIKYGDL+P+DG+IIQSNDLK+DESSLTGESD ++K    DPI+LSGTHVMEGSGK+L+TAVGVNSQ GII  LLGAA +   E+R  A+    +  + + +      L  K +    +G+ ++  E+D                   KE SVLQ KLT+LAIQIGY G+ VA  TV ILII+FC  R+  DG+ +      Q  INF IIGVTVLVVAVPEGLPLAVT+SLAYSVKKMM DNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+FV   ++   PK   L      L++D ISINS Y+SQ++ P+   E  TQ+GNKTEC +LGFVL LG  +YQEIR++  E+ + KVYTFNSVRKSMSTVI L    GY +F+KGASEIV  +C Y +  NG +  FS  D E +V+ VIEPMAS+GLRTI +AYK+ + +S+    N+   + EPD+ENE  IV D+T +A++GI+DPVRPEVP AI +CQ+AGITVRMVTGDN+NTARSIAT CGILKPG+DF+ LEGKEFN RIR  + GEV Q+ +D +WP LRVLAR+ P DKY LV GII S +  +REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVN+VA+VVAFVGAC I D+PLKAVQMLWVNLIMDTLASLALATE+P EELL R PYGRT PLI+R M K I+G  +YQL+++  L+  GE   ++ SGR       S P++HFT +FNTFVMMTLFNEINARKIHG+RNIF+GL  N I+  IWIAT++SQ+VII+FGG   STSAL+   WLWC+ FG+GTL+WGQ++ SIP   +P  +                          + + +    +P+ P  YED D    RSGQILW+RGL+RLQTQ   ++VV+AF+  L+
Sbjct:    3 EYGASLEELRALMEYRSAEAKEKIETDYGGTTGLCERLKTDPNNGLPNNEEELERRRNVFGANEIPPHPPKCFLQLVWEALQDVTLVILLVSAIVSLALSFYRPPGEDTAGSDDSEHDAGWIEGVAILISVIVVVLVTALNDYTKERQFRGLQAKIETEHRFFVLRGGQSVQVVVNELVVGDIAQIKYGDLIPSDGIIIQSNDLKMDESSLTGESDQIRKSPEHDPIILSGTHVMEGSGKMLVTAVGVNSQTGIIMTLLGAAKTVAEEERKTAKREGGDGASGAEEGTAQALLDSKGDEAMANGKAVAAAESDGK-----------------KERSVLQAKLTRLAIQIGYAGSFVAGCTVLILIIRFCISRYAIDGKSFSLA-DFQHFINFLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMLDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSFVNDVHYKDTPKIESLDQNTAKLMMDCISINSSYSSQVIPPKQLGEQATQLGNKTECGMLGFVLALG-KSYQEIRDRHPEETIPKVYTFNSVRKSMSTVINLPD-GGYRVFSKGASEIVTKRCKYFLGKNGTLTKFSSKDAENLVRDVIEPMASDGLRTICVAYKDYVPSSKKTADNQIAYSSEPDWENEEMIVGDMTAIAVLGIQDPVRPEVPAAITRCQEAGITVRMVTGDNINTARSIATACGILKPGEDFIALEGKEFNARIRD-ENGEVSQEKLDLIWPKLRVLARAQPSDKYVLVKGIIDSRVTDSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVVVAFVGACAIQDTPLKAVQMLWVNLIMDTLASLALATEMPTEELLKRKPYGRTSPLISRTMCKNILGHAVYQLVILFTLIFYGEVCFNIPSGRWAPLH--SPPSKHFTIVFNTFVMMTLFNEINARKIHGERNIFKGLFSNPIYYVIWIATMISQVVIIQFGGRWFSTSALNTTEWLWCLAFGVGTLLWGQIVTSIPTGSLPANM-------------------------TIGSGEAPTNDPLMP-DYEDSDTHEKRSGQILWVRGLTRLQTQ---IRVVKAFQAGLD 1092          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: PMCA (gene:FBgn0259214 transcript:FBtr0304050)

HSP 1 Score: 1275.77 bits (3300), Expect = 0.000e+0
Identity = 704/1159 (60.74%), Postives = 860/1159 (74.20%), Query Frame = 1
Query:  646 ATGDRGRADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGL---QCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDH---KDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELE----------DRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANY-ENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEE 4071
            AT D   A + +S+K+L+++ME RG E +  I     GI  LC  L TSP EGL   + D+  RR E +GSNVIPPKPPKTF  LV+EA+QD+TLI+L +AAL+SLGLS Y     D    +++E   GWIEG+AIL +V++VV V AFND+ KERQFRGLQN+IE EHKF VIR  +  +I+VGDILVGDI Q+KYGDLLPADG +IQSNDLK+DESSLTGESD VKKG + DP+VLSGTHVMEGSGK+++TAVGVNSQAGIIF LLGAA  E E           R N Q+N        +Q+K     + +  VTSE    ++  E++  N   +S      ++   KE SVLQ KLTKLAIQIGY G+ +A++TV ILII+FC   F  D + WK   +   ++   IIGVTVLVVAVPEGLPLAVT+SLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+++       LP  S++      L+   IS+NS YTS +M      +LP QVGNKTECALLGFV  LG   YQ IR++ TEDK  +VYTFNSVRKSM TVIP     GY ++TKGASEI+M KC++I    G +  F++  QE++++ VIEPMA +GLRTI +AY++ +   +  INE  I  EP++++E  I+++LTCL +VGIEDPVRPEVP+AI KCQ+AGITVRMVTGDN+NTARSIA+KCGIL+P DDFL+LEGKEFN+RIR    G+++Q LIDKVWP LRVLARSSP DKYTLV GII S ++  REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVN+VA++VAF+GAC + DSPLKAVQMLWVNLIMDTLASLALATE P  +LL R PYGRTKPLI+R M+K I+GQ +YQLI+I  LL  G+ +LD++SGR    +  + PT+HFT IFNTFVMMTLFNEINARKIHGQRN+ EGL  N IF  IWI T++SQ++II++G  A ST AL  D WLWC+FFG+GTLVWGQ++ S+P   +PK L W +           ++  +G N  E   +S + D++P            R+GQILWIRGL+RLQTQ   L+V+RAF+ TLE+
Sbjct:    2 ATIDGRPAQYGISLKQLRELMEHRGREGVMKIAEN-GGIHELCKKLYTSPNEGLSGSKADEEHRR-ETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVLQEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGTHVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDGRSQIKGSQAPSQRETVTSE----ITKSESEG-NHLPQSSSSGAAETGHKKEKSVLQAKLTKLAIQIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKN-TYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEKLCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQGLG-VKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIP-RPNGGYRLYTKGASEIIMKKCAFIYGHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFV-PGKAAINEVHIDGEPNWDDEENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILRPNDDFLILEGKEFNRRIRD-SNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVSENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEFPTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGR--GQELNAGPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQYGKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGR--------GHPEEYTDGMNLGEERFDSIDSDKKP------------RAGQILWIRGLTRLQTQ---LRVIRAFRSTLED 1123          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: PMCA (gene:FBgn0259214 transcript:FBtr0300558)

HSP 1 Score: 1275.77 bits (3300), Expect = 0.000e+0
Identity = 704/1159 (60.74%), Postives = 860/1159 (74.20%), Query Frame = 1
Query:  646 ATGDRGRADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGL---QCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDH---KDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELE----------DRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANY-ENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEE 4071
            AT D   A + +S+K+L+++ME RG E +  I     GI  LC  L TSP EGL   + D+  RR E +GSNVIPPKPPKTF  LV+EA+QD+TLI+L +AAL+SLGLS Y     D    +++E   GWIEG+AIL +V++VV V AFND+ KERQFRGLQN+IE EHKF VIR  +  +I+VGDILVGDI Q+KYGDLLPADG +IQSNDLK+DESSLTGESD VKKG + DP+VLSGTHVMEGSGK+++TAVGVNSQAGIIF LLGAA  E E           R N Q+N        +Q+K     + +  VTSE    ++  E++  N   +S      ++   KE SVLQ KLTKLAIQIGY G+ +A++TV ILII+FC   F  D + WK   +   ++   IIGVTVLVVAVPEGLPLAVT+SLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+++       LP  S++      L+   IS+NS YTS +M      +LP QVGNKTECALLGFV  LG   YQ IR++ TEDK  +VYTFNSVRKSM TVIP     GY ++TKGASEI+M KC++I    G +  F++  QE++++ VIEPMA +GLRTI +AY++ +   +  INE  I  EP++++E  I+++LTCL +VGIEDPVRPEVP+AI KCQ+AGITVRMVTGDN+NTARSIA+KCGIL+P DDFL+LEGKEFN+RIR    G+++Q LIDKVWP LRVLARSSP DKYTLV GII S ++  REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVN+VA++VAF+GAC + DSPLKAVQMLWVNLIMDTLASLALATE P  +LL R PYGRTKPLI+R M+K I+GQ +YQLI+I  LL  G+ +LD++SGR    +  + PT+HFT IFNTFVMMTLFNEINARKIHGQRN+ EGL  N IF  IWI T++SQ++II++G  A ST AL  D WLWC+FFG+GTLVWGQ++ S+P   +PK L W +           ++  +G N  E   +S + D++P            R+GQILWIRGL+RLQTQ   L+V+RAF+ TLE+
Sbjct:    2 ATIDGRPAQYGISLKQLRELMEHRGREGVMKIAEN-GGIHELCKKLYTSPNEGLSGSKADEEHRR-ETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVLQEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGTHVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDGRSQIKGSQAPSQRETVTSE----ITKSESEG-NHLPQSSSSGAAETGHKKEKSVLQAKLTKLAIQIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKN-TYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEKLCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQGLG-VKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIP-RPNGGYRLYTKGASEIIMKKCAFIYGHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFV-PGKAAINEVHIDGEPNWDDEENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILRPNDDFLILEGKEFNRRIRD-SNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVSENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEFPTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGR--GQELNAGPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQYGKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGR--------GHPEEYTDGMNLGEERFDSIDSDKKP------------RAGQILWIRGLTRLQTQ---LRVIRAFRSTLED 1123          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: PMCA (gene:FBgn0259214 transcript:FBtr0300555)

HSP 1 Score: 1275.77 bits (3300), Expect = 0.000e+0
Identity = 704/1159 (60.74%), Postives = 860/1159 (74.20%), Query Frame = 1
Query:  646 ATGDRGRADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGL---QCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDH---KDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELE----------DRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANY-ENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEE 4071
            AT D   A + +S+K+L+++ME RG E +  I     GI  LC  L TSP EGL   + D+  RR E +GSNVIPPKPPKTF  LV+EA+QD+TLI+L +AAL+SLGLS Y     D    +++E   GWIEG+AIL +V++VV V AFND+ KERQFRGLQN+IE EHKF VIR  +  +I+VGDILVGDI Q+KYGDLLPADG +IQSNDLK+DESSLTGESD VKKG + DP+VLSGTHVMEGSGK+++TAVGVNSQAGIIF LLGAA  E E           R N Q+N        +Q+K     + +  VTSE    ++  E++  N   +S      ++   KE SVLQ KLTKLAIQIGY G+ +A++TV ILII+FC   F  D + WK   +   ++   IIGVTVLVVAVPEGLPLAVT+SLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+++       LP  S++      L+   IS+NS YTS +M      +LP QVGNKTECALLGFV  LG   YQ IR++ TEDK  +VYTFNSVRKSM TVIP     GY ++TKGASEI+M KC++I    G +  F++  QE++++ VIEPMA +GLRTI +AY++ +   +  INE  I  EP++++E  I+++LTCL +VGIEDPVRPEVP+AI KCQ+AGITVRMVTGDN+NTARSIA+KCGIL+P DDFL+LEGKEFN+RIR    G+++Q LIDKVWP LRVLARSSP DKYTLV GII S ++  REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVN+VA++VAF+GAC + DSPLKAVQMLWVNLIMDTLASLALATE P  +LL R PYGRTKPLI+R M+K I+GQ +YQLI+I  LL  G+ +LD++SGR    +  + PT+HFT IFNTFVMMTLFNEINARKIHGQRN+ EGL  N IF  IWI T++SQ++II++G  A ST AL  D WLWC+FFG+GTLVWGQ++ S+P   +PK L W +           ++  +G N  E   +S + D++P            R+GQILWIRGL+RLQTQ   L+V+RAF+ TLE+
Sbjct:    2 ATIDGRPAQYGISLKQLRELMEHRGREGVMKIAEN-GGIHELCKKLYTSPNEGLSGSKADEEHRR-ETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVLQEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGTHVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDGRSQIKGSQAPSQRETVTSE----ITKSESEG-NHLPQSSSSGAAETGHKKEKSVLQAKLTKLAIQIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKN-TYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEKLCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQGLG-VKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIP-RPNGGYRLYTKGASEIIMKKCAFIYGHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFV-PGKAAINEVHIDGEPNWDDEENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILRPNDDFLILEGKEFNRRIRD-SNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVSENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEFPTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGR--GQELNAGPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQYGKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGR--------GHPEEYTDGMNLGEERFDSIDSDKKP------------RAGQILWIRGLTRLQTQ---LRVIRAFRSTLED 1123          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: PMCA (gene:FBgn0259214 transcript:FBtr0304048)

HSP 1 Score: 1269.22 bits (3283), Expect = 0.000e+0
Identity = 701/1159 (60.48%), Postives = 859/1159 (74.12%), Query Frame = 1
Query:  646 ATGDRGRADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGL---QCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDH---KDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELE----------DRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANY-ENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNT-LKVVRAFKCTLE 4068
            AT D   A + +S+K+L+++ME RG E +  I     GI  LC  L TSP EGL   + D+  RR E +GSNVIPPKPPKTF  LV+EA+QD+TLI+L +AAL+SLGLS Y     D    +++E   GWIEG+AIL +V++VV V AFND+ KERQFRGLQN+IE EHKF VIR  +  +I+VGDILVGDI Q+KYGDLLPADG +IQSNDLK+DESSLTGESD VKKG + DP+VLSGTHVMEGSGK+++TAVGVNSQAGIIF LLGAA  E E           R N Q+N        +Q+K     + +  VTSE    ++  E++  N   +S      ++   KE SVLQ KLTKLAIQIGY G+ +A++TV ILII+FC   F  D + WK   +   ++   IIGVTVLVVAVPEGLPLAVT+SLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+++       LP  S++      L+   IS+NS YTS +M      +LP QVGNKTECALLGFV  LG   YQ IR++ TEDK  +VYTFNSVRKSM TVIP     GY ++TKGASEI+M KC++I    G +  F++  QE++++ VIEPMA +GLRTI +AY++ +   +  INE  I  EP++++E  I+++LTCL +VGIEDPVRPEVP+AI KCQ+AGITVRMVTGDN+NTARSIA+KCGIL+P DDFL+LEGKEFN+RIR    G+++Q LIDKVWP LRVLARSSP DKYTLV GII S ++  REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVN+VA++VAF+GAC + DSPLKAVQMLWVNLIMDTLASLALATE P  +LL R PYGRTKPLI+R M+K I+GQ +YQLI+I  LL  G+ +LD++SGR    +  + PT+HFT IFNTFVMMTLFNEINARKIHGQRN+ EGL  N IF  IWI T++SQ++II++G  A ST AL  D WLWC+FFG+GTLVWGQ++ S+P   +PK L W +           ++  +G N  E   +S + D++P            R+GQILWIRGL+RLQTQ++  ++VV AF+  L+
Sbjct:    2 ATIDGRPAQYGISLKQLRELMEHRGREGVMKIAEN-GGIHELCKKLYTSPNEGLSGSKADEEHRR-ETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVLQEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGTHVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDGRSQIKGSQAPSQRETVTSE----ITKSESEG-NHLPQSSSSGAAETGHKKEKSVLQAKLTKLAIQIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKN-TYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEKLCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQGLG-VKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIP-RPNGGYRLYTKGASEIIMKKCAFIYGHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFV-PGKAAINEVHIDGEPNWDDEENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILRPNDDFLILEGKEFNRRIRD-SNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVSENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEFPTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGR--GQELNAGPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQYGKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGR--------GHPEEYTDGMNLGEERFDSIDSDKKP------------RAGQILWIRGLTRLQTQISVPIRVVNAFRQGLD 1126          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: PMCA (gene:FBgn0259214 transcript:FBtr0300556)

HSP 1 Score: 1267.68 bits (3279), Expect = 0.000e+0
Identity = 701/1158 (60.54%), Postives = 857/1158 (74.01%), Query Frame = 1
Query:  646 ATGDRGRADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGL---QCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDH---KDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELE----------DRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANY-ENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLE 4068
            AT D   A + +S+K+L+++ME RG E +  I     GI  LC  L TSP EGL   + D+  RR E +GSNVIPPKPPKTF  LV+EA+QD+TLI+L +AAL+SLGLS Y     D    +++E   GWIEG+AIL +V++VV V AFND+ KERQFRGLQN+IE EHKF VIR  +  +I+VGDILVGDI Q+KYGDLLPADG +IQSNDLK+DESSLTGESD VKKG + DP+VLSGTHVMEGSGK+++TAVGVNSQAGIIF LLGAA  E E           R N Q+N        +Q+K     + +  VTSE    ++  E++  N   +S      ++   KE SVLQ KLTKLAIQIGY G+ +A++TV ILII+FC   F  D + WK   +   ++   IIGVTVLVVAVPEGLPLAVT+SLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+++       LP  S++      L+   IS+NS YTS +M      +LP QVGNKTECALLGFV  LG   YQ IR++ TEDK  +VYTFNSVRKSM TVIP     GY ++TKGASEI+M KC++I    G +  F++  QE++++ VIEPMA +GLRTI +AY++ +   +  INE  I  EP++++E  I+++LTCL +VGIEDPVRPEVP+AI KCQ+AGITVRMVTGDN+NTARSIA+KCGIL+P DDFL+LEGKEFN+RIR    G+++Q LIDKVWP LRVLARSSP DKYTLV GII S ++  REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVN+VA++VAF+GAC + DSPLKAVQMLWVNLIMDTLASLALATE P  +LL R PYGRTKPLI+R M+K I+GQ +YQLI+I  LL  G+ +LD++SGR    +  + PT+HFT IFNTFVMMTLFNEINARKIHGQRN+ EGL  N IF  IWI T++SQ++II++G  A ST AL  D WLWC+FFG+GTLVWGQ++ S+P   +PK L W +           ++  +G N  E   +S + D++P            R+GQILWIRGL+RLQTQ   ++VV AF+  L+
Sbjct:    2 ATIDGRPAQYGISLKQLRELMEHRGREGVMKIAEN-GGIHELCKKLYTSPNEGLSGSKADEEHRR-ETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVLQEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGTHVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDGRSQIKGSQAPSQRETVTSE----ITKSESEG-NHLPQSSSSGAAETGHKKEKSVLQAKLTKLAIQIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKN-TYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEKLCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQGLG-VKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIP-RPNGGYRLYTKGASEIIMKKCAFIYGHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFV-PGKAAINEVHIDGEPNWDDEENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILRPNDDFLILEGKEFNRRIRD-SNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVSENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEFPTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGR--GQELNAGPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQYGKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGR--------GHPEEYTDGMNLGEERFDSIDSDKKP------------RAGQILWIRGLTRLQTQ---IRVVNAFRQGLD 1122          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2b4 (ATPase plasma membrane Ca2+ transporting 4 [Source:ZFIN;Acc:ZDB-GENE-061027-60])

HSP 1 Score: 1199.88 bits (3103), Expect = 0.000e+0
Identity = 669/1158 (57.77%), Postives = 835/1158 (72.11%), Query Frame = 1
Query:  667 ADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCD--DFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDHK----------DDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQ-----ENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWK---TGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKK--KKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEA 4074
             DF  ++ +L+++MELR  EA++ I   Y  + G+C  L+TSP EGL  +  D  +R   +G N IPPK PKTF QLV+EA+QD+TLI+L +AA+ISL LS Y    GD+           + E++ GWIEG AIL +V++VV V AFNDW KE+QFRGLQ++IE E KF VIR  Q  +I V +I+VGDI QIKYGDLLPADG++IQ NDLK+DESSLTGESD V+K    DP++LSGTHVMEGSG+++++AVG+NSQ GIIF LLGA   E +     +     EN+N  KT     ++GI L ++   + E  E     E +     + +  KK        E SVLQ KLT+LA+QIG  G I++ VTV ILI+ F    F  +G +WK   T +++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQA++  +++  +P+   +  +   +LV++ISINS YT++++ P  +  LP  VGNKTECALLG VLEL    YQ IR++  E+KL KVYTFNS RKSMSTVI   S  G+ +++KGASEIV+ KCS+I+  +GQ   F   D++++VQ VIEPMA +GLRTI +A ++              + EPD++NEA I++DLTC+ +VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTAR+IATKCGIL+PG+DFL LEGK+FNQ+IR+ K GEV Q+ +DKVWP LRVLARSSP DK+TLV GII S +  TR+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDTLASLALATE P E LL R PYGR KPLI+R M+K I+G  IYQL++   LL AGE   ++DSGR+      S+P+EH+T IFN FVMM LFNEINARKIHG+RN+FEG+ RN IF  + + T   QI+I++FGG   S +AL  D WLWC+F G+G L+WGQ++ +IP      RL ++K+    IP     ++D+AE    E  +  D  + E            +R GQILW RGL+R+QTQ   +KVV AF+ +L E 
Sbjct:   21 GDFGCTMMQLRELMELRSGEAVSKIAECYGDVQGICRRLKTSPIEGLSGNPADIEKRHTSFGKNFIPPKKPKTFLQLVWEALQDVTLIILEVAAIISLALSFYHPPEGDNAACGEVGGVEDEGESQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRKGQVIQIPVAEIVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLTGESDQVRKSLEKDPMLLSGTHVMEGSGRMVVSAVGLNSQTGIIFTLLGAGEDEEKKVKKGKKQGPPENRNKAKT-----QDGIALEIQPLKSEEGVESEEKEEKEEKEKKKVNVTKK--------EKSVLQGKLTRLAVQIGKAGLIMSAVTVVILILYFVIKTFGIEGIEWKAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYIGDTHYKTVPEPEAIKPEILEILVNSISINSAYTTKILPPEKEGGLPRHVGNKTECALLGLVLELKR-DYQPIRDEVPEEKLYKVYTFNSSRKSMSTVIKNSSGPGFRMYSKGASEIVLRKCSHILDASGQQRVFKAKDRDEMVQKVIEPMACDGLRTICVAMRD-------------FSTEPDWDNEADILNDLTCICVVGIEDPVRPEVPEAISKCQRAGITVRMVTGDNINTARAIATKCGILQPGEDFLCLEGKDFNQQIRNDK-GEVEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTVGETRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAIYQLVITFTLLFAGEKFFNIDSGRSALLH--SQPSEHYTIIFNVFVMMQLFNEINARKIHGERNVFEGIYRNPIFCSVVLGTFALQIIIVQFGGKPFSCTALTIDQWLWCIFIGVGELLWGQLITAIPT----HRLKFLKEAGHGIP-----KEDIAEEVLIEGADEIDHAEME------------LRRGQILWFRGLNRIQTQ---IKVVNAFRSSLYEG 1124          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2b4 (ATPase plasma membrane Ca2+ transporting 4 [Source:ZFIN;Acc:ZDB-GENE-061027-60])

HSP 1 Score: 1199.88 bits (3103), Expect = 0.000e+0
Identity = 669/1158 (57.77%), Postives = 835/1158 (72.11%), Query Frame = 1
Query:  667 ADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCD--DFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDHK----------DDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQ-----ENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWK---TGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKK--KKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEA 4074
             DF  ++ +L+++MELR  EA++ I   Y  + G+C  L+TSP EGL  +  D  +R   +G N IPPK PKTF QLV+EA+QD+TLI+L +AA+ISL LS Y    GD+           + E++ GWIEG AIL +V++VV V AFNDW KE+QFRGLQ++IE E KF VIR  Q  +I V +I+VGDI QIKYGDLLPADG++IQ NDLK+DESSLTGESD V+K    DP++LSGTHVMEGSG+++++AVG+NSQ GIIF LLGA   E +     +     EN+N  KT     ++GI L ++   + E  E     E +     + +  KK        E SVLQ KLT+LA+QIG  G I++ VTV ILI+ F    F  +G +WK   T +++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQA++  +++  +P+   +  +   +LV++ISINS YT++++ P  +  LP  VGNKTECALLG VLEL    YQ IR++  E+KL KVYTFNS RKSMSTVI   S  G+ +++KGASEIV+ KCS+I+  +GQ   F   D++++VQ VIEPMA +GLRTI +A ++              + EPD++NEA I++DLTC+ +VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTAR+IATKCGIL+PG+DFL LEGK+FNQ+IR+ K GEV Q+ +DKVWP LRVLARSSP DK+TLV GII S +  TR+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDTLASLALATE P E LL R PYGR KPLI+R M+K I+G  IYQL++   LL AGE   ++DSGR+      S+P+EH+T IFN FVMM LFNEINARKIHG+RN+FEG+ RN IF  + + T   QI+I++FGG   S +AL  D WLWC+F G+G L+WGQ++ +IP      RL ++K+    IP     ++D+AE    E  +  D  + E            +R GQILW RGL+R+QTQ   +KVV AF+ +L E 
Sbjct:   21 GDFGCTMMQLRELMELRSGEAVSKIAECYGDVQGICRRLKTSPIEGLSGNPADIEKRHTSFGKNFIPPKKPKTFLQLVWEALQDVTLIILEVAAIISLALSFYHPPEGDNAACGEVGGVEDEGESQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRKGQVIQIPVAEIVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLTGESDQVRKSLEKDPMLLSGTHVMEGSGRMVVSAVGLNSQTGIIFTLLGAGEDEEKKVKKGKKQGPPENRNKAKT-----QDGIALEIQPLKSEEGVESEEKEEKEEKEKKKVNVTKK--------EKSVLQGKLTRLAVQIGKAGLIMSAVTVVILILYFVIKTFGIEGIEWKAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYIGDTHYKTVPEPEAIKPEILEILVNSISINSAYTTKILPPEKEGGLPRHVGNKTECALLGLVLELKR-DYQPIRDEVPEEKLYKVYTFNSSRKSMSTVIKNSSGPGFRMYSKGASEIVLRKCSHILDASGQQRVFKAKDRDEMVQKVIEPMACDGLRTICVAMRD-------------FSTEPDWDNEADILNDLTCICVVGIEDPVRPEVPEAISKCQRAGITVRMVTGDNINTARAIATKCGILQPGEDFLCLEGKDFNQQIRNDK-GEVEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTVGETRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAIYQLVITFTLLFAGEKFFNIDSGRSALLH--SQPSEHYTIIFNVFVMMQLFNEINARKIHGERNVFEGIYRNPIFCSVVLGTFALQIIIVQFGGKPFSCTALTIDQWLWCIFIGVGELLWGQLITAIPT----HRLKFLKEAGHGIP-----KEDIAEEVLIEGADEIDHAEME------------LRRGQILWFRGLNRIQTQ---IKVVNAFRSSLYEG 1124          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2b4 (ATPase plasma membrane Ca2+ transporting 4 [Source:ZFIN;Acc:ZDB-GENE-061027-60])

HSP 1 Score: 1196.8 bits (3095), Expect = 0.000e+0
Identity = 659/1140 (57.81%), Postives = 822/1140 (72.11%), Query Frame = 1
Query:  667 ADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCD--DFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDHK----------DDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWK---TGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKK--KKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTL 4035
             DF  ++ +L+++MELR  EA++ I   Y  + G+C  L+TSP EGL  +  D  +R   +G N IPPK PKTF QLV+EA+QD+TLI+L +AA+ISL LS Y    GD+           + E++ GWIEG AIL +V++VV V AFNDW KE+QFRGLQ++IE E KF VIR  Q  +I V +I+VGDI QIKYGDLLPADG++IQ NDLK+DESSLTGESD V+K    DP++LSGTHVMEGSG+++++AVG+NSQ GIIF LLGA   E              K    + ++GI L ++   + E  E     E +     + +  KK        E SVLQ KLT+LA+QIG  G I++ VTV ILI+ F    F  +G +WK   T +++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQA++  +++  +P+   +  +   +LV++ISINS YT++++ P  +  LP  VGNKTECALLG VLEL    YQ IR++  E+KL KVYTFNS RKSMSTVI   S  G+ +++KGASEIV+ KCS+I+  +GQ   F   D++++VQ VIEPMA +GLRTI +A ++              + EPD++NEA I++DLTC+ +VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTAR+IATKCGIL+PG+DFL LEGK+FNQ+IR+ K GEV Q+ +DKVWP LRVLARSSP DK+TLV GII S +  TR+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDTLASLALATE P E LL R PYGR KPLI+R M+K I+G  IYQL++   LL AGE   ++DSGR+      S+P+EH+T IFN FVMM LFNEINARKIHG+RN+FEG+ RN IF  + + T   QI+I++FGG   S +AL  D WLWC+F G+G L+WGQ++ +IP      RL ++K+    IP     ++D+AE    E  +  D  + E            +R GQILW RGL+R+QTQM+ +
Sbjct:   21 GDFGCTMMQLRELMELRSGEAVSKIAECYGDVQGICRRLKTSPIEGLSGNPADIEKRHTSFGKNFIPPKKPKTFLQLVWEALQDVTLIILEVAAIISLALSFYHPPEGDNAACGEVGGVEDEGESQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRKGQVIQIPVAEIVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLTGESDQVRKSLEKDPMLLSGTHVMEGSGRMVVSAVGLNSQTGIIFTLLGAGEDE------------EKKVKKAKTQDGIALEIQPLKSEEGVESEEKEEKEEKEKKKVNVTKK--------EKSVLQGKLTRLAVQIGKAGLIMSAVTVVILILYFVIKTFGIEGIEWKAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYIGDTHYKTVPEPEAIKPEILEILVNSISINSAYTTKILPPEKEGGLPRHVGNKTECALLGLVLELK-RDYQPIRDEVPEEKLYKVYTFNSSRKSMSTVIKNSSGPGFRMYSKGASEIVLRKCSHILDASGQQRVFKAKDRDEMVQKVIEPMACDGLRTICVAMRD-------------FSTEPDWDNEADILNDLTCICVVGIEDPVRPEVPEAISKCQRAGITVRMVTGDNINTARAIATKCGILQPGEDFLCLEGKDFNQQIRNDK-GEVEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTVGETRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAIYQLVITFTLLFAGEKFFNIDSGRSALLH--SQPSEHYTIIFNVFVMMQLFNEINARKIHGERNVFEGIYRNPIFCSVVLGTFALQIIIVQFGGKPFSCTALTIDQWLWCIFIGVGELLWGQLITAIPT----HRLKFLKEAGHGIP-----KEDIAEEVLIEGADEIDHAEME------------LRRGQILWFRGLNRIQTQMDVV 1102          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2b4 (ATPase plasma membrane Ca2+ transporting 4 [Source:ZFIN;Acc:ZDB-GENE-061027-60])

HSP 1 Score: 1195.65 bits (3092), Expect = 0.000e+0
Identity = 663/1145 (57.90%), Postives = 828/1145 (72.31%), Query Frame = 1
Query:  667 ADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCD--DFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDHK----------DDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQ-----ENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWK---TGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKK--KKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTL 4035
             DF  ++ +L+++MELR  EA++ I   Y  + G+C  L+TSP EGL  +  D  +R   +G N IPPK PKTF QLV+EA+QD+TLI+L +AA+ISL LS Y    GD+           + E++ GWIEG AIL +V++VV V AFNDW KE+QFRGLQ++IE E KF VIR  Q  +I V +I+VGDI QIKYGDLLPADG++IQ NDLK+DESSLTGESD V+K    DP++LSGTHVMEGSG+++++AVG+NSQ GIIF LLGA   E +     +     EN+N  KT     ++GI L ++   + E  E     E +     + +  KK        E SVLQ KLT+LA+QIG  G I++ VTV ILI+ F    F  +G +WK   T +++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQA++  +++  +P+   +  +   +LV++ISINS YT++++ P  +  LP  VGNKTECALLG VLEL    YQ IR++  E+KL KVYTFNS RKSMSTVI   S  G+ +++KGASEIV+ KCS+I+  +GQ   F   D++++VQ VIEPMA +GLRTI +A ++              + EPD++NEA I++DLTC+ +VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTAR+IATKCGIL+PG+DFL LEGK+FNQ+IR+ K GEV Q+ +DKVWP LRVLARSSP DK+TLV GII S +  TR+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDTLASLALATE P E LL R PYGR KPLI+R M+K I+G  IYQL++   LL AGE   ++DSGR+      S+P+EH+T IFN FVMM LFNEINARKIHG+RN+FEG+ RN IF  + + T   QI+I++FGG   S +AL  D WLWC+F G+G L+WGQ++ +IP      RL ++K+    IP     ++D+AE    E  +  D  + E            +R GQILW RGL+R+QTQM+ +
Sbjct:   21 GDFGCTMMQLRELMELRSGEAVSKIAECYGDVQGICRRLKTSPIEGLSGNPADIEKRHTSFGKNFIPPKKPKTFLQLVWEALQDVTLIILEVAAIISLALSFYHPPEGDNAACGEVGGVEDEGESQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRKGQVIQIPVAEIVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLTGESDQVRKSLEKDPMLLSGTHVMEGSGRMVVSAVGLNSQTGIIFTLLGAGEDEEKKVKKGKKQGPPENRNKAKT-----QDGIALEIQPLKSEEGVESEEKEEKEEKEKKKVNVTKK--------EKSVLQGKLTRLAVQIGKAGLIMSAVTVVILILYFVIKTFGIEGIEWKAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYIGDTHYKTVPEPEAIKPEILEILVNSISINSAYTTKILPPEKEGGLPRHVGNKTECALLGLVLELK-RDYQPIRDEVPEEKLYKVYTFNSSRKSMSTVIKNSSGPGFRMYSKGASEIVLRKCSHILDASGQQRVFKAKDRDEMVQKVIEPMACDGLRTICVAMRD-------------FSTEPDWDNEADILNDLTCICVVGIEDPVRPEVPEAISKCQRAGITVRMVTGDNINTARAIATKCGILQPGEDFLCLEGKDFNQQIRNDK-GEVEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTVGETRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAIYQLVITFTLLFAGEKFFNIDSGRSALLH--SQPSEHYTIIFNVFVMMQLFNEINARKIHGERNVFEGIYRNPIFCSVVLGTFALQIIIVQFGGKPFSCTALTIDQWLWCIFIGVGELLWGQLITAIPT----HRLKFLKEAGHGIP-----KEDIAEEVLIEGADEIDHAEME------------LRRGQILWFRGLNRIQTQMDVV 1114          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2b4 (ATPase plasma membrane Ca2+ transporting 4 [Source:ZFIN;Acc:ZDB-GENE-061027-60])

HSP 1 Score: 1195.26 bits (3091), Expect = 0.000e+0
Identity = 663/1145 (57.90%), Postives = 828/1145 (72.31%), Query Frame = 1
Query:  667 ADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCD--DFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDHK----------DDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQ-----ENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWK---TGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKK--KKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTL 4035
             DF  ++ +L+++MELR  EA++ I   Y  + G+C  L+TSP EGL  +  D  +R   +G N IPPK PKTF QLV+EA+QD+TLI+L +AA+ISL LS Y    GD+           + E++ GWIEG AIL +V++VV V AFNDW KE+QFRGLQ++IE E KF VIR  Q  +I V +I+VGDI QIKYGDLLPADG++IQ NDLK+DESSLTGESD V+K    DP++LSGTHVMEGSG+++++AVG+NSQ GIIF LLGA   E +     +     EN+N  KT     ++GI L ++   + E  E     E +     + +  KK        E SVLQ KLT+LA+QIG  G I++ VTV ILI+ F    F  +G +WK   T +++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQA++  +++  +P+   +  +   +LV++ISINS YT++++ P  +  LP  VGNKTECALLG VLEL    YQ IR++  E+KL KVYTFNS RKSMSTVI   S  G+ +++KGASEIV+ KCS+I+  +GQ   F   D++++VQ VIEPMA +GLRTI +A ++              + EPD++NEA I++DLTC+ +VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTAR+IATKCGIL+PG+DFL LEGK+FNQ+IR+ K GEV Q+ +DKVWP LRVLARSSP DK+TLV GII S +  TR+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDTLASLALATE P E LL R PYGR KPLI+R M+K I+G  IYQL++   LL AGE   ++DSGR+      S+P+EH+T IFN FVMM LFNEINARKIHG+RN+FEG+ RN IF  + + T   QI+I++FGG   S +AL  D WLWC+F G+G L+WGQ++ +IP      RL ++K+    IP     ++D+AE    E  +  D  + E            +R GQILW RGL+R+QTQM+ +
Sbjct:   21 GDFGCTMMQLRELMELRSGEAVSKIAECYGDVQGICRRLKTSPIEGLSGNPADIEKRHTSFGKNFIPPKKPKTFLQLVWEALQDVTLIILEVAAIISLALSFYHPPEGDNAACGEVGGVEDEGESQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRKGQVIQIPVAEIVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLTGESDQVRKSLEKDPMLLSGTHVMEGSGRMVVSAVGLNSQTGIIFTLLGAGEDEEKKVKKGKKQGPPENRNKAKT-----QDGIALEIQPLKSEEGVESEEKEEKEEKEKKKVNVTKK--------EKSVLQGKLTRLAVQIGKAGLIMSAVTVVILILYFVIKTFGIEGIEWKAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYIGDTHYKTVPEPEAIKPEILEILVNSISINSAYTTKILPPEKEGGLPRHVGNKTECALLGLVLELK-RDYQPIRDEVPEEKLYKVYTFNSSRKSMSTVIKNSSGPGFRMYSKGASEIVLRKCSHILDASGQQRVFKAKDRDEMVQKVIEPMACDGLRTICVAMRD-------------FSTEPDWDNEADILNDLTCICVVGIEDPVRPEVPEAISKCQRAGITVRMVTGDNINTARAIATKCGILQPGEDFLCLEGKDFNQQIRNDK-GEVEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTVGETRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAIYQLVITFTLLFAGEKFFNIDSGRSALLH--SQPSEHYTIIFNVFVMMQLFNEINARKIHGERNVFEGIYRNPIFCSVVLGTFALQIIIVQFGGKPFSCTALTIDQWLWCIFIGVGELLWGQLITAIPT----HRLKFLKEAGHGIP-----KEDIAEEVLIEGADEIDHAEME------------LRRGQILWFRGLNRIQTQMDVV 1114          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: ugdh (UDP-glucose 6-dehydrogenase [Source:Xenbase;Acc:XB-GENE-950970])

HSP 1 Score: 1194.49 bits (3089), Expect = 0.000e+0
Identity = 662/1153 (57.42%), Postives = 832/1153 (72.16%), Query Frame = 1
Query:  667 ADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCD--DFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDHK-----------DDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQW---KTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKK-KIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEA 4074
             DF  ++ +L+++MELR  EA+N I + Y G+  +C  L+TSP EGL  +  D  RR +I+G N IPPK  KTF QLV+EA+QD+TLI+L IAA+ISLGLS Y    GD++           + EA+ GWIEG AIL +V++VV V AFNDW KE+QFRGLQ++IE E KF VIR  Q  +I V +++VGDI QIKYGDLLPADG++IQ NDLK+DESSLTGESD VKK    DP++LSGTHVMEGSG++++TAVGVNSQ GIIF LLGA     E++ + + N   ++ AS             +  ++DG  L +    +        K+KK   +  KE SVLQ KLT+LA+QIG  G I++ +TV IL++ F    F   G  W    T +++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQAFV G+++ ++P    L++K   L+V+ IS+NS YTS+++ P  +  LP QVGNKTECALLGFVL+L    YQ +RN+  E+ L KVYTFNSVRKSMSTV+  +S   + +++KGASEI++ KC+ I+   G + PF   D++++V+ VIEPMA +GLRTI +AY++   +S           EP+++NE  I+SDL C+A+VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTAR+IATKCGIL+PG+DFL LEGKEFN  IR+ K GEV QD +DKVWP LRVLARSSP DK+TLV GII S +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P + LL R PYGR KPLI+R M+K I+G  +YQL +I  LL AGE   D+DSGR +     S P+EH+T +FNTFVMM LFNEINARKIHG+RN+FE + RN IF  + + T  +QI+I+EFGG   S S L    W WC+F G+G L+WGQ++ +IP +    RL ++K+    P+    ++D+ +    E+++  D  + E            +R GQILW RGL+R+QTQM+ +   +    +L+ A
Sbjct:   30 GDFGCTIMDLRELMELRSAEAVNRIRDTYGGVHNICRRLKTSPVEGLSGNPSDLERRRQIFGKNFIPPKKAKTFLQLVWEALQDVTLIILEIAAIISLGLSFYHPPGGDNELCGEAAAGVEDEGEAQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRKGQVIQIPVAELVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLTGESDQVKKSLEKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGANEGGEEEKKSKKGNNPLHREAS-------------QTKAQDGVALEIQPLKSEEGVECEEKEKKVVKVPKKEKSVLQGKLTRLAVQIGKAGLIMSAITVIILVLYFVIYTFGVLGRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAFVGGTHYRQIPDPEALNTKILDLIVNGISVNSAYTSKILPPEKEGGLPRQVGNKTECALLGFVLDLK-QDYQTVRNEIPEENLYKVYTFNSVRKSMSTVL-CDSSGKFRMYSKGASEIILRKCTRILDQGGDVCPFKAKDRDEMVKKVIEPMACDGLRTICLAYRDFPSDS-----------EPNWDNEGDILSDLICIAVVGIEDPVRPEVPEAIQKCQRAGITVRMVTGDNINTARAIATKCGILQPGEDFLCLEGKEFNTLIRNEK-GEVEQDKLDKVWPRLRVLARSSPTDKHTLVKGIIDSTVAERRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTDSLLLRKPYGRNKPLISRTMMKNILGHAVYQLTIIFTLLFAGEKFFDIDSGRNVPLH--SPPSEHYTIVFNTFVMMQLFNEINARKIHGERNVFENIFRNPIFCAVVLGTFGAQIIIVEFGGKPFSCSGLTLSQWFWCIFIGVGELLWGQMICTIPTS----RLKFLKEAGHGPL----KEDIQQEELTEDVDEIDHAEME------------LRRGQILWFRGLNRIQTQMDVVYTFQTGGTSLQGA 1133          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: ugdh (UDP-glucose 6-dehydrogenase [Source:Xenbase;Acc:XB-GENE-950970])

HSP 1 Score: 1194.1 bits (3088), Expect = 0.000e+0
Identity = 662/1153 (57.42%), Postives = 832/1153 (72.16%), Query Frame = 1
Query:  667 ADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCD--DFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDHK-----------DDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQW---KTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKK-KIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEA 4074
             DF  ++ +L+++MELR  EA+N I + Y G+  +C  L+TSP EGL  +  D  RR +I+G N IPPK  KTF QLV+EA+QD+TLI+L IAA+ISLGLS Y    GD++           + EA+ GWIEG AIL +V++VV V AFNDW KE+QFRGLQ++IE E KF VIR  Q  +I V +++VGDI QIKYGDLLPADG++IQ NDLK+DESSLTGESD VKK    DP++LSGTHVMEGSG++++TAVGVNSQ GIIF LLGA     E++ + + N   ++ AS             +  ++DG  L +    +        K+KK   +  KE SVLQ KLT+LA+QIG  G I++ +TV IL++ F    F   G  W    T +++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQAFV G+++ ++P    L++K   L+V+ IS+NS YTS+++ P  +  LP QVGNKTECALLGFVL+L    YQ +RN+  E+ L KVYTFNSVRKSMSTV+  +S   + +++KGASEI++ KC+ I+   G + PF   D++++V+ VIEPMA +GLRTI +AY++   +S           EP+++NE  I+SDL C+A+VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTAR+IATKCGIL+PG+DFL LEGKEFN  IR+ K GEV QD +DKVWP LRVLARSSP DK+TLV GII S +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P + LL R PYGR KPLI+R M+K I+G  +YQL +I  LL AGE   D+DSGR +     S P+EH+T +FNTFVMM LFNEINARKIHG+RN+FE + RN IF  + + T  +QI+I+EFGG   S S L    W WC+F G+G L+WGQ++ +IP +    RL ++K+    P+    ++D+ +    E+++  D  + E            +R GQILW RGL+R+QTQM+ +   +    +L+ A
Sbjct:   21 GDFGCTIMDLRELMELRSAEAVNRIRDTYGGVHNICRRLKTSPVEGLSGNPSDLERRRQIFGKNFIPPKKAKTFLQLVWEALQDVTLIILEIAAIISLGLSFYHPPGGDNELCGEAAAGVEDEGEAQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRKGQVIQIPVAELVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLTGESDQVKKSLEKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGANEGGEEEKKSKKGNNPLHREAS-------------QTKAQDGVALEIQPLKSEEGVECEEKEKKVVKVPKKEKSVLQGKLTRLAVQIGKAGLIMSAITVIILVLYFVIYTFGVLGRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAFVGGTHYRQIPDPEALNTKILDLIVNGISVNSAYTSKILPPEKEGGLPRQVGNKTECALLGFVLDLK-QDYQTVRNEIPEENLYKVYTFNSVRKSMSTVL-CDSSGKFRMYSKGASEIILRKCTRILDQGGDVCPFKAKDRDEMVKKVIEPMACDGLRTICLAYRDFPSDS-----------EPNWDNEGDILSDLICIAVVGIEDPVRPEVPEAIQKCQRAGITVRMVTGDNINTARAIATKCGILQPGEDFLCLEGKEFNTLIRNEK-GEVEQDKLDKVWPRLRVLARSSPTDKHTLVKGIIDSTVAERRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTDSLLLRKPYGRNKPLISRTMMKNILGHAVYQLTIIFTLLFAGEKFFDIDSGRNVPLH--SPPSEHYTIVFNTFVMMQLFNEINARKIHGERNVFENIFRNPIFCAVVLGTFGAQIIIVEFGGKPFSCSGLTLSQWFWCIFIGVGELLWGQMICTIPTS----RLKFLKEAGHGPL----KEDIQQEELTEDVDEIDHAEME------------LRRGQILWFRGLNRIQTQMDVVYTFQTGGTSLQGA 1124          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: ugdh (UDP-glucose 6-dehydrogenase [Source:Xenbase;Acc:XB-GENE-950970])

HSP 1 Score: 1192.18 bits (3083), Expect = 0.000e+0
Identity = 664/1155 (57.49%), Postives = 831/1155 (71.95%), Query Frame = 1
Query:  667 ADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCD--DFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDHK-----------DDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVE--VTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQW---KTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKK-KIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEA 4074
             DF  ++ +L+++MELR  EA+N I + Y G+  +C  L+TSP EGL  +  D  RR +I+G N IPPK  KTF QLV+EA+QD+TLI+L IAA+ISLGLS Y    GD++           + EA+ GWIEG AIL +V++VV V AFNDW KE+QFRGLQ++IE E KF VIR  Q  +I V +++VGDI QIKYGDLLPADG++IQ NDLK+DESSLTGESD VKK    DP++LSGTHVMEGSG++++TAVGVNSQ GIIF LLGA            E +  +K  +N L  G+      E    ++DG  L +    +        K+KK   +  KE SVLQ KLT+LA+QIG  G I++ +TV IL++ F    F   G  W    T +++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQAFV G+++ ++P    L++K   L+V+ IS+NS YTS+++ P  +  LP QVGNKTECALLGFVL+L    YQ +RN+  E+ L KVYTFNSVRKSMSTV+  +S   + +++KGASEI++ KC+ I+   G + PF   D++++V+ VIEPMA +GLRTI +AY++   +S           EP+++NE  I+SDL C+A+VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTAR+IATKCGIL+PG+DFL LEGKEFN  IR+ K GEV QD +DKVWP LRVLARSSP DK+TLV GII S +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P + LL R PYGR KPLI+R M+K I+G  +YQL +I  LL AGE   D+DSGR +     S P+EH+T +FNTFVMM LFNEINARKIHG+RN+FE + RN IF  + + T  +QI+I+EFGG   S S L    W WC+F G+G L+WGQ++ +IP +    RL ++K+    P+    ++D+ +    E+++  D  + E            +R GQILW RGL+R+QTQM+ +   +    +L+ A
Sbjct:   21 GDFGCTIMDLRELMELRSAEAVNRIRDTYGGVHNICRRLKTSPVEGLSGNPSDLERRRQIFGKNFIPPKKAKTFLQLVWEALQDVTLIILEIAAIISLGLSFYHPPGGDNELCGEAAAGVEDEGEAQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRKGQVIQIPVAELVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLTGESDQVKKSLEKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGANE--------GGEEEKKSKKGNNPLHIGVISPPSQEPITKAQDGVALEIQPLKSEEGVECEEKEKKVVKVPKKEKSVLQGKLTRLAVQIGKAGLIMSAITVIILVLYFVIYTFGVLGRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAFVGGTHYRQIPDPEALNTKILDLIVNGISVNSAYTSKILPPEKEGGLPRQVGNKTECALLGFVLDLK-QDYQTVRNEIPEENLYKVYTFNSVRKSMSTVL-CDSSGKFRMYSKGASEIILRKCTRILDQGGDVCPFKAKDRDEMVKKVIEPMACDGLRTICLAYRDFPSDS-----------EPNWDNEGDILSDLICIAVVGIEDPVRPEVPEAIQKCQRAGITVRMVTGDNINTARAIATKCGILQPGEDFLCLEGKEFNTLIRNEK-GEVEQDKLDKVWPRLRVLARSSPTDKHTLVKGIIDSTVAERRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTDSLLLRKPYGRNKPLISRTMMKNILGHAVYQLTIIFTLLFAGEKFFDIDSGRNVPLH--SPPSEHYTIVFNTFVMMQLFNEINARKIHGERNVFENIFRNPIFCAVVLGTFGAQIIIVEFGGKPFSCSGLTLSQWFWCIFIGVGELLWGQMICTIPTS----RLKFLKEAGHGPL----KEDIQQEELTEDVDEIDHAEME------------LRRGQILWFRGLNRIQTQMDVVYTFQTGGTSLQGA 1131          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: ugdh (UDP-glucose 6-dehydrogenase [Source:Xenbase;Acc:XB-GENE-950970])

HSP 1 Score: 1191.41 bits (3081), Expect = 0.000e+0
Identity = 663/1153 (57.50%), Postives = 831/1153 (72.07%), Query Frame = 1
Query:  667 ADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCD--DFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDHK-----------DDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQW---KTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKK-KIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEA 4074
             DF  ++ +L+++MELR  EA+N I + Y G+  +C  L+TSP EGL  +  D  RR +I+G N IPPK  KTF QLV+EA+QD+TLI+L IAA+ISLGLS Y    GD++           + EA+ GWIEG AIL +V++VV V AFNDW KE+QFRGLQ++IE E KF VIR  Q  +I V +++VGDI QIKYGDLLPADG++IQ NDLK+DESSLTGESD VKK    DP++LSGTHVMEGSG++++TAVGVNSQ GIIF LLGA     E++ + + N N   T S      +         ++DG  L +    +        K+KK   +  KE SVLQ KLT+LA+QIG  G I++ +TV IL++ F    F   G  W    T +++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQAFV G+++ ++P    L++K   L+V+ IS+NS YTS+++ P  +  LP QVGNKTECALLGFVL+L    YQ +RN+  E+ L KVYTFNSVRKSMSTV+  +S   + +++KGASEI++ KC+ I+   G + PF   D++++V+ VIEPMA +GLRTI +AY++   +S           EP+++NE  I+SDL C+A+VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTAR+IATKCGIL+PG+DFL LEGKEFN  IR+ K GEV QD +DKVWP LRVLARSSP DK+TLV GII S +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P + LL R PYGR KPLI+R M+K I+G  +YQL +I  LL AGE   D+DSGR +     S P+EH+T +FNTFVMM LFNEINARKIHG+RN+FE + RN IF  + + T  +QI+I+EFGG   S S L    W WC+F G+G L+WGQ++ +IP +    RL ++K+    P+    ++D+ +    E+++  D  + E            +R GQILW RGL+R+QTQM+ +   +    +L+ A
Sbjct:   21 GDFGCTIMDLRELMELRSAEAVNRIRDTYGGVHNICRRLKTSPVEGLSGNPSDLERRRQIFGKNFIPPKKAKTFLQLVWEALQDVTLIILEIAAIISLGLSFYHPPGGDNELCGEAAAGVEDEGEAQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRKGQVIQIPVAELVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLTGESDQVKKSLEKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGANEGGEEEKKSKKGN-NPLHTISTHRNTAM---------TQDGVALEIQPLKSEEGVECEEKEKKVVKVPKKEKSVLQGKLTRLAVQIGKAGLIMSAITVIILVLYFVIYTFGVLGRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAFVGGTHYRQIPDPEALNTKILDLIVNGISVNSAYTSKILPPEKEGGLPRQVGNKTECALLGFVLDLK-QDYQTVRNEIPEENLYKVYTFNSVRKSMSTVL-CDSSGKFRMYSKGASEIILRKCTRILDQGGDVCPFKAKDRDEMVKKVIEPMACDGLRTICLAYRDFPSDS-----------EPNWDNEGDILSDLICIAVVGIEDPVRPEVPEAIQKCQRAGITVRMVTGDNINTARAIATKCGILQPGEDFLCLEGKEFNTLIRNEK-GEVEQDKLDKVWPRLRVLARSSPTDKHTLVKGIIDSTVAERRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTDSLLLRKPYGRNKPLISRTMMKNILGHAVYQLTIIFTLLFAGEKFFDIDSGRNVPLH--SPPSEHYTIVFNTFVMMQLFNEINARKIHGERNVFENIFRNPIFCAVVLGTFGAQIIIVEFGGKPFSCSGLTLSQWFWCIFIGVGELLWGQMICTIPTS----RLKFLKEAGHGPL----KEDIQQEELTEDVDEIDHAEME------------LRRGQILWFRGLNRIQTQMDVVYTFQTGGTSLQGA 1127          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: ugdh (UDP-glucose 6-dehydrogenase [Source:Xenbase;Acc:XB-GENE-950970])

HSP 1 Score: 1190.64 bits (3079), Expect = 0.000e+0
Identity = 662/1153 (57.42%), Postives = 828/1153 (71.81%), Query Frame = 1
Query:  667 ADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCD--DFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDHK-----------DDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQW---KTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKK-KIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEA 4074
             DF  ++ +L+++MELR  EA+N I + Y G+  +C  L+TSP EGL  +  D  RR +I+G N IPPK  KTF QLV+EA+QD+TLI+L IAA+ISLGLS Y    GD++           + EA+ GWIEG AIL +V++VV V AFNDW KE+QFRGLQ++IE E KF VIR  Q  +I V +++VGDI QIKYGDLLPADG++IQ NDLK+DESSLTGESD VKK    DP++LSGTHVMEGSG++++TAVGVNSQ GIIF LLGA            E +  +K  +N L             ++DG  L +    +        K+KK   +  KE SVLQ KLT+LA+QIG  G I++ +TV IL++ F    F   G  W    T +++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQAFV G+++ ++P    L++K   L+V+ IS+NS YTS+++ P  +  LP QVGNKTECALLGFVL+L    YQ +RN+  E+ L KVYTFNSVRKSMSTV+  +S   + +++KGASEI++ KC+ I+   G + PF   D++++V+ VIEPMA +GLRTI +AY++   +S           EP+++NE  I+SDL C+A+VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTAR+IATKCGIL+PG+DFL LEGKEFN  IR+ K GEV QD +DKVWP LRVLARSSP DK+TLV GII S +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P + LL R PYGR KPLI+R M+K I+G  +YQL +I  LL AGE   D+DSGR +     S P+EH+T +FNTFVMM LFNEINARKIHG+RN+FE + RN IF  + + T  +QI+I+EFGG   S S L    W WC+F G+G L+WGQ++ +IP +    RL ++K+    P+    ++D+ +    E+++  D  + E            +R GQILW RGL+R+QTQM+ +   +    +L+ A
Sbjct:   21 GDFGCTIMDLRELMELRSAEAVNRIRDTYGGVHNICRRLKTSPVEGLSGNPSDLERRRQIFGKNFIPPKKAKTFLQLVWEALQDVTLIILEIAAIISLGLSFYHPPGGDNELCGEAAAGVEDEGEAQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRKGQVIQIPVAELVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLTGESDQVKKSLEKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGANE--------GGEEEKKSKKGNNPL----------HTKAQDGVALEIQPLKSEEGVECEEKEKKVVKVPKKEKSVLQGKLTRLAVQIGKAGLIMSAITVIILVLYFVIYTFGVLGRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAFVGGTHYRQIPDPEALNTKILDLIVNGISVNSAYTSKILPPEKEGGLPRQVGNKTECALLGFVLDLK-QDYQTVRNEIPEENLYKVYTFNSVRKSMSTVL-CDSSGKFRMYSKGASEIILRKCTRILDQGGDVCPFKAKDRDEMVKKVIEPMACDGLRTICLAYRDFPSDS-----------EPNWDNEGDILSDLICIAVVGIEDPVRPEVPEAIQKCQRAGITVRMVTGDNINTARAIATKCGILQPGEDFLCLEGKEFNTLIRNEK-GEVEQDKLDKVWPRLRVLARSSPTDKHTLVKGIIDSTVAERRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTDSLLLRKPYGRNKPLISRTMMKNILGHAVYQLTIIFTLLFAGEKFFDIDSGRNVPLH--SPPSEHYTIVFNTFVMMQLFNEINARKIHGERNVFENIFRNPIFCAVVLGTFGAQIIIVEFGGKPFSCSGLTLSQWFWCIFIGVGELLWGQMICTIPTS----RLKFLKEAGHGPL----KEDIQQEELTEDVDEIDHAEME------------LRRGQILWFRGLNRIQTQMDVVYTFQTGGTSLQGA 1119          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2b3 (ATPase, Ca++ transporting, plasma membrane 3 [Source:MGI Symbol;Acc:MGI:1347353])

HSP 1 Score: 1207.97 bits (3124), Expect = 0.000e+0
Identity = 665/1154 (57.63%), Postives = 835/1154 (72.36%), Query Frame = 1
Query:  673 FKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGL--QCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYT-----------MYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQEN----QNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQW---KTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEA 4074
            F  ++ EL+ +MELRG EA+  I   Y  +SGLC  L+TSP EGL    +D  +R +IYG N IPPK PKTF QLV+EA+QD+TLI+L +AA++SLGLS Y            +  G   + EAE GWIEG AIL +V+ VV V AFNDW KE+QFRGLQ++IE E KF VIRN Q  ++ V  ++VGDI Q+KYGDLLPADG++IQ NDLK+DESSLTGESD V+K  + DP++LSGTHVMEGSG++++TAVGVNSQ GIIF LLGA   E E +    +      ++++T + +    + + ++   ++E GE                 ++KK  ++  KE SVLQ KLTKLA+QIG  G +++ +TV IL++ F    F  DG  W    T V++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+++  +++ ++P  S L+ K   LLV AISINS YT++++ P  +  LP QVGNKTECALLGFVL+L    +Q +R +  ED+L KVYTFNSVRKSMSTVI +    G+ +F+KGASEI++ KC+ I+++NG++  F   D++ +V+ +IEPMA +GLRTI IAY++  F++          +EPD++NE ++V DLTC+A+VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTAR+IA KCGI++PG+DFL LEGKEFN+RIR+ K GE+ Q+ +DKVWP LRVLARSSP DK+TLV GII S     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P E LL R PYGR KPLI+R M+K I+G  +YQL +I  LL  GE   D+DSGR       S P+EH+T IFNTFVMM LFNEINARKIHG+RN+F+G+  N IF  I + T   QIVI++FGG   S S L  + WLWC+F G+G LVWGQV+ +IP +                 +   K+   G   + M  +DE+  E    + + + ++ R GQILW RGL+R+QTQ   ++VV+AF+ +L E 
Sbjct:   27 FGCTLAELRSLMELRGAEALQKIQEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGKQQDGAMDSSQTRAKKQDGAVAMEMQPLKSAEGGEM--------------EEREKKKANVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVDGRVWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYKEIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVLDLKR-DFQPVREQIPEDQLYKVYTFNSVRKSMSTVIRMPD-GGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVKKIIEPMACDGLRTICIAYRD--FSA---------IQEPDWDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNEK-GEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLTIIFTLLFVGELFFDIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTS----------------QLKCLKEAGHGPGKDEM--TDEELAEGEEEIDHAEREL-RRGQILWFRGLNRIQTQ---IRVVKAFRSSLYEG 1128          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2b3 (ATPase, Ca++ transporting, plasma membrane 3 [Source:MGI Symbol;Acc:MGI:1347353])

HSP 1 Score: 1206.43 bits (3120), Expect = 0.000e+0
Identity = 676/1198 (56.43%), Postives = 848/1198 (70.78%), Query Frame = 1
Query:  673 FKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGL--QCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYT-----------MYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQEN----QNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQW---KTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQM---NTLKVVRAFKCTLEEAHSIEXXXXXXXXXXXXXXXTSLSHPRPLSADSINPLHSSIP 4197
            F  ++ EL+ +MELRG EA+  I   Y  +SGLC  L+TSP EGL    +D  +R +IYG N IPPK PKTF QLV+EA+QD+TLI+L +AA++SLGLS Y            +  G   + EAE GWIEG AIL +V+ VV V AFNDW KE+QFRGLQ++IE E KF VIRN Q  ++ V  ++VGDI Q+KYGDLLPADG++IQ NDLK+DESSLTGESD V+K  + DP++LSGTHVMEGSG++++TAVGVNSQ GIIF LLGA   E E +    +      ++++T + +    + + ++   ++E GE                 ++KK  ++  KE SVLQ KLTKLA+QIG  G +++ +TV IL++ F    F  DG  W    T V++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+++  +++ ++P  S L+ K   LLV AISINS YT++++ P  +  LP QVGNKTECALLGFVL+L    +Q +R +  ED+L KVYTFNSVRKSMSTVI +    G+ +F+KGASEI++ KC+ I+++NG++  F   D++ +V+ +IEPMA +GLRTI IAY++  F++          +EPD++NE ++V DLTC+A+VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTAR+IA KCGI++PG+DFL LEGKEFN+RIR+ K GE+ Q+ +DKVWP LRVLARSSP DK+TLV GII S     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P E LL R PYGR KPLI+R M+K I+G  +YQL +I  LL  GE   D+DSGR       S P+EH+T IFNTFVMM LFNEINARKIHG+RN+F+G+  N IF  I + T   QIVI++FGG   S S L  + WLWC+F G+G LVWGQV+ +IP +                 +   K+   G   + M  +DE+  E    + + + ++ R GQILW RGL+R+QTQM   +T K   +F+  +    S+  Q   +         T LS  +P SA   NP   SIP
Sbjct:   27 FGCTLAELRSLMELRGAEALQKIQEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGKQQDGAMDSSQTRAKKQDGAVAMEMQPLKSAEGGEM--------------EEREKKKANVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVDGRVWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYKEIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVLDLK-RDFQPVREQIPEDQLYKVYTFNSVRKSMSTVIRMPD-GGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVKKIIEPMACDGLRTICIAYRD--FSA---------IQEPDWDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNEK-GEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLTIIFTLLFVGELFFDIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTS----------------QLKCLKEAGHGPGKDEM--TDEELAEGEEEIDHAEREL-RRGQILWFRGLNRIQTQMEVVSTFKRSGSFQGAVRRRSSVLSQLHDVTNLSTPTHVT-LSAAKPPSAAG-NPGGESIP 1173          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2b3 (ATPase, Ca++ transporting, plasma membrane 3 [Source:MGI Symbol;Acc:MGI:1347353])

HSP 1 Score: 1198.34 bits (3099), Expect = 0.000e+0
Identity = 659/1137 (57.96%), Postives = 824/1137 (72.47%), Query Frame = 1
Query:  673 FKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGL--QCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYT-----------MYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQEN----QNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQW---KTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQ 4023
            F  ++ EL+ +MELRG EA+  I   Y  +SGLC  L+TSP EGL    +D  +R +IYG N IPPK PKTF QLV+EA+QD+TLI+L +AA++SLGLS Y            +  G   + EAE GWIEG AIL +V+ VV V AFNDW KE+QFRGLQ++IE E KF VIRN Q  ++ V  ++VGDI Q+KYGDLLPADG++IQ NDLK+DESSLTGESD V+K  + DP++LSGTHVMEGSG++++TAVGVNSQ GIIF LLGA   E E +    +      ++++T + +    + + ++   ++E GE                 ++KK  ++  KE SVLQ KLTKLA+QIG  G +++ +TV IL++ F    F  DG  W    T V++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+++  +++ ++P  S L+ K   LLV AISINS YT++++ P  +  LP QVGNKTECALLGFVL+L    +Q +R +  ED+L KVYTFNSVRKSMSTVI +    G+ +F+KGASEI++ KC+ I+++NG++  F   D++ +V+ +IEPMA +GLRTI IAY++  F++          +EPD++NE ++V DLTC+A+VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTAR+IA KCGI++PG+DFL LEGKEFN+RIR+ K GE+ Q+ +DKVWP LRVLARSSP DK+TLV GII S     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P E LL R PYGR KPLI+R M+K I+G  +YQL +I  LL  GE   D+DSGR       S P+EH+T IFNTFVMM LFNEINARKIHG+RN+F+G+  N IF  I + T   QIVI++FGG   S S L  + WLWC+F G+G LVWGQV+ +IP +                 +   K+   G   + M  +DE+  E    + + + ++ R GQILW RGL+R+QTQ
Sbjct:   27 FGCTLAELRSLMELRGAEALQKIQEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGKQQDGAMDSSQTRAKKQDGAVAMEMQPLKSAEGGEM--------------EEREKKKANVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVDGRVWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYKEIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVLDLK-RDFQPVREQIPEDQLYKVYTFNSVRKSMSTVIRMPD-GGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVKKIIEPMACDGLRTICIAYRD--FSA---------IQEPDWDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNEK-GEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLTIIFTLLFVGELFFDIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTS----------------QLKCLKEAGHGPGKDEM--TDEELAEGEEEIDHAEREL-RRGQILWFRGLNRIQTQ 1114          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2b2 (ATPase, Ca++ transporting, plasma membrane 2 [Source:MGI Symbol;Acc:MGI:105368])

HSP 1 Score: 1185.63 bits (3066), Expect = 0.000e+0
Identity = 664/1152 (57.64%), Postives = 825/1152 (71.61%), Query Frame = 1
Query:  667 ADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGL--QCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXY-----------TMYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQW---KTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEA 4074
             +F  +++EL+ +MELRG EA+  I   Y     +C  L+TSP EGL     D  +R +I+G N IPPK PKTF QLV+EA+QD+TLI+L IAA+ISLGLS Y           T   G   + EAE GWIEG AIL +V+ VV V AFNDW KE+QFRGLQ++IE E KF V+R  Q  +I V +I+VGDI QIKYGDLLPADGL IQ NDLK+DESSLTGESD V+K  + DP++LSGTHVMEGSG++++TAVGVNSQ GIIF LLGA   E E +    + Q+       Q            + S +G        DA +        KK  ++  KE SVLQ KLTKLA+QIG  G +++ +TV IL++ F    F  + + W    T V++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQA+V   ++ ++P  S +++K   LLV+AI+INS YT++++ P  +  LP QVGNKTEC LLGFVL+L    Y+ +R++  E+KL KVYTFNSVRKSMSTVI +   + + +++KGASEIV+ KC  I+S  G+   F   D++++V+ VIEPMA +GLRTI +AY++  F S         + EPD++NE  I+++LTC+ +VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTAR+IA KCGI+ PG+DFL LEGKEFN+RIR+ K GE+ Q+ IDK+WP LRVLARSSP DK+TLV GII S     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P E LL R PYGR KPLI+R M+K I+G  +YQL +I  LL  GE +  +DSGR       S P+EH+T IFNTFVMM LFNEINARKIHG+RN+F+G+ RN IF  I + T   QIVI++FGG   S S L  D W+WC+F GLG LVWGQV+ +IP +    RL ++K+      +++++++ E    E++   D  + E            +R GQILW RGL+R+QTQ   ++VV+AF+ +L E 
Sbjct:   22 GEFGCTMEELRSLMELRGTEAVVKIKETYGDTEAICRRLKTSPVEGLPGTAPDLEKRKQIFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLGLSFYHPPGESNEGCATAQGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRAGQVVQIPVAEIVVGDIAQIKYGDLLPADGLFIQGNDLKIDESSLTGESDQVRKSVDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKAKQQDGAAAMEMQ-----------PLKSAEG-------GDADD--------KKKANMHKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFTVDTFVVNKKPWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAYVGDVHYKEIPDPSSINAKTLELLVNAIAINSAYTTKILPPEKEGALPRQVGNKTECGLLGFVLDLR-QDYEPVRSQMPEEKLYKVYTFNSVRKSMSTVIKMPD-ESFRMYSKGASEIVLKKCCKILSGAGEARVFRPRDRDEMVKKVIEPMACDGLRTICVAYRD--FPS---------SPEPDWDNENDILNELTCICVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCLEGKEFNRRIRNEK-GEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTHTEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTETLLLRKPYGRNKPLISRTMMKNILGHAVYQLTLIFTLLFVGEKMFQIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFRNPIFCTIVLGTFAIQIVIVQFGGKPFSCSPLQLDQWMWCIFIGLGELVWGQVIATIPTS----RLKFLKEAG---RLTQKEEIPEEELNEDVEEIDHAERE------------LRRGQILWFRGLNRIQTQ---IRVVKAFRSSLYEG 1109          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2b2 (ATPase, Ca++ transporting, plasma membrane 2 [Source:MGI Symbol;Acc:MGI:105368])

HSP 1 Score: 1185.63 bits (3066), Expect = 0.000e+0
Identity = 664/1152 (57.64%), Postives = 825/1152 (71.61%), Query Frame = 1
Query:  667 ADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGL--QCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXY-----------TMYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQW---KTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEA 4074
             +F  +++EL+ +MELRG EA+  I   Y     +C  L+TSP EGL     D  +R +I+G N IPPK PKTF QLV+EA+QD+TLI+L IAA+ISLGLS Y           T   G   + EAE GWIEG AIL +V+ VV V AFNDW KE+QFRGLQ++IE E KF V+R  Q  +I V +I+VGDI QIKYGDLLPADGL IQ NDLK+DESSLTGESD V+K  + DP++LSGTHVMEGSG++++TAVGVNSQ GIIF LLGA   E E +    + Q+       Q            + S +G        DA +        KK  ++  KE SVLQ KLTKLA+QIG  G +++ +TV IL++ F    F  + + W    T V++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQA+V   ++ ++P  S +++K   LLV+AI+INS YT++++ P  +  LP QVGNKTEC LLGFVL+L    Y+ +R++  E+KL KVYTFNSVRKSMSTVI +   + + +++KGASEIV+ KC  I+S  G+   F   D++++V+ VIEPMA +GLRTI +AY++  F S         + EPD++NE  I+++LTC+ +VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTAR+IA KCGI+ PG+DFL LEGKEFN+RIR+ K GE+ Q+ IDK+WP LRVLARSSP DK+TLV GII S     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P E LL R PYGR KPLI+R M+K I+G  +YQL +I  LL  GE +  +DSGR       S P+EH+T IFNTFVMM LFNEINARKIHG+RN+F+G+ RN IF  I + T   QIVI++FGG   S S L  D W+WC+F GLG LVWGQV+ +IP +    RL ++K+      +++++++ E    E++   D  + E            +R GQILW RGL+R+QTQ   ++VV+AF+ +L E 
Sbjct:   22 GEFGCTMEELRSLMELRGTEAVVKIKETYGDTEAICRRLKTSPVEGLPGTAPDLEKRKQIFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLGLSFYHPPGESNEGCATAQGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRAGQVVQIPVAEIVVGDIAQIKYGDLLPADGLFIQGNDLKIDESSLTGESDQVRKSVDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKAKQQDGAAAMEMQ-----------PLKSAEG-------GDADD--------KKKANMHKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFTVDTFVVNKKPWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAYVGDVHYKEIPDPSSINAKTLELLVNAIAINSAYTTKILPPEKEGALPRQVGNKTECGLLGFVLDLR-QDYEPVRSQMPEEKLYKVYTFNSVRKSMSTVIKMPD-ESFRMYSKGASEIVLKKCCKILSGAGEARVFRPRDRDEMVKKVIEPMACDGLRTICVAYRD--FPS---------SPEPDWDNENDILNELTCICVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCLEGKEFNRRIRNEK-GEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTHTEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTETLLLRKPYGRNKPLISRTMMKNILGHAVYQLTLIFTLLFVGEKMFQIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFRNPIFCTIVLGTFAIQIVIVQFGGKPFSCSPLQLDQWMWCIFIGLGELVWGQVIATIPTS----RLKFLKEAG---RLTQKEEIPEEELNEDVEEIDHAERE------------LRRGQILWFRGLNRIQTQ---IRVVKAFRSSLYEG 1109          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q16720|AT2B3_HUMAN (Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens OX=9606 GN=ATP2B3 PE=1 SV=3)

HSP 1 Score: 1207.2 bits (3122), Expect = 0.000e+0
Identity = 672/1154 (58.23%), Postives = 834/1154 (72.27%), Query Frame = 1
Query:  673 FKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGL--QCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYT-----------MYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEV----TSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQW---KTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEA 4074
            F  ++ EL+ +MELRG EA+  I   Y  +SGLC  L+TSP EGL    +D  +R +IYG N IPPK PKTF QLV+EA+QD+TLI+L +AA++SLGLS Y            +  G   + EAE GWIEG AIL +V+ VV V AFNDW KE+QFRGLQ++IE E KF VIRN Q  ++ V  ++VGDI Q+KYGDLLPADG++IQ+NDLK+DESSLTGESD V+K  + DP++LSGTHVMEGSG++++TAVGVNSQ GIIF LLGA   E E +    + Q+    +S       D  V +E+    ++E GE              E  +KKK  + + KE SVLQ KLTKLA+QIG  G +++ +TV IL++ F    F  +G  W    T V++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+++  +++ ++P  S L+ K   LLV AISINS YT++++ P  +  LP QVGNKTECALLGFVL+L    +Q +R +  EDKL KVYTFNSVRKSMSTVI +    G+ +F+KGASEI++ KC+ I+++NG++  F   D++ +V+ +IEPMA +GLRTI IAY++    S G        +EPD++NE ++V DLTC+A+VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTAR+IA KCGI++PG+DFL LEGKEFN+RIR+ K GE+ Q+ +DKVWP LRVLARSSP DK+TLV GII S     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P E LL R PYGR KPLI+R M+K I+G  +YQL +I  LL  GE   D+DSGR       S P+EH+T IFNTFVMM LFNEINARKIHG+RN+F+G+  N IF  I + T   QIVI++FGG   S S L  + WLWC+F G+G LVWGQV+ +IP +                 +   K+   G   + M  +DE+  E    + + + ++ R GQILW RGL+R+QTQ   ++VV+AF+ +L E 
Sbjct:   27 FGCTLAELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAEGGE-------------MEEREKKKANAPK-KEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYKEIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVLDLK-RDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPD-GGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDF---SAG--------QEPDWDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNEK-GEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTS----------------QLKCLKEAGHGPGKDEM--TDEELAEGEEEIDHAEREL-RRGQILWFRGLNRIQTQ---IRVVKAFRSSLYEG 1128          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q64568|AT2B3_RAT (Plasma membrane calcium-transporting ATPase 3 OS=Rattus norvegicus OX=10116 GN=Atp2b3 PE=1 SV=2)

HSP 1 Score: 1205.28 bits (3117), Expect = 0.000e+0
Identity = 667/1148 (58.10%), Postives = 828/1148 (72.13%), Query Frame = 1
Query:  673 FKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGL--QCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYT-----------MYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEV----TSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQW---KTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFK 4056
            F  ++ EL+ +MELRG EA+  I   Y  +SGLC  L+TSP EGL    +D  +R +IYG N IPPK PKTF QLV+EA+QD+TLI+L +AA++SLGLS Y            +  G   + EAE GWIEG AIL +V+ VV V AFNDW KE+QFRGLQ++IE E KF VIRN Q  ++ V  ++VGDI Q+KYGDLLPADG++IQ NDLK+DESSLTGESD V+K  + DP++LSGTHVMEGSG++++TAVGVNSQ GIIF LLGA   E E +    + Q+    +S       D  V +E+    ++E GE                 ++KK  ++  KE SVLQ KLTKLA+QIG  G +++ +TV IL++ F    F  DG  W    T V++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+++  +++ ++P  S L+ K   LLV AISINS YT++++ P  +  LP QVGNKTECALLGF+L+L    +Q +R +  ED+L KVYTFNSVRKSMSTVI +    G+ +F+KGASEI++ KC+ I+++NG++  F   D++ +V+ +IEPMA +GLRTI IAY++  F++          +EPD++NE ++V DLTC+A+VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTAR+IA KCGI++PG+DFL LEGKEFN+RIR+ K GE+ Q+ +DKVWP LRVLARSSP DK+TLV GII S     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P E LL R PYGR KPLI+R M+K I+G  +YQL +I  LL  GE   D+DSGR       S P+EH+T IFNTFVMM LFNEINARKIHG+RN+F+G+  N IF  I + T   QIVI++FGG   S S L  + WLWC+F G+G LVWGQV+ +IP +                 +   K+   G   + M  +DE+  E    + + + ++ R GQILW RGL+R+QTQM   +VV  FK
Sbjct:   27 FGCTLAELRSLMELRGAEALQKIQEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAEGGEM--------------EEREKKKANVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVDGRVWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYKEIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFILDLKR-DFQPVREQIPEDQLYKVYTFNSVRKSMSTVIRMPD-GGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVKKIIEPMACDGLRTICIAYRD--FSA---------IQEPDWDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNEK-GEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLTIIFTLLFVGELFFDIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTS----------------QLKCLKEAGHGPGKDEM--TDEELAEGEEEIDHAEREL-RRGQILWFRGLNRIQTQM---EVVSTFK 1122          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|D3K0R6|AT2B4_BOVIN (Plasma membrane calcium-transporting ATPase 4 OS=Bos taurus OX=9913 GN=ATP2B4 PE=1 SV=2)

HSP 1 Score: 1199.11 bits (3101), Expect = 0.000e+0
Identity = 661/1167 (56.64%), Postives = 834/1167 (71.47%), Query Frame = 1
Query:  640 SNATGDRGRADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCD--DFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDHK-----------DDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDR------PNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQW---KTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEA 4074
            SN+  +    +F  +V +L+ +MELR  +AI+ IN  Y G+  LC+ L+T+P EGL  +  D  +R +++G N+IPPK PKTF +LV+EA+QD+TLI+L IAA+ISL LS Y    G+++           + EAE GWIEG AIL +V++VV V AFNDW KE+QFRGLQN+IE E KF VIRN    ++ V +I+VGDI QIKYGDLLPADG++IQ NDLK+DESSLTGESD VKK    DP++LSGTHVMEGSG++++TAVG+NSQ GIIF LLGA+  E E++          EN+N  KT                   +DG  L +   ++        K+KK   +  KE SVLQ KLT+LA+QIG  G I++ +TV ILI+ F    F      W    T +++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRM+VVQA++  + + ++P   +L  K   L+V+ ISINS YTS+++ P  +  LP QVGNKTECALLGFV +L    Y  +R++  E+KL KVYTFNSVRKSMSTVI  +   GY +++KGASEI++ KC+ I+   G+ +PF   D++++V+TVIEPMA  GLRT+ IAY+        D N+     EP ++NE++I+++LTC+A+VGIEDPVRPEVP AI KC++AGITVRMVTGDN+NTAR+IATKCGI+ PGDDFL LEGKEFN+ IR+ K GEV Q+ +DK+WP LRVLARSSP DK+TLV GII S +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P + LL R PYGR KPLI+R M+K I+G  +YQL VI +L+ AGE   D+DSGR       S P++H+T IFNTFV+M LFNEIN+RKIHG+RN+F G+ RN+IF  + + T +SQI+I+EFGG   S + L    W WC+F G+G L+WGQV+ +IP                  S+   K+   G   E +     KD E +  + + + ++ R GQILW RGL+R+QTQ   +KVV+AF  +L E+
Sbjct:   11 SNSILESREGEFGCTVMDLRKLMELRSSDAIDQINVHYGGVMNLCSRLKTNPVEGLSGNPADLEKRKQVFGQNLIPPKKPKTFLELVWEALQDVTLIILEIAAIISLVLSFYRPPGGENEQCGLAVTSPEDEGEAEAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQNRIEKEQKFSVIRNGHIIQLPVAEIVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLERDPMLLSGTHVMEGSGRMVVTAVGINSQTGIIFTLLGASEGEEEEKKKKGKKQGVPENRNKAKT-------------------QDGVALEIQPLNSQEGIDSEEKEKKAAKLPKKEKSVLQGKLTRLAVQIGKAGLIMSAITVLILILYFVIDNFVIQRRPWLAECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMSVVQAYIGDTRYHQIPSPDDLVPKVLDLIVNGISINSAYTSKILPPEKEGGLPRQVGNKTECALLGFVSDLK-QDYHAVRSEVPEEKLYKVYTFNSVRKSMSTVIE-KPGGGYRMYSKGASEIILRKCNRILDKKGEAVPFKNKDRDEMVRTVIEPMACEGLRTLCIAYR--------DFNDG----EPPWDNESEILTELTCIAVVGIEDPVRPEVPEAIAKCKRAGITVRMVTGDNINTARAIATKCGIVTPGDDFLCLEGKEFNRLIRNEK-GEVEQEKLDKIWPKLRVLARSSPTDKHTLVKGIIDSTVGDQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTDSLLKRRPYGRNKPLISRTMMKNILGHAVYQLTVIFFLVFAGEKFFDIDSGRRAPLH--SPPSQHYTIIFNTFVLMQLFNEINSRKIHGERNVFSGIFRNLIFCSVVLGTFISQIIIVEFGGKPFSCTKLTLSQWFWCLFIGIGELLWGQVISTIPT----------------QSLKFLKEAGHGTTKEEIT----KDAEGLDEIDHAEMEL-RRGQILWFRGLNRIQTQ---IKVVKAFHSSLHES 1117          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q64542|AT2B4_RAT (Plasma membrane calcium-transporting ATPase 4 OS=Rattus norvegicus OX=10116 GN=Atp2b4 PE=1 SV=1)

HSP 1 Score: 1196.42 bits (3094), Expect = 0.000e+0
Identity = 655/1161 (56.42%), Postives = 839/1161 (72.27%), Query Frame = 1
Query:  640 SNATGDRGRADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCD--DFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDHK-----------DDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGA------ASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQW---KTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFK 4056
            +N+  +    +F  ++ +L+ +MELR  +A+  I+  Y  +  +CA L+TSP EGL  +  D  +R  ++G N+IPPK PKTF +LV+EA+QD+TLI+L IAA+ISL LS Y    G+++           D+E E GWIEG AILA+V++VVFV AFNDW KE+QFRGLQ++IE E KF +IRN Q  ++ V +I+VGDI Q+KYGDLLPADG++IQ NDLK+DESSLTGESD VKK  + DP++LSGTHVMEGSG++++TAVG+NSQ GIIF LLGA         +   +    EN+N  KT     ++G+ L ++  + S++G               E  +KK  K  + KE SVLQ KLT+LA+QIG  G I++++TV ILI+ F    F      W    T V++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQA++ G+++ ++PK  +L      L+V++I INS YTS+++ P  +  LP QVGNKTEC LLGFV +L    YQ +R++  E+KL KVYTFNSVRKSMSTVI  +   G+ +F+KGASEI++ KC  I++  G I+PF   D++ +V+ VIEPMAS GLRTIGIAY++  F+           EEP +ENE +I + L C+A+VGIEDPVRPEVP+AI KC++AGITVRMVTGDNVNTAR+IATKCGIL PGDDFL LEGKEFN+ IR+ K GEV Q+ +DKVWP LRVLARSSP DK+TLV GII S++   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P + LL R PYGR KPLI+R M+K I+G  +YQL ++  L+ AG+ L D+DSGR       S P++H+T +FNTFV+M LFNEIN+RKIHG++N+F G+ RN+IF  + + T   QI+I+E GG   S + L  + W+WC+F G+G L+WGQV+ +IP                  S+   K+   G++ E ++    KD E +  + + + ++ R GQILW+RGL+R+QTQ+  +KV  +F+
Sbjct:   11 ANSVAESYEGEFGCTLMDLRKLMELRAADAVTQISAHYGSVQEICARLKTSPVEGLSGNPADLEKRRLVFGKNMIPPKKPKTFLELVWEALQDVTLIILEIAAIISLVLSFYRPPGGENEICGHIVSNPEEDEEGETGWIEGAAILASVIIVVFVTAFNDWSKEKQFRGLQSRIELEQKFSIIRNGQLIQLPVAEIVVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKTLDKDPMLLSGTHVMEGSGRMVVTAVGINSQTGIIFTLLGANEEEDDEKKKKGKKQGVSENRNKAKT-----QDGVALEIQ-PLNSQEG------------LDSEEKEKKASKGPK-KEKSVLQGKLTRLAVQIGKAGLIMSILTVLILILYFVVDNFVIQRRAWLPECTPVYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYIGGTHYRQIPKPDDLPPNVLDLIVNSICINSAYTSKILPPEKEGGLPRQVGNKTECGLLGFVTDLK-QDYQAVRSEMPEEKLFKVYTFNSVRKSMSTVI-RKPEGGFRVFSKGASEIMLRKCDRILNKEGGIVPFKTKDRDNMVRNVIEPMASEGLRTIGIAYRD--FDG----------EEPSWENENEIFTGLVCIAVVGIEDPVRPEVPDAINKCKRAGITVRMVTGDNVNTARAIATKCGILTPGDDFLCLEGKEFNRLIRNEK-GEVEQEKLDKVWPRLRVLARSSPTDKHTLVKGIIDSNIGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFSGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTDSLLRRRPYGRNKPLISRTMMKNILGHAVYQLGIVFLLVFAGDKLFDIDSGRKAPLN--SPPSQHYTIVFNTFVLMQLFNEINSRKIHGEKNVFAGVYRNIIFCSVVLGTFFCQILIVEVGGKPFSCTNLTMEQWMWCLFIGIGELLWGQVISAIPTK----------------SLKFLKEAGHGSDKEEIS----KDAEGLEEIDHAEMEL-RRGQILWVRGLNRIQTQIRVVKVFHSFR 1114          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|P23634|AT2B4_HUMAN (Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens OX=9606 GN=ATP2B4 PE=1 SV=2)

HSP 1 Score: 1191.41 bits (3081), Expect = 0.000e+0
Identity = 658/1167 (56.38%), Postives = 833/1167 (71.38%), Query Frame = 1
Query:  640 SNATGDRGRADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCD--DFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDHK-----------DDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGA------ASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQW---KTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQ---MNTLKVVRAFKCTL 4065
            +N+  +    DF  +V EL+ +MELR  +A+  IN  Y G+  LC+ L+TSP EGL  +  D  +R +++G NVIPPK PKTF +LV+EA+QD+TLI+L IAA+ISL LS Y     +++           ++EA+ GWIEG AIL +V++VV V AFNDW KE+QFRGLQ +IE E KF +IRN Q  ++ V +I+VGDI Q+KYGDLLPADG++IQ NDLK+DESSLTGESD VKK  + DP++LSGTHVMEGSG++++TAVGVNSQ GII  LLG          +   +    EN+N  KT     ++G+ L ++  + S++G     I+N+         K KK   +  KE SVLQ KLT+LA+QIG  G +++ +TV ILI+ F    F  +   W    T +++Q  + FFIIG+TVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQA++ G ++ ++P       K   L+V+ ISINS YTS+++ P  +  LP QVGNKTECALLGFV +L    YQ +RN+  E+KL KVYTFNSVRKSMSTVI      G+ +++KGASEI++ KC+ I+   G+ +PF   D++ +V+TVIEPMA +GLRTI IAY+        D ++T    EP ++NE +I+++LTC+A+VGIEDPVRPEVP+AI KC++AGITVRMVTGDN+NTAR+IATKCGIL PGDDFL LEGKEFN+ IR+ K GEV Q+ +DK+WP LRVLARSSP DK+TLV GII S +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P E LL R PYGR KPLI+R M+K I+G   YQLIVI  L+ AGE   D+DSGR       S P++H+T +FNTFV+M LFNEIN+RKIHG++N+F G+ RN+IF  + + T + QI I+EFGG   S ++L    WLWC+F G+G L+WGQ + +IP                  S+   K+   G   E +     KD E +  + + + ++ R GQILW RGL+R+QTQ   +NT +   +FK  L
Sbjct:   11 ANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKTSPVEGLSGNPADLEKRRQVFGHNVIPPKKPKTFLELVWEALQDVTLIILEIAAIISLVLSFYRPAGEENELCGQVATTPEDENEAQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQCRIEQEQKFSIIRNGQLIQLPVAEIVVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIILTLLGVNEDDEGEKKKKGKKQGVPENRNKAKT-----QDGVALEIQ-PLNSQEG-----IDNEE--------KDKKAVKVPKKEKSVLQGKLTRLAVQIGKAGLLMSALTVFILILYFVIDNFVINRRPWLPECTPIYIQYFVKFFIIGITVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYIGGIHYRQIPSPDVFLPKVLDLIVNGISINSAYTSKILPPEKEGGLPRQVGNKTECALLGFVTDLK-QDYQAVRNEVPEEKLYKVYTFNSVRKSMSTVI-RNPNGGFRMYSKGASEIILRKCNRILDRKGEAVPFKNKDRDDMVRTVIEPMACDGLRTICIAYR--------DFDDT----EPSWDNENEILTELTCIAVVGIEDPVRPEVPDAIAKCKQAGITVRMVTGDNINTARAIATKCGILTPGDDFLCLEGKEFNRLIRNEK-GEVEQEKLDKIWPKLRVLARSSPTDKHTLVKGIIDSTVGEHRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLKRRPYGRNKPLISRTMMKNILGHAFYQLIVIFILVFAGEKFFDIDSGRKAPLH--SPPSQHYTIVFNTFVLMQLFNEINSRKIHGEKNVFSGIYRNIIFCSVVLGTFICQIFIVEFGGKPFSCTSLSLSQWLWCLFIGIGELLWGQFISAIPTR----------------SLKFLKEAGHGTTKEEIT----KDAEGLDEIDHAEMEL-RRGQILWFRGLNRIQTQIDVINTFQTGASFKGVL 1120          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A4Y2DYL3 (Calcium-transporting ATPase OS=Araneus ventricosus OX=182803 GN=ATP2B3_2 PE=3 SV=1)

HSP 1 Score: 1328.92 bits (3438), Expect = 0.000e+0
Identity = 722/1158 (62.35%), Postives = 874/1158 (75.47%), Query Frame = 1
Query:  661 GR-ADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQ--CDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYT----MYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGID---LTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRV----------KEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGI-SKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEE 4071
            GR A + +++KEL+++ME RG +A++ I ++Y G+  LC  L TSP +GL     D   R + +G+N+IPP+PPKTF  LV+EA+QD+TLI+L +AALISLGL+ Y     +  G H D EA+ GWIEGVAIL +V++VV V AFND+ KERQFRGLQN+IE EHKF  IR  +  ++ VG+I+VGDICQ+KYGDLLPADGLIIQSNDLK+DESSLTGESD VKKGE+ DP++LSGTHVMEGSGK+L+TAVG+NSQAGIIF LLGAA  E     + ++ +   K   N  KN ++   LTV V ++ E+    +++  +++     S K    +++ V          KE SVLQ KLTKLAIQIGY G+ +A++TV IL I+F    F  +   W +  ++  ++ F IIGVTVLVVAVPEGLPLAVT++LAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ F+ G++   +PKY  L S    LLV  I+INS YTS++MV     ELP QVGNKTECALL FV ++G   YQ +R+   E+KL KVYTFNSVRKSMSTVIP+E   GY +FTKGASEIV+ KC +I + +GQI  F+K DQ+++V+TVIEPMAS GLRTI IAYK+ ++ +    N+  IT EPD+ENE  IVS+LTCL IVGIEDPVRPEVP+AI KCQK+GITVRMVTGDNVNTARSIA KCGI++PGDDFLV++GKEFN+RIR    GE +Q L DKVWP LRVLARSSPQDKYTLV GII S LNP REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVN+VA++VAFVGAC I DSPLKAVQMLWVNLIMDTLASLALATELP  +LL R PYGR+KPLI+R M+K I+G  IYQL+VI  LL AG+ + D+DSG    + G+ +KP+EHFT IFNTFVMMTLFNE+NARKIHG+RNIFEGL  N IF  I I T  +Q+VII+FGGYA ST+ L  D WLWC+F G GTLVWGQ++ ++P   +P    W                  G   ++++ S  +D      L    D   R+GQILWIRGL+RLQTQ   L+VVRAFK TLE+
Sbjct:    7 GRPARYGVTLKELRELMEYRGRDAVHKIRDEYGGVQELCKKLYTSPTDGLSGSAADLEHRQKTFGANLIPPRPPKTFLGLVWEALQDITLIILEVAALISLGLAFYKPPDDLELGGHDDSEADAGWIEGVAILVSVIIVVLVTAFNDYTKERQFRGLQNRIEHEHKFAAIRGGEVNQVLVGEIVVGDICQVKYGDLLPADGLIIQSNDLKVDESSLTGESDHVKKGESLDPVLLSGTHVMEGSGKMLVTAVGINSQAGIIFTLLGAAKTE-----DNEQKKKAKKAWHNDAKNTLECSPLTVPVSISDEE----AIVSGNSHLLNDSSGKANNKEAVEVVPAKQESNPRKEQSVLQAKLTKLAIQIGYAGSTIAVLTVLILGIRFAVKFFVINPRPW-SPFYMNYLVKFIIIGVTVLVVAVPEGLPLAVTLALAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQCFLCGTHHLDMPKYQNLPSNVADLLVTGIAINSAYTSRVMVDPMNVELPKQVGNKTECALLSFVKDIG-KDYQAVRDDIPEEKLHKVYTFNSVRKSMSTVIPIEG--GYRVFTKGASEIVLKKCHFIFARDGQIESFTKEDQDRLVKTVIEPMASEGLRTIAIAYKDYVYAAETQ-NQIQITSEPDWENEDAIVSELTCLCIVGIEDPVRPEVPDAIKKCQKSGITVRMVTGDNVNTARSIAMKCGIIRPGDDFLVIDGKEFNRRIRD-SNGEFQQHLFDKVWPRLRVLARSSPQDKYTLVKGIIDSKLNPNREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFVGACAIEDSPLKAVQMLWVNLIMDTLASLALATELPTPDLLLRKPYGRSKPLISRTMMKNILGHAIYQLVVIFTLLFAGDRIFDIDSG---LNSGLRAKPSEHFTIIFNTFVMMTLFNEMNARKIHGERNIFEGLFTNPIFYSILIITTAAQVVIIQFGGYAFSTTTLTLDQWLWCIFLGCGTLVWGQLITTLPTKRIPHTFTW----------------GSGTPEDDLSPSLGQDGGSSGSL--SQDVKSRTGQILWIRGLTRLQTQ---LRVVRAFKSTLED 1125          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A0X3PD52 (Calcium-transporting ATPase OS=Schistocephalus solidus OX=70667 GN=TR110591 PE=3 SV=1)

HSP 1 Score: 1327.38 bits (3434), Expect = 0.000e+0
Identity = 731/1208 (60.51%), Postives = 904/1208 (74.83%), Query Frame = 1
Query:  655 DRG-RADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYF-----GDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTAS-NQLKNGIDLTVKVEVTSEDGEKLSMI-ENDAYNSTRE--SPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVP--KRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEAHSIEXXXXXXXXXXXXXXXTSLSHPRPLSADSINPLHSSIPNSQQDLFGANTTRSQ 4242
            DRG R +F ++V +LQ +ME RG  A+ ++   Y GI GLC  L+TS   GL   D P R E++G+NVIPPKPPK F  LV+EAIQD+TLI+LIIAA +SL LS+YT Y      GD  + E+E GWIEGVAIL AV++VV V+AFNDW KERQFRGLQNKIES+HKF VIRN Q +++ V DILVGDICQ+KYGDLLPADG+++QSNDLK+DES+LTGESD VKK E+ DPI+LSGTHV+EGSG+I+ITAVGVNSQAGIIF LLGA           +E+Q+  K+ S ++ ++G++     +        L  + E +A  +  E  S +KKK K+   KE SVLQ KLTKLAIQIGY GT++A++TV IL++KF  + F  + + W T  HL++++ F I GVTVLVVAVPEGLPLAVT++LAYSV+KMM DNNLVRHLDACETMGNATAICSDKTGTLTTNRMT VQ +V   ++  LP  S+L +    LL+  I INSGYTS+++ P     L  QVGNKT+CALLGFV  LGG  Y+ +R +W E++L KVYTFNSVRKSMSTVI  +S+ G+ +FTKGASE+V+ +C +I+  +G+  PFS +DQE + ++VIE MA +GLRTI +AYK       G  NE    +EP++++E  I+SDLTCLAIVGIEDPVRPEVP AI +CQ+AGITVRMVTGDNVNTARSIATKCGIL+PG++FLV+EG+EFN+RIR   TG+V+Q+L DKVW +LRVLARSSPQDKY LVSGII S   PTR+VVAVTGDGTND PALK+ADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVN+VAI+VAF+GA  ++DSPLKAVQMLWVNLIMDTLASLALATELP  ELL R PYGRT PL+ R MIK I+   +YQL VI+ LL AGE +L+VDS RA  + G S+PT+HFT+IFNTFV+MTLFNE+NARKIHGQRNIF GL RN IFV IWI+T + QI+I++FGGYA ST ALD D W+WC+FFG+G L+WGQ++I IP++++P  K+ P VK                G   E     ++ + EP S +P E++  V+ GQILWIRGL+RLQTQM TLKVV AF+  L+  +  +        QR+     +L H +  S D  +  +S  P  QQ     +T   Q
Sbjct:   15 DRGPRQNFDITVNDLQRLMETRGANAVKYLRECYGGIQGLCTKLKTSTHNGLSGTDLPDRREVFGTNVIPPKPPKGFCVLVWEAIQDVTLIILIIAAFVSLALSLYTKYVDAEAAGD--ETESEAGWIEGVAILGAVLVVVLVVAFNDWSKERQFRGLQNKIESDHKFAVIRNGQLEQLPVSDILVGDICQVKYGDLLPADGILVQSNDLKIDESALTGESDQVKKSESKDPILLSGTHVVEGSGRIVITAVGVNSQAGIIFTLLGAT----------EEDQSRKKSGSISKGQDGVEAGRGKKKGGVKSNPLETVPEAEALTNKTEGQSEEKKKKKTRVRKEKSVLQTKLTKLAIQIGYAGTVIAVLTVFILVLKFSILTFAVEQQHWNTSKHLKRLVGFIITGVTVLVVAVPEGLPLAVTLALAYSVRKMMDDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTAVQCYVGEQHYRTLPTASQLPNLTSELLLQGIPINSGYTSKVLPPPQPGGLIIQVGNKTDCALLGFVNSLGG-NYETVRQEWPEEQLYKVYTFNSVRKSMSTVI-RDSKGGFLMFTKGASEMVVKRCKWILDADGKPKPFSDADQEILTRSVIEVMAGDGLRTICLAYKRFTTAPSGMPNEVTSPQEPNWDDEDAIISDLTCLAIVGIEDPVRPEVPPAIRQCQEAGITVRMVTGDNVNTARSIATKCGILQPGENFLVMEGQEFNRRIRDKTTGQVKQELFDKVWLNLRVLARSSPQDKYVLVSGIIKSRAGPTRQVVAVTGDGTNDAPALKRADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAILVAFIGAAVVSDSPLKAVQMLWVNLIMDTLASLALATELPTPELLKREPYGRTTPLVNRMMIKNILFHSLYQLAVILSLLFAGEYILEVDSARASVEHGNSRPTQHFTSIFNTFVLMTLFNEMNARKIHGQRNIFSGLFRNWIFVVIWISTFILQILIVQFGGYAFSTKALDIDQWMWCLFFGIGELIWGQLIICIPDSIIPECKKKPTVKP---------------GEVEEEEEEEEDIEAEP-SGIPSEEETAVK-GQILWIRGLNRLQTQMQTLKVVNAFRMGLDARYDRD--------QRKSLSAIALKHRQSASLDYADADNSVEPAQQQSAHEMDTIMHQ 1183          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A4Y2DZM8 (Calcium-transporting ATPase OS=Araneus ventricosus OX=182803 GN=ATP2B3_2 PE=3 SV=1)

HSP 1 Score: 1322.38 bits (3421), Expect = 0.000e+0
Identity = 721/1162 (62.05%), Postives = 867/1162 (74.61%), Query Frame = 1
Query:  661 GR-ADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQ--CDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYT----MYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDR-----------------PNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGI-SKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEE 4071
            GR A + +++KEL+++ME RG +A++ I ++Y G+  LC  L TSP +GL     D   R + +G+N+IPP+PPKTF  LV+EA+QD+TLI+L +AALISLGL+ Y     +  G H D EA+ GWIEGVAIL +V++VV V AFND+ KERQFRGLQN+IE EHKF  IR  +  ++ VG+I+VGDICQ+KYGDLLPADGLIIQSNDLK+DESSLTGESD VKKGE+ DP++LSGTHVMEGSGK+L+TAVG+NSQAGIIF LLGAA  E  ++                 P+A  N   N    + L   + ++ +  + S +   L+     A N         K +S   KE SVLQ KLTKLAIQIGY G+ +A++TV IL I+F    F  +   W +  ++  ++ F IIGVTVLVVAVPEGLPLAVT++LAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ F+ G++   +PKY  L S    LLV  I+INS YTS++MV     ELP QVGNKTECALL FV ++G   YQ +R+   E+KL KVYTFNSVRKSMSTVIP+E   GY +FTKGASEIV+ KC +I + +GQI  F+K DQ+++V+TVIEPMAS GLRTI IAYK+ ++ +    N+  IT EPD+ENE  IVS+LTCL IVGIEDPVRPEVP+AI KCQK+GITVRMVTGDNVNTARSIA KCGI++PGDDFLV++GKEFN+RIR    GE +Q L DKVWP LRVLARSSPQDKYTLV GII S LNP REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVN+VA++VAFVGAC I DSPLKAVQMLWVNLIMDTLASLALATELP  +LL R PYGR+KPLI+R M+K I+G  IYQL+VI  LL AG+ + D+DSG    + G+ +KP+EHFT IFNTFVMMTLFNE+NARKIHG+RNIFEGL  N IF  I I T  +Q+VII+FGGYA ST+ L  D WLWC+F G GTLVWGQ++ ++P   +P    W                  G   ++++ S  +D      L    D   R+GQILWIRGL+RLQTQ   L+VVRAFK TLE+
Sbjct:    7 GRPARYGVTLKELRELMEYRGRDAVHKIRDEYGGVQELCKKLYTSPTDGLSGSAADLEHRQKTFGANLIPPRPPKTFLGLVWEALQDITLIILEVAALISLGLAFYKPPDDLELGGHDDSEADAGWIEGVAILVSVIIVVLVTAFNDYTKERQFRGLQNRIEHEHKFAAIRGGEVNQVLVGEIVVGDICQVKYGDLLPADGLIIQSNDLKVDESSLTGESDHVKKGESLDPVLLSGTHVMEGSGKMLVTAVGINSQAGIIFTLLGAAKTEDNEQKKKAKKEAKKARKKKKEPSAWHNDAKNTLECSPLTVPVSISDEEAIVSGNSHLLNDSSGKANNKEAVEVVPAKQESNPRKEQSVLQAKLTKLAIQIGYAGSTIAVLTVLILGIRFAVKFFVINPRPW-SPFYMNYLVKFIIIGVTVLVVAVPEGLPLAVTLALAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQCFLCGTHHLDMPKYQNLPSNVADLLVTGIAINSAYTSRVMVDPMNVELPKQVGNKTECALLSFVKDIG-KDYQAVRDDIPEEKLHKVYTFNSVRKSMSTVIPIEG--GYRVFTKGASEIVLKKCHFIFARDGQIESFTKEDQDRLVKTVIEPMASEGLRTIAIAYKDYVYAAETQ-NQIQITSEPDWENEDAIVSELTCLCIVGIEDPVRPEVPDAIKKCQKSGITVRMVTGDNVNTARSIAMKCGIIRPGDDFLVIDGKEFNRRIRD-SNGEFQQHLFDKVWPRLRVLARSSPQDKYTLVKGIIDSKLNPNREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFVGACAIEDSPLKAVQMLWVNLIMDTLASLALATELPTPDLLLRKPYGRSKPLISRTMMKNILGHAIYQLVVIFTLLFAGDRIFDIDSG---LNSGLRAKPSEHFTIIFNTFVMMTLFNEMNARKIHGERNIFEGLFTNPIFYSILIITTAAQVVIIQFGGYAFSTTTLTLDQWLWCIFLGCGTLVWGQLITTLPTKRIPHTFTW----------------GSGTPEDDLSPSLGQDGGSSGSL--SQDVKSRTGQILWIRGLTRLQTQ---LRVVRAFKSTLED 1138          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A087U9V2 (Plasma membrane calcium-transporting ATPase 3 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_07328 PE=3 SV=1)

HSP 1 Score: 1316.21 bits (3405), Expect = 0.000e+0
Identity = 722/1171 (61.66%), Postives = 872/1171 (74.47%), Query Frame = 1
Query:  649 TGDRGRADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQ--CDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYT----MYFGDHKDD-EAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTA--------SNQLKNGID---LTVKVEVTSEDGEKLSMIENDAY--NSTRESPKKK----------KDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEE 4071
            T D   A + + +K+L+++ME RG EAI  I  +Y+G+  LC  L TSP +GL     D   R + +G+NVIPPKPPKTF +LV+EA+QD+TLI+L IAAL+SLGL+ Y     +  G   D+ E E GWIEGVAIL +V++VV V AFND+ KERQFRGLQN+IE EHKF VIR  +  +I VG+I+VGDICQ+KYGDLLPADG+IIQSNDLK+DESSLTGESD VKKGEN DPI+LSGTHVMEGSGK+L+TAVGVNSQAGIIF LLGAA  E E++    + +               N  KN ++   LTV V ++ E+    + +  +++  N +   P  K          K +S   KE SVLQ KLTKLAIQIGY G+ +A++TV IL+I+F    F  +   W +  ++  ++ F IIGVTVLVVAVPEGLPLAVT++LAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+F+ G++F   PKY  L S    LLV  I+INS YTS++M P    +LP QVGNKTECALL FVL+LG   YQ +R+   E+KL KVYTFNSVRKSMSTVIP+E   G+ +FTKGASE+V+ +C++I   +G++  F+K DQ+++V+T+IEPMA +GLRTI IAYK+ +F  +   N+  I  E D+E+E  ++SDLTCL IVGIEDPVRPEVP+AI KCQK+GITVRMVTGDNVNTARSIA KCGI++PGDDFLVL+GKEFN+RIR    GE +Q L+DKVWP LRVLARSSPQDKYTLV GII S LN  REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVN+VA++VAFVGAC I DSPLKAVQMLWVNLIMDTLASLALATE+P  +LL R PYGR+KPLI+R M+K I+G  IYQL VI  LL AG+ + D+DSG  L     +KP+EHFT IFNTFVMMTLFNEINARKIHG+RNIFEGL  N IF  I + T  +Q++II++GGYA ST+ L  D WLWCVF G GTLVWGQ++ SIP   +PK   W      P  M     + E  +  +++                  D+ R+GQILWIRGL+RLQTQ   L+VVRAFK TLE+
Sbjct:    3 TVDGRPAQYGVELKDLRELMECRGREAIQRIKEEYSGVQELCKKLYTSPTDGLSGSAADLEHRQKTFGANVIPPKPPKTFLELVWEALQDITLIILEIAALVSLGLAFYKPPEDLELGGSVDESEGEAGWIEGVAILVSVIIVVLVTAFNDYTKERQFRGLQNRIEHEHKFSVIRGGEVNQIPVGEIVVGDICQVKYGDLLPADGIIIQSNDLKVDESSLTGESDHVKKGENIDPILLSGTHVMEGSGKMLVTAVGVNSQAGIIFTLLGAAKSEDEEQKKKMKKEAKKARKKKKDASAWHNDAKNTLECSPLTVPVSISDEE----AAVSGNSHLINDSTAKPHNKDASGAEIVPLKQESNPRKEQSVLQTKLTKLAIQIGYAGSTIAILTVLILVIRFAVKFFVINPRPW-SPFYMNYLVKFIIIGVTVLVVAVPEGLPLAVTLALAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSFICGTHFKVPPKYENLPSNVGDLLVTGIAINSAYTSRVMPPDNPGDLPKQVGNKTECALLSFVLDLG-KDYQTVRDDIPEEKLHKVYTFNSVRKSMSTVIPIEG--GFRVFTKGASEMVLKRCNFIFGRDGKLERFTKEDQDRLVKTIIEPMACDGLRTIAIAYKDYVFIPQAQ-NQFQIDGEVDWEDEDNVISDLTCLCIVGIEDPVRPEVPDAIKKCQKSGITVRMVTGDNVNTARSIALKCGIIRPGDDFLVLDGKEFNRRIRD-SNGEFQQHLLDKVWPRLRVLARSSPQDKYTLVKGIIDSKLNQNREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFVGACAIEDSPLKAVQMLWVNLIMDTLASLALATEMPTPDLLLRKPYGRSKPLISRTMMKNILGHAIYQLAVIFTLLFAGDKIFDIDSG--LNAPLHAKPSEHFTIIFNTFVMMTLFNEINARKIHGERNIFEGLLTNPIFYSILVITAAAQVIIIQYGGYAFSTATLTIDQWLWCVFLGCGTLVWGQLITSIPTKRIPKTFTWGSGP--PEEMVGSASLVEDGSSGSLSQ-----------------DVKRTGQILWIRGLTRLQTQ---LRVVRAFKSTLED 1139          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: T1FP68 (Calcium-transporting ATPase OS=Helobdella robusta OX=6412 GN=20210615 PE=3 SV=1)

HSP 1 Score: 1311.59 bits (3393), Expect = 0.000e+0
Identity = 701/1134 (61.82%), Postives = 853/1134 (75.22%), Query Frame = 1
Query:  673 FKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQC--DDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDHK-----DDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYED--DDIVRSGQILWIRGLSRLQTQMNTLKVVR 4047
            F  ++KELQD+M+ RG      +  +Y     LC  L+TSP EGL    +D   RI +YGSN IPPKP K+F++L +EA+QD+TLI+LIIAA+ISLGLS Y     D       + E+  GWIEGVAIL AV++VV V AFNDWQKERQFRGLQ+KIE EHKF  +RN +  +I V D++VGD+CQ+KYGDLLPADG+IIQSNDLK+DESSLTGESD VKK EN DP++LSGTHVMEGSGK+LI AVGVNSQ+GIIF LLGA   + ++     ++  ++ TA  +   G  L         + E +++I++       E   +   +S   KE SVLQ KLTKLAIQIGYIGTIVA++TV ILI+ F    F    + W    +LQQ + FFIIGVTVLVVAVPEGLPLAVT++LAYSVKKMM DNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+++   +  K+PK++E S+  + L++++I+INSGYTS++M    KNELP QVGNKTECALLGF+++L    Y+  R    E+K+ KVYTFNSVRKSMSTVIP E+  GYT+FTKGASEIVM KC++I+   GQ  PF  SDQE I++ VIEPMAS+GLRTIG+AYKN ++ S G  N+ VI++EPD+ENE  IVS+LTCL  VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTARSIATKCGI+KP DDF+++EG +FN RIR        Q+LIDK+WP LRVLARSSPQDKYTLV GII S LNP REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVN+VA++ AF+GAC I DSPLKA+QMLWVNLIMDTLASLALATELP EE+L+R PYGRTKPLI+R M+K I+G  +YQL VI  LL AG  L D+D G+       +KPT+HFT IFN FVMMTLFNEINARKIHGQRN+FEGL RN +F+ IWI T ++Q++I++FG YA +T  L  + W+WC+F G+G LVWGQ++ +IP   +P++L                  A GA       +  K+ E +    YE+  DD+ + GQILWIRGL+RLQ Q+  + V +
Sbjct:    9 FGCTIKELQDLMQCRGKNGHLVLQQRYGSALELCKKLKTSPTEGLSGSEEDKKIRISVYGSNFIPPKPAKSFWRLAWEALQDVTLIILIIAAIISLGLSFYHPPLSDEDHLGSDETESSAGWIEGVAILGAVLVVVLVTAFNDWQKERQFRGLQSKIEHEHKFSTLRNGEVLQIGVADLVVGDVCQVKYGDLLPADGIIIQSNDLKIDESSLTGESDHVKKSENGDPMLLSGTHVMEGSGKMLIVAVGVNSQSGIIFTLLGATQEKAKE---TTKDATDSATAKTKGATGAPLA--------ELEDIALIDSTQDKKKTEESDQADKQSRGRKEKSVLQAKLTKLAIQIGYIGTIVALLTVIILILNFSITTFVVQKKPWSND-YLQQYVKFFIIGVTVLVVAVPEGLPLAVTLALAYSVKKMMLDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYIGDVHHKKIPKFTEFSANIQPLIIESIAINSGYTSRIMPSENKNELPKQVGNKTECALLGFLVDLE-QNYETARENMPEEKIHKVYTFNSVRKSMSTVIPREN--GYTLFTKGASEIVMKKCTWILDGQGQPRPFGVSDQENIIKRVIEPMASDGLRTIGVAYKNYVYGS-GQPNDVVISKEPDWENETDIVSNLTCLLFVGIEDPVRPEVPEAIKKCQRAGITVRMVTGDNINTARSIATKCGIIKPSDDFIIMEGPDFNSRIRRTLDDPPSQELIDKIWPKLRVLARSSPQDKYTLVKGIIDSKLNPNREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIAAFLGACVIKDSPLKAIQMLWVNLIMDTLASLALATELPNEEMLNRRPYGRTKPLISRTMMKNIIGHAVYQLTVIFVLLFAGHILFDIDDGKWQPPN--AKPTQHFTIIFNAFVMMTLFNEINARKIHGQRNVFEGLNRNPVFICIWIGTFIAQVIIVQFGSYAFATVGLSLEQWVWCLFLGIGELVWGQLITTIPTRRLPRKL------------------ALGA-------ASPKEIELLEQSAYEEGMDDMGKRGQILWIRGLNRLQHQIRVVNVFQ 1099          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: ENSAMXT00000014864.2 (pep primary_assembly:Astyanax_mexicanus-2.0:7:35306831:35359735:-1 gene:ENSAMXG00000014383.2 transcript:ENSAMXT00000014864.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1196.42 bits (3094), Expect = 0.000e+0
Identity = 669/1158 (57.77%), Postives = 830/1158 (71.68%), Query Frame = 1
Query:  667 ADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGL--QCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGD-----------HKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKS-IRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWK---TGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKG-YTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEAHSIE 4086
             +F  S+KEL+ +MELRG E I  I   Y  ++GLC+ L+TSP +GL  Q  D  +R  ++G N IPPK PKTF QLV+EA+QD+TLI+L +AA++SLGLS Y     D             + E+E GWIEG AIL +V+ VV V AFNDW KE+QFRGLQ++IE E KF V+R  Q  +I V +I+VGDI QIKYGDLLPADG++IQ NDLK+DESSLTGESD VKK    DP++LSGTHVMEGSGK+L+TA+GVNSQ GIIF LLGA   + ED    ++ +   +    + K            ++DG  + M      NS   +  ++K K+ +  KE SVLQ KLTKLA+QIG  G +++ +TV ILI+ F    F+  G  W+   T +++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQA++   ++ ++P+   +      LLV  IS+N  YT+++M P  +  LP QVGNKTECALLGFVL+L    YQ IRN+  E+KL KVYTFNSVRKSMSTV  L++  G + +F+KGASEI++ KC  I++  G+   F   D++ +V+ VIEPMAS GLRTI +AY++    S G         EPD+ENE+ I++ LTCL +VGIEDPVRPEVP+AI KCQ+AGITVRMVTGDN+NTAR+IATKCGIL+PGDDFL LEGKEFN+RIR+ K GE+ Q+ IDK+WP LRVLARSSP DK+TLV GII S +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P E LL R PYGR KPLI+R M+K I+G G+YQL +I  LL AGE + D+DSGR       + P+EH+T +FNTFVMM LFNEINARKIHG+RN+F+G+  N+IF  I   T + QIVI++FGG   S   L  + WLWCVF G G L+WGQV+ SIP +    RL ++K                G   E + + + +D E +  + + + ++ R GQILW RGL+R+QTQ   ++VV AF+ +L     +E
Sbjct:   23 GEFGCSLKELRGLMELRGTEGIRKIQETYADVNGLCSRLKTSPVDGLSGQPADLEKRTIVFGQNFIPPKKPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYRPPEADSTNCGEGTGGVEDEGESEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRGGQVIQIPVAEIVVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVKKTLEKDPMLLSGTHVMEGSGKMLVTAIGVNSQTGIIFTLLGAGGEDDEDEEKEEKKKEKERKKEKKTK------------AQDGAAMEM---QPLNSDEGADAEEKRKANLPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILIVLFIVNTFWVQGLAWEKSCTPIYIQFFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYIADKHYRRVPEPEVIPGSIMDLLVLGISVNCAYTTKIMSPEKEGGLPRQVGNKTECALLGFVLDLK-KDYQPIRNEIPEEKLYKVYTFNSVRKSMSTV--LKNPDGSFRMFSKGASEILLKKCYKILTATGEAKVFRPRDRDDMVKKVIEPMASEGLRTICLAYRD-FPASDG---------EPDWENESDILTSLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARAIATKCGILQPGDDFLCLEGKEFNRRIRNEK-GEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTVIEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNIVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHGVYQLTIIFTLLFAGERMFDIDSGRNAPLH--APPSEHYTIVFNTFVMMQLFNEINARKIHGERNVFDGIFNNMIFCSIVFGTFVIQIVIVQFGGKPFSCVGLSIEQWLWCVFLGFGCLLWGQVISSIPTS----RLKFLKTA------------GHGTQKEEIPDEELEDMEDLDEIDHAEREL-RRGQILWFRGLNRIQTQ---IRVVNAFRSSLSPYEGLE 1129          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2b4 (ATPase plasma membrane Ca2+ transporting 4 [Source:NCBI gene;Acc:103040534])

HSP 1 Score: 1190.25 bits (3078), Expect = 0.000e+0
Identity = 667/1158 (57.60%), Postives = 833/1158 (71.93%), Query Frame = 1
Query:  667 ADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCD--DFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGD-----------HKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPN------AQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWK---TGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEA 4074
             DF  +V +L+++MELR  EA+N I + +  + G+C  L+TSP EGL  +  D  +R   +G N IPPK PKTF QLV+EA+QD+TLI+L IAA+ISLGLS Y    GD             + E++ GWIEG AIL +V++VV V AFNDW KE+QFRGLQ++IE E KF VIR  Q  +I+V +I+VGDI QIKYGDLLPADG++IQ NDLK+DESSLTGESD V+K    DP++LSGTHVMEGSG++++TAVG+NSQ GIIF LLGA   E E +        A EN+N  KT     ++GI L ++         K            +E  K+ K  ++  KE SVLQ KLT+LA+QIG  G I++ VTV ILI+ F    F  + ++WK   T +++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQA+V  +++ K+P+   ++ +   L+V++ISINS YT++++ P  +  LP  VGNKTECALLG VL+L    YQ IR++  E+KL KVYTFNS RKSMSTV+      G+ +++KGASEI++ KCSYI+   GQ   F   D++++V+ VIEPMA +GLRTI +A ++      GD        EP+++NEA I++DLTC+ +VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTAR+IATKCGIL PG+DFL LEGKEFNQ+IR+ K GEV Q+ +DKVWP LRVLARSSP DK+TLV GII S +  TR+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDTLASLALATE P E LL R PYGR KPLI+R M+K I+G  +YQL V   LL AGE + ++DSGR       S P+EH+T IFN FVMM LFNEINARKIHG+RN+FEG+ RN IF  + I T   QI+I++FGG   S + L  D WLWCVF G+G L+WGQ + +IP      RL ++K+    ++    +   +  + + +++++ +               +R GQILW RGL+R+QTQ   +KVV AF+ +L E 
Sbjct:   21 GDFGCTVMDLRELMELRSAEAVNKIRDTHGDVQGICRRLKTSPIEGLSGNPSDLEKRHTAFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLGLSFYHPQGGDSNACGQAVGGVEDEGESQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRKGQVIQISVAEIVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLTGESDQVRKSLEKDPMLLSGTHVMEGSGRMVVTAVGLNSQTGIIFTLLGAGGEEEEKKVKKGKKQGAPENRNKAKT-----QDGIALEIQ-------PLKSDEGAEAEEKEEKEPQKEVKKVNVTKKEKSVLQGKLTRLAVQIGKAGLIMSAVTVIILILYFVISTFGVNKQEWKAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYVGDTHYKKVPEPEAINPETLELMVNSISINSAYTTKILSPEREGGLPRHVGNKTECALLGLVLDLK-RDYQPIRDEVPEEKLYKVYTFNSSRKSMSTVLKNPDGSGFRMYSKGASEIILRKCSYILDAAGQPRVFKPKDRDEMVRKVIEPMACDGLRTICVAKRDFT----GD--------EPNWDNEADILTDLTCICVVGIEDPVRPEVPEAISKCQRAGITVRMVTGDNINTARAIATKCGILLPGEDFLCLEGKEFNQQIRNDK-GEVEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTVGETRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASLALATEPPTEALLLRKPYGRDKPLISRTMMKNILGHAVYQLSVTFTLLFAGEKIFNIDSGRNSPLH--SPPSEHYTIIFNVFVMMQLFNEINARKIHGERNVFEGIYRNPIFCSVVIGTFALQIIIVQFGGKPFSCTGLTLDQWLWCVFIGVGELLWGQFITAIPT----HRLKFLKEAGHGITKEEIQQEEQTEDVDEIDHAEME---------------LRRGQILWFRGLNRIQTQ---IKVVNAFRSSLYEG 1128          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2b4 (ATPase plasma membrane Ca2+ transporting 4 [Source:NCBI gene;Acc:103040534])

HSP 1 Score: 1186.02 bits (3067), Expect = 0.000e+0
Identity = 660/1152 (57.29%), Postives = 827/1152 (71.79%), Query Frame = 1
Query:  667 ADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCD--DFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGD-----------HKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWK---TGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEA 4074
             DF  +V +L+++MELR  EA+N I + +  + G+C  L+TSP EGL  +  D  +R   +G N IPPK PKTF QLV+EA+QD+TLI+L IAA+ISLGLS Y    GD             + E++ GWIEG AIL +V++VV V AFNDW KE+QFRGLQ++IE E KF VIR  Q  +I+V +I+VGDI QIKYGDLLPADG++IQ NDLK+DESSLTGESD V+K    DP++LSGTHVMEGSG++++TAVG+NSQ GIIF LLGA   E E +    + Q+        LK+      + +   E  +++  +     N T+             KE SVLQ KLT+LA+QIG  G I++ VTV ILI+ F    F  + ++WK   T +++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQA+V  +++ K+P+   ++ +   L+V++ISINS YT++++ P  +  LP  VGNKTECALLG VL+L    YQ IR++  E+KL KVYTFNS RKSMSTV+      G+ +++KGASEI++ KCSYI+   GQ   F   D++++V+ VIEPMA +GLRTI +A ++      GD        EP+++NEA I++DLTC+ +VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTAR+IATKCGIL PG+DFL LEGKEFNQ+IR+ K GEV Q+ +DKVWP LRVLARSSP DK+TLV GII S +  TR+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDTLASLALATE P E LL R PYGR KPLI+R M+K I+G  +YQL V   LL AGE + ++DSGR       S P+EH+T IFN FVMM LFNEINARKIHG+RN+FEG+ RN IF  + I T   QI+I++FGG   S + L  D WLWCVF G+G L+WGQ + +IP      RL ++K+    ++    +   +  + + +++++ +               +R GQILW RGL+R+QTQ   +KVV AF+ +L E 
Sbjct:   21 GDFGCTVMDLRELMELRSAEAVNKIRDTHGDVQGICRRLKTSPIEGLSGNPSDLEKRHTAFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLGLSFYHPQGGDSNACGQAVGGVEDEGESQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRKGQVIQISVAEIVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLTGESDQVRKSLEKDPMLLSGTHVMEGSGRMVVTAVGLNSQTGIIFTLLGAGGEEEEKKVKKAKTQDGIALEIQPLKSDEGAEAEEKEEKEPQKEVKKV-----NVTK-------------KEKSVLQGKLTRLAVQIGKAGLIMSAVTVIILILYFVISTFGVNKQEWKAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYVGDTHYKKVPEPEAINPETLELMVNSISINSAYTTKILSPEREGGLPRHVGNKTECALLGLVLDLK-RDYQPIRDEVPEEKLYKVYTFNSSRKSMSTVLKNPDGSGFRMYSKGASEIILRKCSYILDAAGQPRVFKPKDRDEMVRKVIEPMACDGLRTICVAKRDFT----GD--------EPNWDNEADILTDLTCICVVGIEDPVRPEVPEAISKCQRAGITVRMVTGDNINTARAIATKCGILLPGEDFLCLEGKEFNQQIRNDK-GEVEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTVGETRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASLALATEPPTEALLLRKPYGRDKPLISRTMMKNILGHAVYQLSVTFTLLFAGEKIFNIDSGRNSPLH--SPPSEHYTIIFNVFVMMQLFNEINARKIHGERNVFEGIYRNPIFCSVVIGTFALQIIIVQFGGKPFSCTGLTLDQWLWCVFIGVGELLWGQFITAIPT----HRLKFLKEAGHGITKEEIQQEEQTEDVDEIDHAEME---------------LRRGQILWFRGLNRIQTQ---IKVVNAFRSSLYEG 1116          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2b4 (ATPase plasma membrane Ca2+ transporting 4 [Source:NCBI gene;Acc:103040534])

HSP 1 Score: 1184.09 bits (3062), Expect = 0.000e+0
Identity = 661/1145 (57.73%), Postives = 826/1145 (72.14%), Query Frame = 1
Query:  667 ADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCD--DFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGD-----------HKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPN------AQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWK---TGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTL 4035
             DF  +V +L+++MELR  EA+N I + +  + G+C  L+TSP EGL  +  D  +R   +G N IPPK PKTF QLV+EA+QD+TLI+L IAA+ISLGLS Y    GD             + E++ GWIEG AIL +V++VV V AFNDW KE+QFRGLQ++IE E KF VIR  Q  +I+V +I+VGDI QIKYGDLLPADG++IQ NDLK+DESSLTGESD V+K    DP++LSGTHVMEGSG++++TAVG+NSQ GIIF LLGA   E E +        A EN+N  KT     ++GI L ++         K            +E  K+ K  ++  KE SVLQ KLT+LA+QIG  G I++ VTV ILI+ F    F  + ++WK   T +++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQA+V  +++ K+P+   ++ +   L+V++ISINS YT++++ P  +  LP  VGNKTECALLG VL+L    YQ IR++  E+KL KVYTFNS RKSMSTV+      G+ +++KGASEI++ KCSYI+   GQ   F   D++++V+ VIEPMA +GLRTI +A ++      GD        EP+++NEA I++DLTC+ +VGIEDPVRPEVP AI KCQ+AGITVRMVTGDN+NTAR+IATKCGIL PG+DFL LEGKEFNQ+IR+ K GEV Q+ +DKVWP LRVLARSSP DK+TLV GII S +  TR+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDTLASLALATE P E LL R PYGR KPLI+R M+K I+G  +YQL V   LL AGE + ++DSGR       S P+EH+T IFN FVMM LFNEINARKIHG+RN+FEG+ RN IF  + I T   QI+I++FGG   S + L  D WLWCVF G+G L+WGQ + +IP      RL ++K+    ++    +   +  + + +++++ +               +R GQILW RGL+R+QTQM+ +
Sbjct:   21 GDFGCTVMDLRELMELRSAEAVNKIRDTHGDVQGICRRLKTSPIEGLSGNPSDLEKRHTAFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLGLSFYHPQGGDSNACGQAVGGVEDEGESQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRKGQVIQISVAEIVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLTGESDQVRKSLEKDPMLLSGTHVMEGSGRMVVTAVGLNSQTGIIFTLLGAGGEEEEKKVKKGKKQGAPENRNKAKT-----QDGIALEIQ-------PLKSDEGAEAEEKEEKEPQKEVKKVNVTKKEKSVLQGKLTRLAVQIGKAGLIMSAVTVIILILYFVISTFGVNKQEWKAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYVGDTHYKKVPEPEAINPETLELMVNSISINSAYTTKILSPEREGGLPRHVGNKTECALLGLVLDLK-RDYQPIRDEVPEEKLYKVYTFNSSRKSMSTVLKNPDGSGFRMYSKGASEIILRKCSYILDAAGQPRVFKPKDRDEMVRKVIEPMACDGLRTICVAKRDFT----GD--------EPNWDNEADILTDLTCICVVGIEDPVRPEVPEAISKCQRAGITVRMVTGDNINTARAIATKCGILLPGEDFLCLEGKEFNQQIRNDK-GEVEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTVGETRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASLALATEPPTEALLLRKPYGRDKPLISRTMMKNILGHAVYQLSVTFTLLFAGEKIFNIDSGRNSPLH--SPPSEHYTIIFNVFVMMQLFNEINARKIHGERNVFEGIYRNPIFCSVVIGTFALQIIIVQFGGKPFSCTGLTLDQWLWCVFIGVGELLWGQFITAIPT----HRLKFLKEAGHGITKEEIQQEEQTEDVDEIDHAEME---------------LRRGQILWFRGLNRIQTQMDVV 1118          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2b1b (plasma membrane calcium-transporting ATPase 1-like [Source:NCBI gene;Acc:103045095])

HSP 1 Score: 1175.61 bits (3040), Expect = 0.000e+0
Identity = 663/1167 (56.81%), Postives = 817/1167 (70.01%), Query Frame = 1
Query:  667 ADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGL--QCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXY-----------TMYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLK----------NGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQW---KTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKG-YTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEAHSIE 4086
            A+F  ++KEL+ +MELRG E +  I   Y  + GLC+ L++S  EGL    DD   R ++YG N IPPK PKTF QLV+EA+QD+TLI+L +AA+ISLGLS Y               G   + EAE GWIEG AIL +VV VV V AFNDW KE+QFRGLQ++IE E KF V+R  Q  +I V +++VGDI Q+KYGDLLPADG++IQ NDLK+DESSLTGESD VKK  + DP++LSGTHVMEGSGK+L+TAVGVNSQ GIIF LLGA   + ++    +E     +    + K           G+D      ++SEDG     I+ D           KK  ++  KE SVLQ KLTKLA+QIG  G  ++ +TV IL++ F    F+  G  W    T V++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQ +V   ++ K+P+   +  K   LLV  IS+N  YT+++M P  +  LP QVGNKTECALLGF L+L    YQ IRN++ E+K  KVYTFNSVRKSMSTV  L +  G Y +F+KGASEI++ KC  I++ NG+ + F   D++ +++ VIEPMAS GLRTI +AY++            V   EPD++NE  I++ LTC+ +VGIEDPVRPEVP+AI KCQ+AGITVRMVTGDN+NTAR+IATKCGIL PGDDFL LEGKEFN+RIR+ + GE+ Q+ ID++WP LRVLARSSP DK+TLV GII S +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P E LL R PYGR KPLI+R M+K I+G  IYQL +I  LL AGE + D+DSGR       + P+EH+T +FNTFVMM LFNEINARKIHG+RN+F+G+  N+IF  I   T L QIVI++FGG   S   L  + WLWCVF G G L+WGQ++ +IP +    RL ++          + +   +     +M+  D  + E            +R GQ+LW RGL R+QTQ   ++VV AF+  +     +E
Sbjct:   22 AEFGCTLKELRSLMELRGPEGLQRIQECYGDVQGLCSRLKSSCTEGLSGHSDDIANRKDVYGKNFIPPKKPKTFLQLVWEALQDVTLIILEVAAIISLGLSFYRPPDAERENCGKAAGGVEDEGEAEAGWIEGAAILLSVVCVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRGGQIIQIPVAELVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVKKTMDKDPMLLSGTHVMEGSGKMLVTAVGVNSQTGIIFTLLGAGDEDGDNEDEKEEKDRKKREKEEKKKEKERKKKEKKGGVDTE---PLSSEDG-----IDGDV----------KKKTNLPKKEKSVLQGKLTKLAVQIGKAGLFMSAITVIILVVLFLVDTFWVQGLPWIKDCTPVYIQFFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQVYVGDRHYRKVPEPDLIPGKIMDLLVTGISVNCAYTTKIMPPEREGGLPRQVGNKTECALLGFSLDLR-KDYQIIRNEYPEEKFFKVYTFNSVRKSMSTV--LRNYDGSYRMFSKGASEILLKKCCKILTANGEPIYFKPRDRDDLMKMVIEPMASEGLRTICLAYRDF----------PVSEGEPDWDNETDILTGLTCICVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARAIATKCGILHPGDDFLCLEGKEFNRRIRN-ELGEIEQERIDRIWPKLRVLARSSPTDKHTLVKGIIDSTVVEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAIYQLTIIFTLLFAGEQIFDIDSGRNAPLH--APPSEHYTIVFNTFVMMQLFNEINARKIHGERNVFDGIFNNLIFCSIVFGTFLIQIVIVQFGGKPFSCVGLSIEQWLWCVFLGFGCLLWGQLITTIPTS----RLKFLMTAG--HGTQKEEIPEDELEEMDMDEIDHAEME------------LRRGQVLWCRGLQRIQTQ---IRVVNAFREAMSPYEGLE 1133          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007912.1 (pep scaffold:Pmarinus_7.0:GL490738:3481:17315:-1 gene:ENSPMAG00000007146.1 transcript:ENSPMAT00000007912.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 469.159 bits (1206), Expect = 2.878e-151
Identity = 240/420 (57.14%), Postives = 309/420 (73.57%), Query Frame = 1
Query: 1609 ESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQW---KTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEV 2859
            E  K+KK  ++  KE SVLQ KLTKLA+QIG  G +++ +TV IL++ F    F+  G  W    T +++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQA+V   ++  +P    L+     +L   I++N  YT++++ P  +  LP QVGNKTECALLG + E+    YQ +R++  E++L KVYTFNSVRKSMSTV+   +  G+ +++KGASEI++ KCS I+   G+   F   D++++V+ VIEPMA +GLRTI +AY++    S           EP +++E  IV++LTC+ +VGIEDPVRPEVPNAI  CQ+AGITVRMVTGDN+NTAR+IA+KCGIL P +DFL +EGKEFN+RIR+ K GEV
Sbjct:   23 EDHKEKKRSNVTKKEKSVLQGKLTKLAVQIGKAGLVMSAITVVILVLYFVIETFWVQGMPWLPECTPIYVQFFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAYVGDVHYCSVPSPDALAPAIMDVLTTGIAVNCAYTTKILPPEKEGGLPRQVGNKTECALLGLLAEMRR-DYQAVRDELPEERLYKVYTFNSVRKSMSTVLH-NADGGFRLYSKGASEILLKKCSRILGATGETRGFRLRDRDEMVRKVIEPMACDGLRTICLAYRDFPIGS-----------EPKWDDENAIVNELTCVTVVGIEDPVRPEVPNAIKMCQRAGITVRMVTGDNINTARAIASKCGILHPNEDFLCIEGKEFNRRIRNDK-GEV 428          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007505.1 (pep scaffold:Pmarinus_7.0:GL487901:1873:6828:1 gene:ENSPMAG00000006781.1 transcript:ENSPMAT00000007505.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 237.654 bits (605), Expect = 1.473e-72
Identity = 116/134 (86.57%), Postives = 122/134 (91.04%), Query Frame = 1
Query: 2998 DGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIK 3399
            DGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDTLASLALATE P E LL R PYGR KPL++R M K
Sbjct:    1 DGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASLALATEPPTEALLLRRPYGRNKPLVSRTMTK 134          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010373.1 (pep scaffold:Pmarinus_7.0:GL481096:3909:20014:1 gene:ENSPMAG00000009373.1 transcript:ENSPMAT00000010373.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 234.958 bits (598), Expect = 5.972e-64
Identity = 198/620 (31.94%), Postives = 305/620 (49.19%), Query Frame = 1
Query: 1663 LQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFV----EGSNFTKLPKYSELSSKFRAL-----------------LVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLG-------FVLELGGPTYQEIRNKWT---EDKLRKVYT--FNSVRKSMST----VIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIE-PMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFL--VLEGKEFN------QRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLIT 3384
            LQ KL +   Q+     +++++ +A+ II          G  W  G      I +F I V + V A+PEGLP  +T  LA   ++M K N +VR L + ET+G  + ICSDKTGTLTTN+M+V + F+    +G N + L +++   S +                    L++  +I +      +       +  +VG  TE AL         F   L G +  E  N      +  ++K +T  F+  RKSMS     V P  S  G  +F KGA E V+ +CS+ V      +P +   +EKI+ T+ E     + LR + +A +++    R D+N    T+   +E +   V    C+  VG+ DP R EV ++I+ C++AGI V    GDN  TA +I  + GI    +D       G+EF+      QR+   +                R  AR  P  K  +V       L    E+ A+TGDG ND PALKKA++G AMG +GT VAK AS+++L DDNF+SIV AV  GR +Y+++ +F+++ ++ N+  +V  F+ A       L  VQ+LWVNL+ D L + AL    P  ++++R P    +PLI+
Sbjct:   97 LQQKLDEFGEQLS---KVISLICIAVWIINIGHFNDPVHGGSWMRGA-----IYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIIDRADGENCS-LNEFTITGSTYAPEGEVYKNDKLVRCGEYDGLIELATICALCNDSSLDFNEAKGVYEKVGEATETALTCQVEKMNVFDTHLVGLSKVERANACNNVIKQLMKKEFTLEFSRDRKSMSVYCTPVKPSRSSVGNKMFVKGAPEGVIDRCSH-VRVGTTKLPMTAGMKEKILATIREYGTGRDTLRCLALATRDMP-PRREDMNLIDSTKFASYEVDLTFVG---CVG-VGMLDPPRKEVSSSIILCREAGIRV---IGDNKGTAVAICRRIGIFGEDEDVKDKAYTGREFDDLPLEEQRLACQRA---------------RCFARVEPSHKSKIVE-----FLQSCDEITAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRNPKEPLIS 677          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001468.1 (pep scaffold:Pmarinus_7.0:GL477283:10882:33618:1 gene:ENSPMAG00000001326.1 transcript:ENSPMAT00000001468.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 217.238 bits (552), Expect = 6.352e-64
Identity = 135/246 (54.88%), Postives = 170/246 (69.11%), Query Frame = 1
Query:  649 TGDRGRADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQ--CDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXY-----------TMYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSG 1347
            +G     DF LSV EL+ +MELRG EAI  +   Y G  G+C  L TSP +GL     D  +R  ++G N IPPK PKTF +LV+EA+QD+TLI+L IAA++SLGLS Y           ++  G   + E+  GWIEG AIL +V  VV V AFNDW KERQFRGLQ++IE E +F VIR  Q  ++ V DI+VGDI Q+KYGDLLPADG++IQSNDLK+DESSLTGESD V+K  + DP++LSG
Sbjct:   18 SGGSQDGDFGLSVDELRALMELRGPEAIAMVQEAYGGKEGVCRRLHTSPNDGLPGTAADLEKRRLVFGQNFIPPKKPKTFLELVWEALQDVTLIILEIAAIVSLGLSFYQPPGQNSDMCGSVSGGAEDEGESAAGWIEGAAILLSVACVVLVTAFNDWSKERQFRGLQSRIEQEQRFSVIRGGQLLQLPVADIVVGDIAQVKYGDLLPADGMLIQSNDLKIDESSLTGESDHVRKSIDRDPMLLSG 263          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002775.1 (pep scaffold:Pmarinus_7.0:GL486089:3809:7949:1 gene:ENSPMAG00000002528.1 transcript:ENSPMAT00000002775.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 212.616 bits (540), Expect = 1.346e-62
Identity = 128/227 (56.39%), Postives = 169/227 (74.45%), Query Frame = 1
Query:  814 DDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDHKD---------DEA--EVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDR 1461
            +D   R + +G N IPPK PK+F  LV+ A+QD+TLI+L +AA++SLGLS Y    G++ +         +EA  + GWIEG AIL  VV+VV V AFNDW KERQFRGLQ++IE E KF VIR  Q  E+ V +++VGD+ Q+KYGDLLPADG+++Q N+L +DESSLTGESD + K  + DP++LSGTHVMEGSG++++TAVG+NSQ+GIIF LLGA S E  D+
Sbjct:    7 EDLEWRRKTFGRNHIPPKKPKSFVALVWHALQDVTLIILEVAAVVSLGLSFYRPPEGENTELCGQSSGSIEEAGSDTGWIEGTAILLTVVVVVLVTAFNDWSKERQFRGLQSRIEQEQKFSVIRGGQLVEVHVAELVVGDVAQVKYGDLLPADGVLLQGNELSVDESSLTGESDHLSKSPDCDPMLLSGTHVMEGSGRMVVTAVGINSQSGIIFTLLGATSGESSDK 233          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: PMC1 (Vacuolar Ca2+ ATPase involved in depleting cytosol of Ca2+ ions; prevents growth inhibition by activation of calcineurin in the presence of elevated concentrations of calcium; similar to mammalian PMCA1a [Source:SGD;Acc:S000002974])

HSP 1 Score: 304.679 bits (779), Expect = 1.486e-85
Identity = 208/556 (37.41%), Postives = 300/556 (53.96%), Query Frame = 1
Query: 2269 KWTEDKLRKVYTFNSVRKSMSTVIPLESRKG----YTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPD-------FENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILK---PGDDFLVLEGKEF-----NQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITD--SPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTI-FNTFVMMTLFNEINARKIH--------------GQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLP 3828
            K+  +K+ +   F S RK    V+  +  K     Y  F KGA+EIV   CSY  +++  +   ++ D +K     I+ +AS+ LR I +A+K+          +    + P+       F ++  ++ D     ++GI+DP+R  V  ++ +CQ+AG+TVRMVTGDN+ TA++IA  C IL      + +  +EG EF     N+RIR              + P+LRVLARSSP+DK  LV       L    +VVAVTGDGTND PALK ADVGF+MGI+GT+VA+EASDIIL  D+F++IV A+ WGR V  SI KF+QFQL VN+ A+++ FV +   +D  S L AVQ+LW+NLIMDTLA+LALAT+ P   ++DR P GR+  LI+    K I+ Q   QLIV   L   G  L      +   D+  S   +    + FNTFV +  F  + +RK+                  N F+ L RN  F+ I       Q++I+ FGG   S +      W+  V  G+ +L+ G ++   P+ V  K  P
Sbjct:  603 KFNIEKVVQTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSYKRNSDDTLEEINE-DNKKETDDEIKNLASDALRAISVAHKDFCECDSWPPEQLRDKDSPNIAALDLLFNSQKGLILD----GLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILSTDISSEAYSAMEGTEFRKLTKNERIR--------------ILPNLRVLARSSPEDKRLLVE-----TLKGMGDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFSAIVNAIKWGRCVSVSIKKFIQFQLIVNITAVILTFVSSVASSDETSVLTAVQLLWINLIMDTLAALALATDKPDPNIMDRKPRGRSTSLISVSTWKMILSQATLQLIVTFILHFYGPELF----FKKHEDEITSHQQQQLNAMTFNTFVWLQFFTMLVSRKLDEGDGISNWRGRISAANLNFFQDLGRNYYFLTIMAIIGSCQVLIMFFGGAPFSIARQTKSMWITAVLCGMLSLIMGVLVRICPDEVAVKVFP 1130          

HSP 2 Score: 128.257 bits (321), Expect = 4.476e-30
Identity = 67/139 (48.20%), Postives = 90/139 (64.75%), Query Frame = 1
Query: 1651 EMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDG--EQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNF 2061
            E + LQL L++LA  I   G + A++   +L  ++ F    +DG            + +N FI  +TV+VVAVPEGLPLAVT++LA++  +M KD NLVR L +CETMG+ATA+CSDKTGTLT N MTVV+ F   S F
Sbjct:  329 ESTPLQLHLSQLADNISVYGCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKTGTLTENVMTVVRGFPGNSKF 467          

HSP 3 Score: 100.523 bits (249), Expect = 1.419e-21
Identity = 100/309 (32.36%), Postives = 154/309 (49.84%), Query Frame = 1
Query:  670 DFKLSVKELQDI---------MELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCDDFPR-----RIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDHKDDE-----AEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKK-----------------GENF-----------------DPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGA 1437
            +FKLS  +L D+         + L G+E+           + L   L+T    G+   +        R + YG N +P + PK+F QLV+ A  D T+ +L +AA++S  L +Y ++    + D       +V WIEGVAI+ AV +VV V A ND+QKE QF  L NK +   K  VIRN Q   I++  +LVGD+  ++ GD++PAD ++I S   + DESS+TGES+ ++K                   N                  D +++SG+ ++ G G+ +IT+VG+NS  G     L A
Sbjct:   31 NFKLSKSQLSDLHNPKSIRSFVRLFGYES-----------NSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLPERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGNKIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKL-NKKKENRKIIVIRNDQEILISIHHVLVGDVISLQTGDVVPADCVMI-SGKCEADESSITGESNTIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGSRILSGLGRGVITSVGINSVYGQTMTSLNA 326          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: PMR1 (High affinity Ca2+/Mn2+ P-type ATPase; required for Ca2+ and Mn2+ transport into Golgi; involved in Ca2+ dependent protein sorting, processing; D53A mutant (Mn2+ transporting) is rapamycin sensitive, Q783A mutant (Ca2+ transporting) is rapamycin resistant; Mn2+ transport into Golgi lumen required for rapamycin sensitivity; mutations in human homolog ATP2C1 cause acantholytic skin condition Hailey-Hailey disease; human ATP2C1 can complement yeast null mutant [Source:SGD;Acc:S000003135])

HSP 1 Score: 290.812 bits (743), Expect = 3.370e-82
Identity = 259/890 (29.10%), Postives = 419/890 (47.08%), Query Frame = 1
Query: 1078 DWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYS----------------ELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVI--PLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTI-FNTFVMMTLFNEINARKIHGQRNIFE-GLQRNVIFVFIWIATILSQIVII 3687
            +++ E+    L   + +E    ++R  Q   +    ++ GD+   + GD +PAD  II++ DL +DES+LT        GEN +P+  +   + + S      ++   S+   I A +G    E                      +G  + V     +  G    M+ N       E PK            + LQL + KL   +  +  IV  +   + II+         G  W         +  F I V++ V A+PEGLP+ VT++LA  V +M K   +VR L + ET+G+   ICSDKTGTLT+N MTV + +   S   KL   S                 L+   R  L      N+   SQ        E    +GN T+ ALL    +L      +IRN  T  K++++  FNS RK M+T I  P++++   T++ KGA E ++   +  + + G+        Q+  +      MAS GLR  G A   +  +S      T +TE+        ++ DLT   ++G+ DP RP V  AI +  + G+ + M+TGD+ NTA +IA + GI        VL G + +         E+  D +  V   + + AR++P+ K  +V       L    +VVA+TGDG ND PALK +D+G +MG  GTDVAKEASD++LTDD+F++I+ A+  G+ ++++I  FL FQL+ ++ A+ +  +   F   +PL A+Q+LW+N++MD   + +L  E    E++ + P  RT  ++T  ++K        +L+     +I G   + V   + +A+ G  K T   TT+ F  FV   +FN +  R  H  ++IFE G   N +F +    ++L Q+  I
Sbjct:  135 EYRSEKSLEALNKLVPAE--CHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDESNLT--------GEN-EPVHKTSQTIEKSSFNDQPNSIVPISERSCI-AYMGTLVKE---------------------GHGKGIVVGTGTNTSFGAVFEMMNN------IEKPK------------TPLQLTMDKLGKDLSLVSFIVIGMICLVGIIQ---------GRSW---------LEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNGNLKNYLTEDVRETLTIGNLCNNASFSQ--------EHAIFLGNPTDVALLE---QLANFEMPDIRN--TVQKVQEL-PFNSKRKLMATKILNPVDNK--CTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMASEGLRVFGFAKLTLSDSS------TPLTED--------LIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLD---------EMSDDQLANVIDHVNIFARATPEHKLNIVRA-----LRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMK--------RLLTTAACIIVGTVYIFV---KEMAEDG--KVTARDTTMTFTCFVFFDMFNALACR--HNTKSIFEIGFFTNKMFNYAVGLSLLGQMCAI 896          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: ENA2 (P-type ATPase sodium pump; involved in Na+ efflux to allow salt tolerance; likely not involved in Li+ efflux [Source:SGD;Acc:S000002446])

HSP 1 Score: 198.364 bits (503), Expect = 8.017e-52
Identity = 131/369 (35.50%), Postives = 198/369 (53.66%), Query Frame = 1
Query: 2299 YTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNG-QIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGD---------DFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDS-----PLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPY 3360
            + F+S  K MS+V      + Y I+ KGA E ++S CS     +G +I P +  D E I + V   +++ GLR +G A K+   +   D     IT      N A   SDL  L ++GI DP R E   A+ K  +AGI V M+TGD V TA++IA + GIL P +         D +V+ G +F+          + ++ +D +     V+AR SPQ K  ++       L+  ++  A+TGDG ND P+LK A+VG AMGI G+DV+KEASDI+L+DDNF SI+ AV  GR + D+I KF+   L  N+   +   +G  F  ++     PL  V++LW+ ++     ++ L  E    +L+DR P+
Sbjct:  535 FPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYS-LSNEGLRVLGFASKSFTKDQVNDDQLKNITS-----NRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGIL-PTNLYHYSQEIVDSMVMTGSQFDG---------LSEEEVDDLPVLPLVIARCSPQTKVRMIEA-----LHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPH 882          

HSP 2 Score: 92.8189 bits (229), Expect = 3.130e-19
Identity = 91/357 (25.49%), Postives = 145/357 (40.62%), Query Frame = 1
Query: 1015 WIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFD-------------PIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFV 2046
            WI G  I   + + V +    +++  +    L+N   S     VIRN +S+ I   D++ GDIC +K GD +PAD  +I++ +   DES LTGES  V K  N                +  S + V++G  K ++    +NS+ G I   L   S  +   P+    QN                                       T  S KK     +     + L  KL+KLA+ + +I  + A++ +A         +F  D                 I  + V +  +P  L + +TI+++     M+  N +VR LD+ E +G    ICSDKTGTLT  +M   Q ++
Sbjct:   91 WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNL--SSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQN---------------------------------------TWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQ-------KFDVDKR-------------VAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWI 386          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: ENA5 (Protein with similarity to P-type ATPase sodium pumps; member of the Na+ efflux ATPase family [Source:SGD;Acc:S000002445])

HSP 1 Score: 197.208 bits (500), Expect = 1.720e-51
Identity = 131/368 (35.60%), Postives = 197/368 (53.53%), Query Frame = 1
Query: 2299 YTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNG-QIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGD---------DFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDS-----PLKAVQMLWVNLIMDTLASLALATELPGEELLDRAP 3357
            + F+S  K MS+V      + Y I+ KGA E ++S CS     +G +I P +  D E I + V   +++ GLR +G A K+   +   D     IT      N A   SDL  L ++GI DP R E   A+ K  +AGI V M+TGD V TA++IA + GIL P +         D +V+ G +F+          + ++ +D +     V+AR SPQ K  ++       L+  ++  A+TGDG ND P+LK A+VG AMGI G+DV+KEASDI+L+DDNF SI+ AV  GR + D+I KF+   L  N+   +   +G  F  ++     PL  V++LW+ ++     ++ L  E    +L+DR P
Sbjct:  535 FPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYS-LSNEGLRVLGFASKSFTKDQVNDDQLKNITS-----NRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGIL-PTNLYHYSQEIVDSMVMTGSQFDG---------LSEEEVDDLPVLPLVIARCSPQTKVRMIEA-----LHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPP 881          

HSP 2 Score: 92.8189 bits (229), Expect = 2.950e-19
Identity = 91/357 (25.49%), Postives = 145/357 (40.62%), Query Frame = 1
Query: 1015 WIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFD-------------PIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFV 2046
            WI G  I   + + V +    +++  +    L+N   S     VIRN +S+ I   D++ GDIC +K GD +PAD  +I++ +   DES LTGES  V K  N                +  S + V++G  K ++    +NS+ G I   L   S  +   P+    QN                                       T  S KK     +     + L  KL+KLA+ + +I  + A++ +A         +F  D                 I  + V +  +P  L + +TI+++     M+  N +VR LD+ E +G    ICSDKTGTLT  +M   Q ++
Sbjct:   91 WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNL--SSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQN---------------------------------------TWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQ-------KFDVDKR-------------VAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWI 386          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: ENA1 (P-type ATPase sodium pump; involved in Na+ and Li+ efflux to allow salt tolerance [Source:SGD;Acc:S000002447])

HSP 1 Score: 196.438 bits (498), Expect = 3.354e-51
Identity = 132/381 (34.65%), Postives = 201/381 (52.76%), Query Frame = 1
Query: 2299 YTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNG-QIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGD---------DFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDS-----PLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMI 3396
            + F+S  K MS+V      + Y I+ KGA E ++S CS     +G +I P +  D E I + V   +++ GLR +G A K+   +   D     IT      N A   SDL  L ++GI DP R E   A+ K  +AGI V M+TGD V TA++IA + GIL P +         D +V+ G +F+          + ++ +D +     V+AR SPQ K  ++       L+  ++   +TGDG ND P+LK A+VG AMGI G+DV+KEASDI+L+DDNF SI+ AV  GR + D+I KF+   L  N+   +   +G  F  ++     PL  V++LW+ ++     ++ L  E    +L+DR P+     + T  +I
Sbjct:  535 FPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYS-LSNEGLRVLGFASKSFTKDQVNDDQLKNITS-----NRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGIL-PTNLYHYSQEIVDSMVMTGSQFDG---------LSEEEVDDLPVLPLVIARCSPQTKVRMIEA-----LHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVI 894          

HSP 2 Score: 95.5153 bits (236), Expect = 4.199e-20
Identity = 111/453 (24.50%), Postives = 179/453 (39.51%), Query Frame = 1
Query:  742 NNKYNGISGLCAG-----LRTSPAEGLQCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFD-------------PIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFV 2046
            N ++N    L A      + TS  EGL  D+F  R++  G N +       +  +V   + +         A+I + L    + F  H        WI G  I   + + V +    +++  +    L+N   S     VIRN +S+ I   D++ GDIC +K GD +PAD  +I++ +   DES LTGES  V K  N                +  S + V++G  K ++    +NS+ G I   L   S  +   P+    QN                                       T  S KK     +     + L  KL+KLA+ + +I  + A++ +A         +F  D                 I  + V +  +P  L + +TI+++     M+  N +VR LD+ E +G    ICSDKTGTLT  +M   Q ++
Sbjct:   11 NAEFNAYHTLTAEEAAEFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCN---------AMIMVLLISMIISFAMHD-------WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNL--SSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQN---------------------------------------TWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQ-------KFDVDKR-------------VAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWI 386          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO41775 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3I0])

HSP 1 Score: 1092.03 bits (2823), Expect = 0.000e+0
Identity = 628/1145 (54.85%), Postives = 793/1145 (69.26%), Query Frame = 1
Query:  667 ADFK-LSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCDDFPRRIE----IYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKY-SELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRG-DINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEAHS 4080
            ADF  +SV +L+ +M+ RG EA +H+ +   G+ GL   L TS  +G+    FP  IE    ++G NVIPPKPPKTF++ + +A +D TLI+L +AA++SL L I+     +    EA  GWI+G AIL AV +V  V A ND+QKE+QFRGLQ+KIE EHKF VIRN  ++EI   +I+VGD+CQIKYGDLLPADG+++QSNDLK+DESSLTGESD VKKGE  DP+ L+GTH+MEGSGK+++TAVG+NSQ+GIIF LLGA        P+  ++ ++    S  +K               G+    +  D    + E+ K++KDK    +E SVLQ KLTKLA+ IG+ G   A++T+ ++ ++F   ++ K+   W+   HL   +N FI G+TVLVVAVPEGLPLAVTISLAYSVKKM+ DNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ +  G +   +P+   E S +   +L   I++NS Y S  +V   +  LP QVGNKTECALLG VL+LG  TYQ+ R+   E    KVYTFNS RKSMST I +    GY +F+KGASEI++S+C+ I+  NGQ  PFS  D   +VQ+VIEPMAS+GLRTI +AY++  F   G D ++T     PD+++EA I+S++T +AI GIEDPVR EVP AI KCQ+AGI VRMVTGDNVNTARSIA KCGIL+P  DFLVL+GKEFN+ IR    G V Q   D++WP LRVLARSSP+DKYTLV GII S LNP RE+VAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF SIV AVMWGRNVYDSISKFLQFQLTVNLVAIV+AFVGAC +  SPL   Q+LWVNLIMD+ ASLALATE P EELL R PYGRTKPLITR MI+ I+G G+YQ+IV+  L+  G    D++ G    ++   KPT+H   IFNTFV+M LFNEIN+R +HG+RN+F+G+ RN IFV I   T + QI+IIE  G A     L+ + W+WC+F G   L+WGQ++++IP    PK L     + +P++     D A  +                              ++LWIRGL+RLQ Q   ++VV AF+  ++   S
Sbjct:   25 ADFSDISVGDLKQLMKCRGLEAKDHLAST-GGLHGLVRKLHTSTEKGIS--GFPEDIENRKRVFGPNVIPPKPPKTFWEFLVDACKDTTLIILTVAAVVSLLLGIFAPE--ECGGSEANTGWIDGFAILIAVCIVALVTAVNDYQKEQQFRGLQSKIELEHKFTVIRNGDAKEILNSEIVVGDLCQIKYGDLLPADGVVVQSNDLKVDESSLTGESDMVKKGEK-DPLFLAGTHIMEGSGKMIVTAVGLNSQSGIIFTLLGAT------HPDKIDSGDDAPPQSPAIKGA------------PGDDFEDVNLDDDQESSENGKERKDK----QEKSVLQAKLTKLAVTIGWFGVAAALLTIIVMALQFSIRKYVKEKASWQN-THLNAYVNAFITGLTVLVVAVPEGLPLAVTISLAYSVKKMLDDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQLYTMGQHHKTIPENPKEFSPELLEILCKGIALNSSYASNCVVNGGREILPMQVGNKTECALLGLVLDLGD-TYQDYRDNNPESTFVKVYTFNSSRKSMSTAIRMPD-GGYRLFSKGASEILLSRCTSIIGRNGQPEPFSSQDCLSLVQSVIEPMASDGLRTICMAYRD--FPPTGKDHDDT----PPDWDDEAGILSEMTAIAIAGIEDPVRQEVPAAIKKCQQAGIVVRMVTGDNVNTARSIAGKCGILEPDKDFLVLDGKEFNKLIRD-SNGRVSQKKFDEIWPRLRVLARSSPEDKYTLVKGIIDSKLNPAREIVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFRSIVMAVMWGRNVYDSISKFLQFQLTVNLVAIVIAFVGACVVEVSPLTGTQLLWVNLIMDSFASLALATEPPTEELLTRKPYGRTKPLITRTMIRNILGHGVYQIIVLFVLVFKGAEFFDIEDG--FLEETRCKPTQHSAVIFNTFVLMQLFNEINSRMVHGERNVFKGIFRNPIFVGIMGGTFIVQILIIELTGKAFHVVGLNWEQWMWCIFLGFTELLWGQLVLTIPKESFPK-LCRFGTEGVPIATIIEPDGARDSR----------------------------ARLLWIRGLTRLQHQ---IRVVNAFRSAIDGGRS 1097          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO41774 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3H9])

HSP 1 Score: 732.635 bits (1890), Expect = 0.000e+0
Identity = 421/1051 (40.06%), Postives = 653/1051 (62.13%), Query Frame = 1
Query:  682 SVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQ--CDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDHKDD-EAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQS-QEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKY--SELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVP 3816
            S ++L+++M  +   A   I+  ++G+  L   LRTS  +GL    D+   R ++YGSN +P    ++ F  +  +++D  LIVL+I A+ISL L +  +Y    K     EV W EGV IL  VVL++ + A +D+ ++  FR  Q ++  E +  VIR+  + ++I   +++VGD+C +K G L+ ADG+++QS+DL +DE+  +      +     DP+V +GTHV++G+GK ++ AVG ++QA +   L   AS  +E +P A     NNK + N L+                                  K+ K+      E + L+ K+ ++A+ +GYIG  VA++T+ ++++ F    +Y + +  K    +   +  FI+G+ VLVV+VPEGLPLAVT +LA+  K M    +LV+H+D  ETMGN + I  +KTG LT +RM V + F+        PK    ++ S+    L  AIS+N+ Y+SQ+  P  ++ LP QVGNKT+C+LL  +LE+G  TYQ  R+   ED+  KV+ F S RKSM+TV+  E + G+ ++TKGA+EI++ +C+  ++T+G++ PF+  D+E++ + V+E M    L+ + +A +++  + +G +           E+EA+++ DLT +A+VGIEDP+R +VP AI KC +AGI V MV+GD++ TAR++A + GILKP +D L+  G+EFN  IR P  G+V  D  + +WP L+VLAR++ +DKYTLV  ++ S +N   E+VAVTG G +DGP L+KADVGF MG++G+DVAK+++D++L DDNF SIV A+ WGRNVY+++ KFL FQ TV   A +V  +GAC    SPL A Q+LWVNLIMD+LASLAL  + P ++LL   PYGR K LI R +I+ +VG  I+QL+V+  L+      LD+  G       I +P++H + +F TFV M +FNEIN+R +HG RN+F+G+ RN++F+ IWIA +  Q++I+E    A +T  +DA+ WLWC+F GL  L+W QV+ + P T +P
Sbjct:   16 SKQKLEEVMTSQSEHAKQFIDQNFDGMQTLIRNLRTSAFKGLTGFADNLAHRRQVYGSNEMPLARRRSLFHFLLYSMKDWILIVLVIGAIISLVLGL--VYPESCKGVINGEVAWYEGVGILVMVVLMILISALSDYLRDADFRCQQKRVHMEERVTVIRDSGAVKDILKSELVVGDLCLLKAGSLVAADGVVVQSSDLVVDETLFSRSE---RHKSVVDPLVFAGTHVVKGTGKFIVLAVGASTQAMMQLRLGDPASPGIELQP-APAGPINNKGSQNLLEF---------------------------------KRHKE------ENATLEGKVNRVAVALGYIGIAVALITMIVIMVHFSVTNYYTNEKPAKPE-DVNMYVRAFIMGMVVLVVSVPEGLPLAVTFALAFCTKMMYNKQSLVKHMDIIETMGNVSNIYCNKTGVLTEHRMRVDRMFIADQLLDGDPKVYKHKIPSELLDDLFKAISLNTSYSSQIQ-PAGRDHLPVQVGNKTDCSLLQLMLEMG-ETYQYWRDDHPEDRFVKVFAFTSERKSMTTVLEKE-KDGFYVYTKGAAEILLPRCTSTITTDGKMRPFTDEDRERLRKEVMEEMHKQALKILVLACRSLSDSDKGLL-----------EDEAKVLEDLTLMAVVGIEDPIREKVPEAIWKCDRAGIRVCMVSGDSIQTARAVAARVGILKPDEDILMYTGQEFNSYIRDPD-GKVNTDRFNSMWPKLKVLARATARDKYTLVKHVMGSGVNRQGEMVAVTGAGVHDGPVLRKADVGFTMGVSGSDVAKDSADVVLLDDNFGSIVWAIKWGRNVYNTVVKFLMFQFTVTWSAFIVVVIGACVTGRSPLGATQLLWVNLIMDSLASLALTRDFPTDDLLRHQPYGRHKALIGRTLIRNVVGHVIFQLVVMFVLIFKAHEWLDIKDG--FQTDTICQPSQHSSLVFTTFVFMQVFNEINSRSVHG-RNMFKGIHRNIVFICIWIAQVSIQVLIVEVFTRAFNTKGMDAEQWLWCIFLGLSELIWAQVIYTFPKTWLP 1002          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO44517 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVV7])

HSP 1 Score: 434.876 bits (1117), Expect = 4.737e-131
Identity = 257/692 (37.14%), Postives = 406/692 (58.67%), Query Frame = 1
Query: 1804 HLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMT-----VVQAFVEGSNFTKLPKY--SELSSKFRALLVDAISINSGYTSQLMVPRTK---NELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNG-LRTIGIAYKNVIFN--SRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLE-------GKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPK 3819
            H  +II  FII V +++VA PEGL +AVTI+L+ S++ M   +  VR+ D  ETMG+ T +C +KTG LT          V + FV G +F     +  S+++ K    +   I+IN+ Y S + V RT+   +    QVG+ TECALL F  +LG   Y  IR     ++  KV+ F+   +SM+TV+  +    Y ++ KG+ E+V+ +C  +++ + Q      +D+ K V  +I  M     L+ + +AY    F   SR    E  +++EP+++ E +I+SD+  +  VG+E+ VR EV  AI++C++AG+ + MVTG ++ TA S A  CGIL P   +  +E        K  N+ I S  +G++ Q   DK+WP +RV++R +P+ K + +  I  S +    EVVAV   G +D   L+ ADVG +MG  GTD+A+EASDI+L  D F+S++  + WGR++Y+++ KFLQFQLT   V ++V  +GA     S   A Q+LW+NLIMD LASLAL  + P +++L   PYGR KPLI+R +++ ++G  IYQ+ V+  ++    +  D   G   + + + +PT+H T +F TF++M LFNE+N R++   RN+F G   + +F+ + +  I  QI+I++F   +     LD   WLWC FFG   L+WGQ++ S+P  V+P+
Sbjct:  330 HWNEIIKTFIIAVVIIIVAEPEGLSMAVTITLSRSLRNMCAQDIFVRNADVLETMGSVTTLCCNKTGVLTAVSKIPLYEEVAECFVGGKHFRGDTSHYKSDIAVKVVHEVAKGIAINTSYNSNIQV-RTQLVSSSERNQVGDITECALLQFTADLG-VYYPFIREANPCEEFSKVFPFSPETRSMTTVV--KENATYKVYCKGSPEVVLPRCVRLLNMDEQEETLD-ADRLKKVNDIITAMQEKSQLKVMCLAYGTTPFKGRSRDVCMEPRLSKEPNWDEENRILSDMHFVGFVGMEESVRGEVSEAILRCRRAGLMITMVTGASLQTAGSFAQNCGILTPNKYWPAVEKTIIGYDSKLLNEEI-SDDSGKISQVEFDKLWPDVRVVSRCTPEGKRSFMQAIRRSRVRREGEVVAVVASGVHDANFLRDADVGLSMGATGTDIAQEASDIVLKGDKFSSVLDTIKWGRHIYETVLKFLQFQLTATWVTMIVLIIGAILFQKSIFSAAQLLWLNLIMDALASLALTGDHPTDDILRHKPYGRNKPLISRAVLRNVIGHAIYQIAVVFIVIYLIADFTDTRFG--YSAESLCRPTQHSTMVFTTFILMQLFNEVNCRRV-SSRNVFSG-PFDWVFLIVLLLCIGVQIIIVQFFTNSFRVEPLDWQQWLWCFFFGFSELIWGQIIFSVPKGVIPR 1011          

HSP 2 Score: 123.25 bits (308), Expect = 3.790e-28
Identity = 83/248 (33.47%), Postives = 143/248 (57.66%), Query Frame = 1
Query:  691 ELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGL--QCDDFPRRIEIYGSNVIPPKPPKT-FFQLVFEAIQDLTXXXXXXXXXXXXXXXXY--TMYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGII 1419
            +L +I+  +  + +  +++ + G+ G+   L+TS  +G+    D   RR + +GSN I  +  +  FF+ +  ++ D+ LI+L++  + S+ L  Y   +  G +  D  +  W+EG  IL    ++V +   +D+ +E+ F  LQ +IESE K +V+R  + +EI   D+ VGD+C I  G ++PADG+++++ +L  DESSL  ES   K     DP V + THV EGSGK++I AVG ++Q   I
Sbjct:   17 KLVEILTQKDGKGLQMLDDDFGGVRGIIHRLQTSSKKGILDTSDALARRTKSFGSNRISGQAKRRGFFRALLYSMTDIVLILLVLGGIASVILGYYYREVCKGKYIPDSEKNAWMEGAGILGTAAVIVLLSTLSDYLREKSFYRLQKRIESERKTRVMRGGEMKEICYQDVKVGDLCVIGPGSIIPADGILVENTELTTDESSLNKESRASKTSR--DPFVFASTHVTEGSGKMIILAVGDSTQIAAI 262          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO35616 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL15])

HSP 1 Score: 256.144 bits (653), Expect = 1.405e-70
Identity = 243/856 (28.39%), Postives = 388/856 (45.33%), Query Frame = 1
Query: 1195 GDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRV--KEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPK--YSELSSKFRALLVDAISINSGYTSQLMVPRT------------KNELPTQVGNKTECALLGFVLELG----GPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKC-SYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFE-GLQRNVIFVFIWIATILSQIVIIEFG 3696
            GD+  I  GD +PAD  + ++ DL++DESS TGE                    ME + K  +    VNS +G+                +A+ N     T       G  + +     SE GE   +++ +      E+PK    KS+    K++S   L +  L + +G+I                                  + I+  F IGV++ V A+PEGLP+ VT++LA  V +M K N +V+ L   ET+G ++ ICSDKTGTLT N MTV Q F     + +     YS L      L  D I+    YTS   + +T            +N +    G  TE A++    +      G  +  +  +    + +K+      RK  S+ +   +R  Y  + KGA E VM +C SY    NG  +P +  D E+I   V+  M+S GLR I  A+                          + +  LT L I+G+ DP R  V  A+     +G+ V+M+TGD+  TA +IA   GI   G     L G+E          G     +ID+V     V  R SP+ K  +V       L     VVA+TGDG ND  ALK+AD+G AMG +GTDV+KEA+++IL DD+F +I+ A+  G+ ++ +I  F++FQL+ ++ AI +  +       +PL A+Q+LW+N+IMD   + +L  E    +++ R P     P+IT+ +I  ++   +  +   +++             R + D  I+ P +  T  F  FV   +FN ++ R    +++IF+ G   N +F++    +++ Q ++I F 
Sbjct:  143 GDLVCISIGDRVPADIRLTEAVDLEIDESSFTGE--------------------MEPASKTTLPIPAVNSGSGV----------------SARRNIAFMGTLVRS-GRGKGVVIGTGENSEFGEIFKLMKAE------ETPKTPLQKSMDSLGKQLSFYSLCIIGLIVLLGWI--------------------------------QKRAILEMFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMAKRNAIVKKLPIVETLGCSSVICSDKTGTLTKNEMTVSQIFTADGFYAEATGVGYSPLGEVI--LNEDPIT----YTSNSSIAKTVEAGYLCNNASIRNGV--LYGQPTEGAIVTVAQKASTFTCGIDFVRVDERPFSSE-KKLMAVKCRRKHRSSAMAEIARDIY--YVKGAPENVMRQCTSYY--KNGSAVPMTAKDVERIGDAVLA-MSSRGLRVIAFAH-------------------------GEDLQQLTYLGIMGLLDPPRNGVREAVRTLLDSGVQVKMITGDSRETAITIAELLGIHFKGRP--TLSGEELEAL-----DGLQLSTIIDQV----SVFYRVSPRHKVAIVKA-----LQQHGHVVAMTGDGVNDAVALKRADIGIAMGKSGTDVSKEAAEMILVDDDFNTIMAAIEEGKGIFYNIKNFVRFQLSTSIAAISLITISTFLKLPNPLNAMQILWINIIMDGPPAQSLGVEPVDSDVMRRPPRNVKSPMITKTLIAKVISAALLIVCGTLWVFW-----------REMRDNIIT-PRDT-TMTFTCFVFFDMFNALSCRS--QEKSIFQVGFLTNRMFLYAVGGSLIGQFLVIYFA 853          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO36455 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SII2])

HSP 1 Score: 242.662 bits (618), Expect = 1.680e-65
Identity = 197/608 (32.40%), Postives = 305/608 (50.16%), Query Frame = 1
Query: 1678 TKLAIQIGYIGTIVAMVTVAILIIKF--CFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNF----------TKLPKYSELSSKFR-ALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFV-LELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSP--------------KTGEVRQDLIDKVWPSLR------VLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYG-RTKPLITRPMI 3396
            T +AI+IG+   I+  V VA+ +  F    V  Y           LQ +I  F+IG+  +V  VPEGL   VT+ L  + K+M   N LV++L+A ET+G+ + ICSDKTGTLT NRMTV   + +   F          T + K    ++  R A L +     SG  +  ++ R      T  GN +E ALL  V L++G  T  ++R ++         + N    S+  +    S   + +  KGA E V+ +CS I+   G++ P    D ++  +     +   G R +G A ++ +      I     T+EP+F      V  L  + ++ + DP R  VP+A+ KC+ AGI V MVTGD+  TA++IA   GI+  G + +    ++ + R+  P                GE++ D+ DK    +       V AR+SPQ K  +V G           +VAVTGDG ND PALKKAD+G AMGI+G+DV+K+A+D+IL DDNF SIV  V  GR ++D++ K + + LT N+  I    +        PL  + +L ++L  D + +++LA E    +++ R P   RT+ L+   +I
Sbjct:  317 TPIAIEIGHFIHIITGVAVALGVTFFIISLVLGY---------TILQAVI--FLIGI--IVANVPEGLLATVTVCLTLTAKRMAAKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKTFEADTTEDQSGTAMEKTETWTALGRIAGLCNRAEFVSGQDNVAVLRRD-----TMGGNASEAALLKCVELQVGSVT--KMREEFHRVAEIPFNSTNKYHVSIHEINDENSTYSHHLLMKGAPERVLDRCSTIL-IKGELKPLD-DDMKQAFEMAYLDLGGMGERVLGFA-QHYLDKENFPIGFEFETDEPNFP-----VEGLCFVGLMSMIDPPRAAVPDAVAKCRSAGIKVFMVTGDHPITAKAIAQGVGIISEGTETV----EDISLRLEIPVEEVDKSQADAIVVHGGELK-DMTDKDIDDILKNHKEIVFARTSPQQKLIIVEG-----CQRNGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLMFIVAGIPQPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRMPRDPRTEKLVNERLI 886          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2b2 (ATPase plasma membrane Ca2+ transporting 2 [Source:NCBI gene;Acc:101156400])

HSP 1 Score: 1199.88 bits (3103), Expect = 0.000e+0
Identity = 666/1154 (57.71%), Postives = 828/1154 (71.75%), Query Frame = 1
Query:  667 ADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQC--DDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXY------------TMYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEK-LSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWK---TGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEA 4074
            ADF  SV +L+ +MELRG E +  +   Y G+ GLC  L+TSP EGL     D  +R EI+G N+IPPK PKTF QLV+EA+QD+TLI+L +AALISLGLS Y            +   G   + EA+ GWIEG AIL +VV VV V AFNDW KE+QFRGLQ++IE E KFQV+R  Q  ++ V DILVGDI QIKYGDLLPADG++IQ NDLK+DESSLTGESD VKK  + DP++LSGTHVMEGSG++++TAVGVNSQ GIIF LLGA   E E +        +    + ++++G   + +++V  +DG   + M    +        K+KK  S   KE SVLQ KLTKLA+QIGY G +++ +TV IL++ F    F      W    T +++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMT VQ ++   ++ K+P    L  K   LL++AI+INS YT++++ P  +  LP QVGNKTEC LLG +LEL    YQ IRN+  E+KL KVYTFNSVRKSMSTVI L     + +++KGASEIV+ KCS+I++  G++  F   D++++V+ VIEPMA  GLRTI +AY++  F++           EP++++E  I++DLT + +VGIEDPVRPEVP+AI KCQ+AGITVRMVTGDN+NTAR+IA KCGI+ PG+DFL ++GKEFN+RIR+ K GEV Q+ IDKVWP LRVLARSSP DK+TLV GII S +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P E LL R PYGR KPLI+  M K I+G  +YQL++I  LL  GE + D+DSGR       S P+EH+T IFNTFVMM LFNEINARKIHG+RN+F+G+ RN IF  I   T + QIVI++FGG   S   L+ + W+WCVF GLG LVWGQV+ +IPN     +L ++++      ++ + ++ E    E     D  + E            +R GQILW RGL+R+QTQ   ++VV AF+ +L E 
Sbjct:   22 ADFGCSVMDLRSLMELRGTEGVVKLQEDYGGVEGLCKRLKTSPTEGLLGVQADLDKRKEIFGKNLIPPKKPKTFLQLVWEALQDVTLIILELAALISLGLSFYHPPGESGGEMCGSAAGGVEDEGEADAGWIEGAAILLSVVCVVIVTAFNDWSKEKQFRGLQSRIEQEQKFQVVRGSQVIQLPVADILVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVKKAADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGVEEEEKKEKKGGAVEDGHQNTGKMQDGNMESNQIKVKKQDGAAAMEMQPLKSAEGGEADEKEKKKVSAPKKEKSVLQGKLTKLAVQIGYAGLVMSSITVTILVLYFSIDNFVMKKRPWMAECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTAVQCYIGDVHYKKIPDPGVLPPKSLDLLINAIAINSAYTTKILPPDKEGGLPKQVGNKTECGLLGLILELK-RDYQPIRNQIPEEKLYKVYTFNSVRKSMSTVIKLPD-GSFRMYSKGASEIVLKKCSHILNEVGELRVFRPRDKDEMVKKVIEPMACEGLRTICVAYRD--FSN---------DPEPNWDDENNILNDLTAICVVGIEDPVRPEVPDAIQKCQRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCIDGKEFNRRIRNEK-GEVEQERIDKVWPKLRVLARSSPTDKHTLVKGIIDSTMADQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPNESLLKRKPYGRNKPLISSTMTKNILGHAVYQLVIIFTLLFVGEQIFDIDSGRDAPLH--SPPSEHYTLIFNTFVMMQLFNEINARKIHGERNVFDGIFRNPIFCSIVFGTFVVQIVIVQFGGKPFSCQPLNLEKWMWCVFLGLGELVWGQVIATIPNL----KLRFLRRAG---QLTHKDELPEEDVNEENEEIDHAERE------------LRRGQILWFRGLNRIQTQ---IRVVNAFRSSLYEG 1137          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2b2 (ATPase plasma membrane Ca2+ transporting 2 [Source:NCBI gene;Acc:101156400])

HSP 1 Score: 1191.41 bits (3081), Expect = 0.000e+0
Identity = 668/1154 (57.89%), Postives = 821/1154 (71.14%), Query Frame = 1
Query:  667 ADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQC--DDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXY------------TMYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQ-LKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWK---TGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEA 4074
            ADF  SV +L+ +MELRG E +  +   Y G+ GLC  L+TSP EGL     D  +R EI+G N+IPPK PKTF QLV+EA+QD+TLI+L +AALISLGLS Y            +   G   + EA+ GWIEG AIL +VV VV V AFNDW KE+QFRGLQ++IE E KFQV+R  Q  ++ V DILVGDI QIKYGDLLPADG++IQ NDLK+DESSLTGESD VKK  + DP++LSGTHVMEGSG++++TAVGVNSQ GIIF LLGA   E E +    + Q+       Q LK           ++E GE                 K+KK  S   KE SVLQ KLTKLA+QIGY G +++ +TV IL++ F    F      W    T +++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMT VQ ++   ++ K+P    L  K   LL++AI+INS YT++++ P  +  LP QVGNKTEC LLG +LEL    YQ IRN+  E+KL KVYTFNSVRKSMSTVI L     + +++KGASEIV+ KCS+I++  G++  F   D++++V+ VIEPMA  GLRTI +AY++  F++           EP++++E  I++DLT + +VGIEDPVRPEVP+AI KCQ+AGITVRMVTGDN+NTAR+IA KCGI+ PG+DFL ++GKEFN+RIR+ K GEV Q+ IDKVWP LRVLARSSP DK+TLV GII S +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P E LL R PYGR KPLI+  M K I+G  +YQL++I  LL  GE + D+DSGR       S P+EH+T IFNTFVMM LFNEINARKIHG+RN+F+G+ RN IF  I   T + QIVI++FGG   S   L+ + W+WCVF GLG LVWGQV+ +IPN     +L ++++      ++ + ++ E    E     D  + E            +R GQILW RGL+R+QTQ   ++VV AF+ +L E 
Sbjct:   22 ADFGCSVMDLRSLMELRGTEGVVKLQEDYGGVEGLCKRLKTSPTEGLLGVQADLDKRKEIFGKNLIPPKKPKTFLQLVWEALQDVTLIILELAALISLGLSFYHPPGESGGEMCGSAAGGVEDEGEADAGWIEGAAILLSVVCVVIVTAFNDWSKEKQFRGLQSRIEQEQKFQVVRGSQVIQLPVADILVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVKKAADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGVEEEEKKEKKVKKQDGAAAMEMQPLK-----------SAEGGEA--------------DEKEKKKVSAPKKEKSVLQGKLTKLAVQIGYAGLVMSSITVTILVLYFSIDNFVMKKRPWMAECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTAVQCYIGDVHYKKIPDPGVLPPKSLDLLINAIAINSAYTTKILPPDKEGGLPKQVGNKTECGLLGLILELKR-DYQPIRNQIPEEKLYKVYTFNSVRKSMSTVIKLPD-GSFRMYSKGASEIVLKKCSHILNEVGELRVFRPRDKDEMVKKVIEPMACEGLRTICVAYRD--FSN---------DPEPNWDDENNILNDLTAICVVGIEDPVRPEVPDAIQKCQRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCIDGKEFNRRIRNEK-GEVEQERIDKVWPKLRVLARSSPTDKHTLVKGIIDSTMADQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPNESLLKRKPYGRNKPLISSTMTKNILGHAVYQLVIIFTLLFVGEQIFDIDSGRDAPLH--SPPSEHYTLIFNTFVMMQLFNEINARKIHGERNVFDGIFRNPIFCSIVFGTFVVQIVIVQFGGKPFSCQPLNLEKWMWCVFLGLGELVWGQVIATIPNL----KLRFLRRAG---QLTHKDELPEEDVNEENEEIDHAERE------------LRRGQILWFRGLNRIQTQ---IRVVNAFRSSLYEG 1112          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2b2 (ATPase plasma membrane Ca2+ transporting 2 [Source:NCBI gene;Acc:101156400])

HSP 1 Score: 1191.41 bits (3081), Expect = 0.000e+0
Identity = 673/1185 (56.79%), Postives = 830/1185 (70.04%), Query Frame = 1
Query:  667 ADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQC--DDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXY------------TMYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAA----------------SHELED------RPNAQENQNN----NKTASNQLKNGIDL-----TVKVEVTSEDGEK-LSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWK---TGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEA 4074
            ADF  SV +L+ +MELRG E +  +   Y G+ GLC  L+TSP EGL     D  +R EI+G N+IPPK PKTF QLV+EA+QD+TLI+L +AALISLGLS Y            +   G   + EA+ GWIEG AIL +VV VV V AFNDW KE+QFRGLQ++IE E KFQV+R  Q  ++ V DILVGDI QIKYGDLLPADG++IQ NDLK+DESSLTGESD VKK  + DP++LSGTHVMEGSG++++TAVGVNSQ GIIF LLGA                  H+  D       P A    +     N T S  L NG        + +++V  +DG   + M    +        K+KK  S   KE SVLQ KLTKLA+QIGY G +++ +TV IL++ F    F      W    T +++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMT VQ ++   ++ K+P    L  K   LL++AI+INS YT++++ P  +  LP QVGNKTEC LLG +LEL    YQ IRN+  E+KL KVYTFNSVRKSMSTVI L     + +++KGASEIV+ KCS+I++  G++  F   D++++V+ VIEPMA  GLRTI +AY++  F++           EP++++E  I++DLT + +VGIEDPVRPEVP+AI KCQ+AGITVRMVTGDN+NTAR+IA KCGI+ PG+DFL ++GKEFN+RIR+ K GEV Q+ IDKVWP LRVLARSSP DK+TLV GII S +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P E LL R PYGR KPLI+  M K I+G  +YQL++I  LL  GE + D+DSGR       S P+EH+T IFNTFVMM LFNEINARKIHG+RN+F+G+ RN IF  I   T + QIVI++FGG   S   L+ + W+WCVF GLG LVWGQV+ +IPN     +L ++++      ++ + ++ E    E     D  + E            +R GQILW RGL+R+QTQ   ++VV AF+ +L E 
Sbjct:   22 ADFGCSVMDLRSLMELRGTEGVVKLQEDYGGVEGLCKRLKTSPTEGLLGVQADLDKRKEIFGKNLIPPKKPKTFLQLVWEALQDVTLIILELAALISLGLSFYHPPGESGGEMCGSAAGGVEDEGEADAGWIEGAAILLSVVCVVIVTAFNDWSKEKQFRGLQSRIEQEQKFQVVRGSQVIQLPVADILVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVKKAADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGVEEEEKKEKKGGAVEDGHQNTDCSHPPIHPIATITTDGAAGINATGSANLINGKMQDGNMESNQIKVKKQDGAAAMEMQPLKSAEGGEADEKEKKKVSAPKKEKSVLQGKLTKLAVQIGYAGLVMSSITVTILVLYFSIDNFVMKKRPWMAECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTAVQCYIGDVHYKKIPDPGVLPPKSLDLLINAIAINSAYTTKILPPDKEGGLPKQVGNKTECGLLGLILELK-RDYQPIRNQIPEEKLYKVYTFNSVRKSMSTVIKLPD-GSFRMYSKGASEIVLKKCSHILNEVGELRVFRPRDKDEMVKKVIEPMACEGLRTICVAYRD--FSN---------DPEPNWDDENNILNDLTAICVVGIEDPVRPEVPDAIQKCQRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCIDGKEFNRRIRNEK-GEVEQERIDKVWPKLRVLARSSPTDKHTLVKGIIDSTMADQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPNESLLKRKPYGRNKPLISSTMTKNILGHAVYQLVIIFTLLFVGEQIFDIDSGRDAPLH--SPPSEHYTLIFNTFVMMQLFNEINARKIHGERNVFDGIFRNPIFCSIVFGTFVVQIVIVQFGGKPFSCQPLNLEKWMWCVFLGLGELVWGQVIATIPNL----KLRFLRRAG---QLTHKDELPEEDVNEENEEIDHAERE------------LRRGQILWFRGLNRIQTQ---IRVVNAFRSSLYEG 1168          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2b2 (ATPase plasma membrane Ca2+ transporting 2 [Source:NCBI gene;Acc:101156400])

HSP 1 Score: 1187.17 bits (3070), Expect = 0.000e+0
Identity = 671/1179 (56.91%), Postives = 826/1179 (70.06%), Query Frame = 1
Query:  667 ADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQC--DDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXY------------TMYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAA----------------SHELED------RPNAQENQNN----NKTASNQLKNGIDL-----TVKVEVTSEDGEK-LSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWK---TGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFK 4056
            ADF  SV +L+ +MELRG E +  +   Y G+ GLC  L+TSP EGL     D  +R EI+G N+IPPK PKTF QLV+EA+QD+TLI+L +AALISLGLS Y            +   G   + EA+ GWIEG AIL +VV VV V AFNDW KE+QFRGLQ++IE E KFQV+R  Q  ++ V DILVGDI QIKYGDLLPADG++IQ NDLK+DESSLTGESD VKK  + DP++LSGTHVMEGSG++++TAVGVNSQ GIIF LLGA                  H+  D       P A    +     N T S  L NG        + +++V  +DG   + M    +        K+KK  S   KE SVLQ KLTKLA+QIGY G +++ +TV IL++ F    F      W    T +++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMT VQ ++   ++ K+P    L  K   LL++AI+INS YT++++ P  +  LP QVGNKTEC LLG +LEL    YQ IRN+  E+KL KVYTFNSVRKSMSTVI L     + +++KGASEIV+ KCS+I++  G++  F   D++++V+ VIEPMA  GLRTI +AY++  F++           EP++++E  I++DLT + +VGIEDPVRPEVP+AI KCQ+AGITVRMVTGDN+NTAR+IA KCGI+ PG+DFL ++GKEFN+RIR+ K GEV Q+ IDKVWP LRVLARSSP DK+TLV GII S +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P E LL R PYGR KPLI+  M K I+G  +YQL++I  LL  GE + D+DSGR       S P+EH+T IFNTFVMM LFNEINARKIHG+RN+F+G+ RN IF  I   T + QIVI++FGG   S   L+ + W+WCVF GLG LVWGQV+ +IPN     +L ++++      ++ + ++ E    E     D  + E            +R GQILW RGL+R+QTQ   ++VV  FK
Sbjct:   22 ADFGCSVMDLRSLMELRGTEGVVKLQEDYGGVEGLCKRLKTSPTEGLLGVQADLDKRKEIFGKNLIPPKKPKTFLQLVWEALQDVTLIILELAALISLGLSFYHPPGESGGEMCGSAAGGVEDEGEADAGWIEGAAILLSVVCVVIVTAFNDWSKEKQFRGLQSRIEQEQKFQVVRGSQVIQLPVADILVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVKKAADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGVEEEEKKEKKGGAVEDGHQNTDCSHPPIHPIATITTDGAAGINATGSANLINGKMQDGNMESNQIKVKKQDGAAAMEMQPLKSAEGGEADEKEKKKVSAPKKEKSVLQGKLTKLAVQIGYAGLVMSSITVTILVLYFSIDNFVMKKRPWMAECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTAVQCYIGDVHYKKIPDPGVLPPKSLDLLINAIAINSAYTTKILPPDKEGGLPKQVGNKTECGLLGLILELK-RDYQPIRNQIPEEKLYKVYTFNSVRKSMSTVIKLPD-GSFRMYSKGASEIVLKKCSHILNEVGELRVFRPRDKDEMVKKVIEPMACEGLRTICVAYRD--FSN---------DPEPNWDDENNILNDLTAICVVGIEDPVRPEVPDAIQKCQRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCIDGKEFNRRIRNEK-GEVEQERIDKVWPKLRVLARSSPTDKHTLVKGIIDSTMADQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPNESLLKRKPYGRNKPLISSTMTKNILGHAVYQLVIIFTLLFVGEQIFDIDSGRDAPLH--SPPSEHYTLIFNTFVMMQLFNEINARKIHGERNVFDGIFRNPIFCSIVFGTFVVQIVIVQFGGKPFSCQPLNLEKWMWCVFLGLGELVWGQVIATIPNL----KLRFLRRAG---QLTHKDELPEEDVNEENEEIDHAERE------------LRRGQILWFRGLNRIQTQ---IEVVNTFK 1162          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2b2 (ATPase plasma membrane Ca2+ transporting 2 [Source:NCBI gene;Acc:101156400])

HSP 1 Score: 1187.17 bits (3070), Expect = 0.000e+0
Identity = 671/1179 (56.91%), Postives = 826/1179 (70.06%), Query Frame = 1
Query:  667 ADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQC--DDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXY------------TMYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAA----------------SHELED------RPNAQENQNN----NKTASNQLKNGIDL-----TVKVEVTSEDGEK-LSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWK---TGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFK 4056
            ADF  SV +L+ +MELRG E +  +   Y G+ GLC  L+TSP EGL     D  +R EI+G N+IPPK PKTF QLV+EA+QD+TLI+L +AALISLGLS Y            +   G   + EA+ GWIEG AIL +VV VV V AFNDW KE+QFRGLQ++IE E KFQV+R  Q  ++ V DILVGDI QIKYGDLLPADG++IQ NDLK+DESSLTGESD VKK  + DP++LSGTHVMEGSG++++TAVGVNSQ GIIF LLGA                  H+  D       P A    +     N T S  L NG        + +++V  +DG   + M    +        K+KK  S   KE SVLQ KLTKLA+QIGY G +++ +TV IL++ F    F      W    T +++Q  + FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMT VQ ++   ++ K+P    L  K   LL++AI+INS YT++++ P  +  LP QVGNKTEC LLG +LEL    YQ IRN+  E+KL KVYTFNSVRKSMSTVI L     + +++KGASEIV+ KCS+I++  G++  F   D++++V+ VIEPMA  GLRTI +AY++  F++           EP++++E  I++DLT + +VGIEDPVRPEVP+AI KCQ+AGITVRMVTGDN+NTAR+IA KCGI+ PG+DFL ++GKEFN+RIR+ K GEV Q+ IDKVWP LRVLARSSP DK+TLV GII S +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSISKFLQFQLTVN+VA++VAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P E LL R PYGR KPLI+  M K I+G  +YQL++I  LL  GE + D+DSGR       S P+EH+T IFNTFVMM LFNEINARKIHG+RN+F+G+ RN IF  I   T + QIVI++FGG   S   L+ + W+WCVF GLG LVWGQV+ +IPN     +L ++++      ++ + ++ E    E     D  + E            +R GQILW RGL+R+QTQ   ++VV  FK
Sbjct:   22 ADFGCSVMDLRSLMELRGTEGVVKLQEDYGGVEGLCKRLKTSPTEGLLGVQADLDKRKEIFGKNLIPPKKPKTFLQLVWEALQDVTLIILELAALISLGLSFYHPPGESGGEMCGSAAGGVEDEGEADAGWIEGAAILLSVVCVVIVTAFNDWSKEKQFRGLQSRIEQEQKFQVVRGSQVIQLPVADILVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVKKAADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGVEEEEKKEKKGGAVEDGHQNTDCSHPPIHPIATITTDGAAGINATGSANLINGKMQDGNMESNQIKVKKQDGAAAMEMQPLKSAEGGEADEKEKKKVSAPKKEKSVLQGKLTKLAVQIGYAGLVMSSITVTILVLYFSIDNFVMKKRPWMAECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTAVQCYIGDVHYKKIPDPGVLPPKSLDLLINAIAINSAYTTKILPPDKEGGLPKQVGNKTECGLLGLILELK-RDYQPIRNQIPEEKLYKVYTFNSVRKSMSTVIKLPD-GSFRMYSKGASEIVLKKCSHILNEVGELRVFRPRDKDEMVKKVIEPMACEGLRTICVAYRD--FSN---------DPEPNWDDENNILNDLTAICVVGIEDPVRPEVPDAIQKCQRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCIDGKEFNRRIRNEK-GEVEQERIDKVWPKLRVLARSSPTDKHTLVKGIIDSTMADQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPNESLLKRKPYGRNKPLISSTMTKNILGHAVYQLVIIFTLLFVGEQIFDIDSGRDAPLH--SPPSEHYTLIFNTFVMMQLFNEINARKIHGERNVFDGIFRNPIFCSIVFGTFVVQIVIVQFGGKPFSCQPLNLEKWMWCVFLGLGELVWGQVIATIPNL----KLRFLRRAG---QLTHKDELPEEDVNEENEEIDHAERE------------LRRGQILWFRGLNRIQTQ---IEVVNTFK 1162          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000014734.1 (SMESG000014734.1)

HSP 1 Score: 2373.97 bits (6151), Expect = 0.000e+0
Identity = 1243/1244 (99.92%), Postives = 1244/1244 (100.00%), Query Frame = 1
Query:  628 MKRTSNATGDRGRADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEAHSIEXXXXXXXXXXXXXXXTSLSHPRPLSADSINPLHSSIPNSQQDLFGANTTRSQLLLNSYQNXXXXXXXXXXXXXXXNVSRLKETRSLSTEFS 4359
            MKRTSNATGDRGRADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTLIVLIIAALISLGLSIYTMYFGDHKDDEAEVGWIEGVAILAAVVLVVFVIAFNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAF+EGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYIVGQGIYQLIVIIYLLIAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEAHSIEQQKLQLWQQRRLRLRTSLSHPRPLSADSINPLHSSIPNSQQDLFGANTTRSQLLLNSYQNPPHSHQQLHHQLPHLNVSRLKETRSLSTEFS
Sbjct:    1 MKRTSNATGDRGRADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTLIVLIIAALISLGLSIYTMYFGDHKDDEAEVGWIEGVAILAAVVLVVFVIAFNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFIEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYIVGQGIYQLIVIIYLLIAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLEEAHSIEQQKLQLWQQRRLRLRTSLSHPRPLSADSINPLHSSIPNSQQDLFGANTTRSQLLLNSYQNPPHSHQQLHHQLPHLNVSRLKETRSLSTEFS 1244          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000014734.1 (SMESG000014734.1)

HSP 1 Score: 2249.17 bits (5827), Expect = 0.000e+0
Identity = 1145/1151 (99.48%), Postives = 1149/1151 (99.83%), Query Frame = 1
Query:  610 MSESISMKRTSNATGDRGRADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCT 4062
            MSESISMKRTSNATGDRGRADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTLIVLIIAALISLGLSIYTMYFGDHKDDEAEVGWIEGVAILAAVVLVVFVIAFNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAF+EGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYIVGQGIYQLIVIIYLLIAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNT++VV AF+ T
Sbjct:    1 MSESISMKRTSNATGDRGRADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTLIVLIIAALISLGLSIYTMYFGDHKDDEAEVGWIEGVAILAAVVLVVFVIAFNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFIEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYIVGQGIYQLIVIIYLLIAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTIRVVDAFRMT 1151          

HSP 2 Score: 53.5286 bits (127), Expect = 1.883e-6
Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 1
Query: 4687 IRVVDAFRMTNDQRQDMHRSSIGXXXXXXXXXXXXXXXXXXXXXXXXXMGTVDA 4848
            IRVVDAFRMTNDQRQDMHRSSIGAIRAARNLQIARQAAAASALAESSAMGTVDA
Sbjct: 1142 IRVVDAFRMTNDQRQDMHRSSIGAIRAARNLQIARQAAAASALAESSAMGTVDA 1195          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000014734.1 (SMESG000014734.1)

HSP 1 Score: 2214.88 bits (5738), Expect = 0.000e+0
Identity = 1128/1129 (99.91%), Postives = 1129/1129 (100.00%), Query Frame = 1
Query:  628 MKRTSNATGDRGRADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDHKDDEAEVGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRL 4014
            MKRTSNATGDRGRADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTLIVLIIAALISLGLSIYTMYFGDHKDDEAEVGWIEGVAILAAVVLVVFVIAFNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAF+EGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYIVGQGIYQLIVIIYLLIAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRL
Sbjct:    1 MKRTSNATGDRGRADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTLIVLIIAALISLGLSIYTMYFGDHKDDEAEVGWIEGVAILAAVVLVVFVIAFNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFIEGSNFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYIVGQGIYQLIVIIYLLIAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRL 1129          

HSP 2 Score: 53.5286 bits (127), Expect = 1.976e-6
Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 1
Query: 4687 IRVVDAFRMTNDQRQDMHRSSIGXXXXXXXXXXXXXXXXXXXXXXXXXMGTVDA 4848
            IRVVDAFRMTNDQRQDMHRSSIGAIRAARNLQIARQAAAASALAESSAMGTVDA
Sbjct: 1177 IRVVDAFRMTNDQRQDMHRSSIGAIRAARNLQIARQAAAASALAESSAMGTVDA 1230          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000063816.1 (SMESG000063816.1)

HSP 1 Score: 1389.02 bits (3594), Expect = 0.000e+0
Identity = 740/1159 (63.85%), Postives = 901/1159 (77.74%), Query Frame = 1
Query:  673 FKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCDDFP---RRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDHKDDEAE--VGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDR-----PNAQENQNNNKTASNQLKN---GIDLTVKVEVTSEDGEKLS------MIENDAYNSTRESPKKKKDKSIRV--KEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGS-NFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYE-----DDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLE 4068
            ++++ KEL D+M LR  EAI  I  KY  +  +C  L+TSP  GL  D+     RR E +GSN+IPPKPPKTFF+L++EA+QDLTLIVL+ AA+ISL L++Y+ + G    DE E   GWIEGVAIL AV++VV V AFNDWQKERQFRGLQ++IE  HK  VIR   ++EI VGDI+VGDICQ+KYGDLLPADG+IIQSND+K+DESSLTGE D VKKG + DP++LSGTHVMEGS K+L+TAVG+NSQAGIIFALLGAA+ E +D+     PN Q ++ N+ + +   KN    ++L    E   ED ++ S          DA  S  ++ K K++K +R   K+ SVLQLKL KLA  IG IGTIVA +TV ILIIKFC   +  + E W    HL+++INF IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+++ G  N T LP + ELS     +LV  ISINS YTS+LM  R  NELP+Q+GNKTECALLGFV       Y ++R +W E+KL KVYTFNS RKSMST+I  E +    + TKGASE++++KCS+I+  NG+I PF+  D E +V+ VIEPMAS+GLRTIG+AYK  +     D  + +  E+ D ENE  ++ DLT + IVGIEDPVRPEVP AI KCQKAGITVRMVTGDN+NTARSIA KCGILKPG+DFLV+EGKEFN R+R P +G+++Q+LID+VWP LRVLARSSPQDKYTLV+GII SHL  +REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVN+VA++VAF+GACFITDSPLKAVQMLWVNLIMDTLASLALATE+P EELLDRAPYGRTKP+I+R MIK I+GQ IYQL V  YLL+ G  LLDV++GR L ++GI+KPT+HFT IFNTFVMMTLFNE N+RKIHGQ+N+F+GLQRNV+F+ IW+ T + QIVI+++GGYAL T AL+ DHWLWC+ FG+G L+W Q++  IP TV+PK +PW KKK   +  +  + + +  + ++ N S+++D + +  L  +     DDDI  SGQILWIRGLSRLQTQM   +VV AF+ +L+
Sbjct:    6 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRRE-FGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHGDETEGDAGWIEGVAILGAVIVVVLVTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEIIVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD-HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLVKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIEDEGK--LLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDY-QGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKK---LPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQM---RVVNAFRSSLD 1153          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000063816.1 (SMESG000063816.1)

HSP 1 Score: 1387.86 bits (3591), Expect = 0.000e+0
Identity = 740/1157 (63.96%), Postives = 899/1157 (77.70%), Query Frame = 1
Query:  679 LSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCDDFP---RRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTXXXXXXXXXXXXXXXXYTMYFGDHKDDEAE--VGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDR-----PNAQENQNNNKTASNQLKN---GIDLTVKVEVTSEDGEKLS------MIENDAYNSTRESPKKKKDKSIRV--KEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFVEGS-NFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYXXXXXXXXXXXXXXXXXAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYE-----DDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKCTLE 4068
            ++ KEL D+M LR  EAI  I  KY  +  +C  L+TSP  GL  D+     RR E +GSN+IPPKPPKTFF+L++EA+QDLTLIVL+ AA+ISL L++Y+ + G    DE E   GWIEGVAIL AV++VV V AFNDWQKERQFRGLQ++IE  HK  VIR   ++EI VGDI+VGDICQ+KYGDLLPADG+IIQSND+K+DESSLTGE D VKKG + DP++LSGTHVMEGS K+L+TAVG+NSQAGIIFALLGAA+ E +D+     PN Q ++ N+ + +   KN    ++L    E   ED ++ S          DA  S  ++ K K++K +R   K+ SVLQLKL KLA  IG IGTIVA +TV ILIIKFC   +  + E W    HL+++INF IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+++ G  N T LP + ELS     +LV  ISINS YTS+LM  R  NELP+Q+GNKTECALLGFV       Y ++R +W E+KL KVYTFNS RKSMST+I  E +    + TKGASE++++KCS+I+  NG+I PF+  D E +V+ VIEPMAS+GLRTIG+AYK  +     D  + +  E+ D ENE  ++ DLT + IVGIEDPVRPEVP AI KCQKAGITVRMVTGDN+NTARSIA KCGILKPG+DFLV+EGKEFN R+R P +G+++Q+LID+VWP LRVLARSSPQDKYTLV+GII SHL  +REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVN+VA++VAF+GACFITDSPLKAVQMLWVNLIMDTLASLALATE+P EELLDRAPYGRTKP+I+R MIK I+GQ IYQL V  YLL+ G  LLDV++GR L ++GI+KPT+HFT IFNTFVMMTLFNE N+RKIHGQ+N+F+GLQRNV+F+ IW+ T + QIVI+++GGYAL T AL+ DHWLWC+ FG+G L+W Q++  IP TV+PK +PW KKK   +  +  + + +  + ++ N S+++D + +  L  +     DDDI  SGQILWIRGLSRLQTQM   +VV AF+ +L+
Sbjct:    1 MNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRRE-FGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHGDETEGDAGWIEGVAILGAVIVVVLVTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEIIVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD-HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLVKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIEDEGK--LLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDY-QGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKK---LPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQM---RVVNAFRSSLD 1146          
The following BLAST results are available for this feature:
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP2B30.000e+058.23ATPase plasma membrane Ca2+ transporting 3 [Source... [more]
ATP2B30.000e+058.23ATPase plasma membrane Ca2+ transporting 3 [Source... [more]
ATP2B30.000e+058.45ATPase plasma membrane Ca2+ transporting 3 [Source... [more]
ATP2B30.000e+058.30ATPase plasma membrane Ca2+ transporting 3 [Source... [more]
ATP2B30.000e+058.30ATPase plasma membrane Ca2+ transporting 3 [Source... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mca-30.000e+058.79Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
mca-30.000e+058.79Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
mca-30.000e+058.79Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
mca-30.000e+058.79Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
mca-30.000e+058.58Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PMCA0.000e+060.74gene:FBgn0259214 transcript:FBtr0304050[more]
PMCA0.000e+060.74gene:FBgn0259214 transcript:FBtr0300558[more]
PMCA0.000e+060.74gene:FBgn0259214 transcript:FBtr0300555[more]
PMCA0.000e+060.48gene:FBgn0259214 transcript:FBtr0304048[more]
PMCA0.000e+060.54gene:FBgn0259214 transcript:FBtr0300556[more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2b40.000e+057.77ATPase plasma membrane Ca2+ transporting 4 [Source... [more]
atp2b40.000e+057.77ATPase plasma membrane Ca2+ transporting 4 [Source... [more]
atp2b40.000e+057.81ATPase plasma membrane Ca2+ transporting 4 [Source... [more]
atp2b40.000e+057.90ATPase plasma membrane Ca2+ transporting 4 [Source... [more]
atp2b40.000e+057.90ATPase plasma membrane Ca2+ transporting 4 [Source... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ugdh0.000e+057.42UDP-glucose 6-dehydrogenase [Source:Xenbase;Acc:XB... [more]
ugdh0.000e+057.42UDP-glucose 6-dehydrogenase [Source:Xenbase;Acc:XB... [more]
ugdh0.000e+057.49UDP-glucose 6-dehydrogenase [Source:Xenbase;Acc:XB... [more]
ugdh0.000e+057.50UDP-glucose 6-dehydrogenase [Source:Xenbase;Acc:XB... [more]
ugdh0.000e+057.42UDP-glucose 6-dehydrogenase [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp2b30.000e+057.63ATPase, Ca++ transporting, plasma membrane 3 [Sour... [more]
Atp2b30.000e+056.43ATPase, Ca++ transporting, plasma membrane 3 [Sour... [more]
Atp2b30.000e+057.96ATPase, Ca++ transporting, plasma membrane 3 [Sour... [more]
Atp2b20.000e+057.64ATPase, Ca++ transporting, plasma membrane 2 [Sour... [more]
Atp2b20.000e+057.64ATPase, Ca++ transporting, plasma membrane 2 [Sour... [more]
back to top
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q16720|AT2B3_HUMAN0.000e+058.23Plasma membrane calcium-transporting ATPase 3 OS=H... [more]
sp|Q64568|AT2B3_RAT0.000e+058.10Plasma membrane calcium-transporting ATPase 3 OS=R... [more]
sp|D3K0R6|AT2B4_BOVIN0.000e+056.64Plasma membrane calcium-transporting ATPase 4 OS=B... [more]
sp|Q64542|AT2B4_RAT0.000e+056.42Plasma membrane calcium-transporting ATPase 4 OS=R... [more]
sp|P23634|AT2B4_HUMAN0.000e+056.38Plasma membrane calcium-transporting ATPase 4 OS=H... [more]
back to top
BLAST of Calcium-transporting ATPase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y2DYL30.000e+062.35Calcium-transporting ATPase OS=Araneus ventricosus... [more]
A0A0X3PD520.000e+060.51Calcium-transporting ATPase OS=Schistocephalus sol... [more]
A0A4Y2DZM80.000e+062.05Calcium-transporting ATPase OS=Araneus ventricosus... [more]
A0A087U9V20.000e+061.66Plasma membrane calcium-transporting ATPase 3 (Fra... [more]
T1FP680.000e+061.82Calcium-transporting ATPase OS=Helobdella robusta ... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000014864.20.000e+057.77pep primary_assembly:Astyanax_mexicanus-2.0:7:3530... [more]
atp2b40.000e+057.60ATPase plasma membrane Ca2+ transporting 4 [Source... [more]
atp2b40.000e+057.29ATPase plasma membrane Ca2+ transporting 4 [Source... [more]
atp2b40.000e+057.73ATPase plasma membrane Ca2+ transporting 4 [Source... [more]
atp2b1b0.000e+056.81plasma membrane calcium-transporting ATPase 1-like... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007912.12.878e-15157.14pep scaffold:Pmarinus_7.0:GL490738:3481:17315:-1 g... [more]
ENSPMAT00000007505.11.473e-7286.57pep scaffold:Pmarinus_7.0:GL487901:1873:6828:1 gen... [more]
ENSPMAT00000010373.15.972e-6431.94pep scaffold:Pmarinus_7.0:GL481096:3909:20014:1 ge... [more]
ENSPMAT00000001468.16.352e-6454.88pep scaffold:Pmarinus_7.0:GL477283:10882:33618:1 g... [more]
ENSPMAT00000002775.11.346e-6256.39pep scaffold:Pmarinus_7.0:GL486089:3809:7949:1 gen... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PMC11.486e-8537.41Vacuolar Ca2+ ATPase involved in depleting cytosol... [more]
PMR13.370e-8229.10High affinity Ca2+/Mn2+ P-type ATPase; required fo... [more]
ENA28.017e-5235.50P-type ATPase sodium pump; involved in Na+ efflux ... [more]
ENA51.720e-5135.60Protein with similarity to P-type ATPase sodium pu... [more]
ENA13.354e-5134.65P-type ATPase sodium pump; involved in Na+ and Li+... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO417750.000e+054.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417740.000e+040.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445174.737e-13137.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356161.405e-7028.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364551.680e-6532.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2b20.000e+057.71ATPase plasma membrane Ca2+ transporting 2 [Source... [more]
atp2b20.000e+057.89ATPase plasma membrane Ca2+ transporting 2 [Source... [more]
atp2b20.000e+056.79ATPase plasma membrane Ca2+ transporting 2 [Source... [more]
atp2b20.000e+056.91ATPase plasma membrane Ca2+ transporting 2 [Source... [more]
atp2b20.000e+056.91ATPase plasma membrane Ca2+ transporting 2 [Source... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014734.10.000e+099.92SMESG000014734.1[more]
SMESG000014734.11.883e-699.48SMESG000014734.1[more]
SMESG000014734.11.976e-699.91SMESG000014734.1[more]
SMESG000063816.10.000e+063.85SMESG000063816.1[more]
SMESG000063816.10.000e+063.96SMESG000063816.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001679 ID=SMED30001679|Name=Calcium-transporting ATPase|organism=Schmidtea mediterranea sexual|type=transcript|length=5068bp
TATACTGATATCAAATAGGGAGAGAAATTCAATCCAACACTCTGACTGTA
TGTCAGTGTGTATGCGCGAACGCATGTGTGCGTGTTTGTGTGTCTATTTG
GTAATTTATTTCAGTTTTGCATTAAAAACCATCGTTGAGGGGATTGTCGT
CGATTATTGACAAACTGACTGGAGCGATGAAATTAGAGAACAATTTGCTG
GGGGTGAGAAAAGTGAGTGTGTACAATGCAATCAGCGACAACGCACACCA
GCAAATGCACACACCGACTTGTGCGTATGCACCAATCCCGATATCAAGTG
ATGCTTTTGAACTAAATTTACAGCTCGAATTAAACGTGTATTATACCATT
AATAATATCTCTGGCATGCCAGCAATGAAATTGTCCAACAACTATTATAT
GCATAGTGGATTACAAGAAAAGAAAAATTGATTATTACTATATCATTACT
AATCATAAAAATTCTCCTCTGTTACAATAATAACCATTGAAAATCTGTTT
CTCATTATCATTAATGTTCCTATCGGTTCTCGAATTGATCAAGGATTTCC
ATTAATTCCATGCATTAACAATCTGTTGTCATTGTCATATTTGCCTATTT
GAAAGAACAATGTCTGAGTCTATTTCAATGAAACGAACGAGCAATGCAAC
CGGAGATCGGGGAAGAGCGGATTTTAAATTGTCAGTCAAAGAACTTCAAG
ACATTATGGAACTTCGTGGACATGAAGCAATAAATCACATCAACAATAAA
TATAACGGGATTTCTGGGCTTTGTGCTGGCCTTAGAACGTCTCCCGCTGA
AGGACTTCAGTGTGACGATTTTCCAAGACGGATTGAGATCTACGGATCCA
ATGTTATTCCACCTAAACCGCCAAAAACATTTTTTCAATTGGTATTTGAA
GCGATTCAGGATCTAACCCTTATTGTATTAATAATTGCAGCTCTTATTTC
TCTTGGCCTATCTATATATACTATGTATTTTGGTGACCACAAAGACGACG
AAGCTGAAGTTGGTTGGATTGAAGGTGTTGCTATCCTGGCCGCAGTGGTA
CTGGTTGTGTTTGTCATAGCTTTCAATGATTGGCAGAAAGAGCGCCAATT
TCGGGGTCTTCAAAACAAAATAGAATCAGAACACAAATTCCAAGTGATTA
GAAATAAACAATCTCAGGAAATAGCTGTCGGTGATATCCTCGTTGGAGAC
ATTTGCCAAATTAAATACGGAGACCTATTACCAGCCGACGGATTAATTAT
ACAGAGTAACGACCTGAAGCTAGATGAAAGCTCTCTCACTGGTGAATCAG
ACTTTGTTAAAAAGGGAGAAAACTTTGACCCAATCGTACTTTCTGGTACA
CATGTTATGGAGGGCTCTGGGAAAATTTTGATAACTGCTGTCGGAGTAAA
TTCCCAAGCGGGAATAATCTTTGCCTTACTTGGAGCTGCATCTCACGAAT
TAGAGGACAGACCAAATGCTCAAGAAAATCAAAACAATAATAAAACAGCC
TCCAACCAACTGAAAAATGGTATAGATTTAACCGTCAAAGTTGAAGTGAC
TTCAGAAGATGGCGAAAAACTTTCAATGATCGAAAATGATGCCTATAACT
CGACTAGAGAATCTCCGAAAAAGAAAAAAGATAAAAGTATTCGAGTCAAA
GAAATGTCAGTTTTGCAGCTGAAATTAACAAAACTAGCTATCCAAATTGG
ATATATTGGAACGATCGTGGCTATGGTGACTGTAGCAATACTCATAATAA
AATTTTGCTTCGTCCGGTTTTACAAAGATGGTGAACAATGGAAAACTGGA
GTTCATTTGCAACAAATTATTAATTTCTTCATTATCGGTGTAACTGTTTT
GGTTGTGGCAGTACCAGAGGGTCTTCCGTTGGCTGTGACTATTTCCTTGG
CATACTCTGTCAAGAAAATGATGAAAGACAATAACTTGGTCAGGCATCTG
GATGCCTGTGAAACGATGGGGAATGCTACAGCAATATGTTCAGATAAAAC
TGGAACTTTGACTACTAATAGAATGACTGTCGTTCAAGCATTCGTTGAAG
GTTCCAACTTCACAAAGCTTCCAAAATACTCAGAATTATCTAGTAAATTT
AGAGCATTATTAGTTGACGCCATATCTATCAACAGCGGTTACACTTCTCA
ACTCATGGTTCCTAGAACTAAAAACGAATTACCAACTCAAGTTGGTAACA
AAACAGAATGTGCGCTTTTAGGATTCGTTTTAGAACTTGGAGGACCGACT
TATCAAGAAATCAGAAACAAATGGACGGAAGATAAATTGAGAAAGGTGTA
CACATTCAATTCTGTCCGAAAATCAATGAGTACTGTCATCCCGTTGGAAA
GCAGAAAAGGCTATACCATTTTTACTAAAGGGGCTTCAGAAATTGTTATG
TCAAAGTGCTCTTACATTGTGTCAACCAATGGACAGATAATGCCATTCAG
TAAAAGCGATCAGGAGAAAATAGTTCAGACCGTCATCGAACCCATGGCGT
CCAATGGATTAAGAACGATTGGAATAGCATATAAAAATGTGATTTTCAAC
AGTCGGGGTGACATCAATGAAACTGTAATTACCGAAGAACCGGATTTTGA
AAATGAAGCTCAAATAGTCTCTGATCTCACATGTTTGGCAATAGTCGGAA
TAGAAGACCCAGTCAGGCCAGAAGTCCCAAATGCGATTATGAAATGTCAG
AAAGCGGGAATTACAGTGAGAATGGTCACTGGAGATAATGTCAACACAGC
TAGGTCAATTGCAACGAAATGTGGAATTTTGAAACCCGGCGATGACTTTT
TGGTGCTAGAAGGAAAGGAATTTAACCAGAGAATAAGAAGCCCAAAAACG
GGAGAAGTCAGACAAGACCTCATAGATAAAGTTTGGCCTTCTCTCCGAGT
TCTTGCTCGTTCCTCTCCTCAAGATAAATACACTCTAGTCAGCGGAATTA
TTGCCAGTCATTTGAATCCCACGAGAGAAGTTGTAGCAGTCACTGGCGAT
GGAACTAATGATGGACCGGCTCTGAAAAAAGCCGATGTCGGCTTTGCAAT
GGGCATTGCTGGAACAGACGTTGCTAAAGAAGCATCAGATATTATTCTTA
CTGATGATAATTTTACGAGCATTGTAAAAGCAGTCATGTGGGGCAGAAAT
GTCTATGATTCTATTTCAAAGTTTTTACAATTTCAATTAACTGTCAATTT
GGTTGCAATAGTTGTTGCTTTCGTCGGAGCATGCTTTATTACGGACAGCC
CTTTGAAAGCTGTTCAAATGTTGTGGGTCAACCTCATAATGGATACATTG
GCCTCACTGGCACTGGCTACAGAATTGCCTGGAGAAGAATTACTGGATCG
CGCTCCATATGGTCGTACAAAACCTCTTATAACCAGACCAATGATTAAGT
ACATTGTTGGCCAAGGAATATATCAATTAATTGTCATAATTTATTTACTA
ATTGCGGGTGAAAATTTACTGGATGTTGACAGTGGTCGTGCACTGGCCGA
TAAAGGTATTTCCAAGCCTACGGAGCATTTTACTACTATTTTTAATACTT
TTGTCATGATGACATTATTCAATGAAATCAACGCTAGAAAAATTCATGGA
CAAAGAAATATTTTTGAGGGCCTCCAAAGAAATGTCATTTTTGTGTTTAT
ATGGATTGCAACAATACTTTCTCAGATTGTTATCATTGAATTTGGAGGAT
ATGCTTTGAGCACTTCAGCACTGGACGCAGATCATTGGTTATGGTGCGTG
TTTTTTGGATTGGGCACCCTGGTTTGGGGACAGGTTTTAATCTCCATACC
AAATACAGTAGTTCCTAAACGACTTCCATGGGTGAAGAAAAAGAAAATAC
CAATGTCAATGAGTCGAAGAAAAGATATGGCCGAAGGTGCCAATTACGAA
AATATGAATAATTCTGATGAAAAGGACGAAGAGCCGGTGTCTCCATTACC
ATACGAGGATGATGATATTGTTAGGTCCGGTCAAATATTGTGGATTCGAG
GTTTATCTAGACTTCAGACTCAGATGAATACGTTAAAAGTCGTTAGAGCT
TTCAAATGTACTCTGGAAGAAGCCCATTCGATTGAACAACAGAAACTTCA
ATTGTGGCAACAAAGACGTTTACGACTAAGGACAAGTCTGTCTCATCCAA
GACCCTTGTCAGCTGATTCAATCAATCCTTTGCACTCGTCGATTCCGAAT
TCGCAACAGGATTTGTTCGGTGCCAATACTACTAGATCCCAGTTACTTCT
TAATTCATATCAGAACCCCCCTCACTCCCATCAGCAACTTCATCATCAAC
TGCCTCATTTGAACGTTTCACGGTTGAAGGAGACGAGAAGTCTTAGCACA
GAGTTTTCTTGATTATTGGACGAATTGCATTATTAGATAACGACTTCTAG
GGGACTAGCCTCTGACCACATATTTGTCTGTGTATATTGTTGAACAATAC
TAGAAGTAGCCATATTTCCTCTTCATCTGCATAAACGCATGAATTTACTA
ATAACTGTATTAAAAAAACACAACCTATAGTTGATGATTTCTACAACTGC
TGGCTGATATGCTTGGTAAAAGGTATTTTATAGTTTGAAGGGTATGTAAG
CATGCAAGTATGTAGCTAATACTTCTCTCAATAATTCATGTCAGTTTCCT
TTCAATAACCTAATATATATTCCTAAACCTTTTCAGATCCGGGTCGTCGA
CGCATTCAGAATGACAAATGATCAGAGACAGGATATGCATAGGAGTAGTA
TTGGTGCAATTAGGGCAGCCAGGAATTTGCAAATCGCTCGCCAAGCTGCT
GCAGCGTCCGCGCTCGCGGAATCCAGTGCGATGGGCACTGTTGACGCCTG
AGATTTTACTATTTGACTAATTTTCAAGTTACATTTAGCTTTGGTGAAGA
TCGAGTGAATTTCCTTTTCACTTGGATCGTATGTTTGCGATTCTCTCTTT
TCCTATGGTGATACGTAGTTGTCATGAATGGTATTTGATTTTTACAGAGA
TGTGCGTTTTGTTCTGATGTTAATGATTACTTATAGATATTACTCTTAAT
AAATAAATAAACTTCACA
back to top

protein sequence of SMED30001679-orf-1

>SMED30001679-orf-1 ID=SMED30001679-orf-1|Name=SMED30001679-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1251bp
MSESISMKRTSNATGDRGRADFKLSVKELQDIMELRGHEAINHINNKYNG
ISGLCAGLRTSPAEGLQCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQ
DLTLIVLIIAALISLGLSIYTMYFGDHKDDEAEVGWIEGVAILAAVVLVV
FVIAFNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQ
IKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVM
EGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQ
LKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMS
VLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHL
QQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDAC
ETMGNATAICSDKTGTLTTNRMTVVQAFVEGSNFTKLPKYSELSSKFRAL
LVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQE
IRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKC
SYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRG
DINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAG
ITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEV
RQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTN
DGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYD
SISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASL
ALATELPGEELLDRAPYGRTKPLITRPMIKYIVGQGIYQLIVIIYLLIAG
ENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRN
IFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFG
LGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMN
NSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQMNTLKVVRAFKC
TLEEAHSIEQQKLQLWQQRRLRLRTSLSHPRPLSADSINPLHSSIPNSQQ
DLFGANTTRSQLLLNSYQNPPHSHQQLHHQLPHLNVSRLKETRSLSTEFS
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0000463cholinergic neuron
PLANA:0000484secretory system
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR006408P-type_ATPase_IIB
IPR001757P_typ_ATPase
IPR030320ATP2B1
IPR036412HAD-like_sf
IPR004014ATPase_P-typ_cation-transptr_N
IPR023298ATPase_P-typ_TM_dom_sf
IPR006068ATPase_P-typ_cation-transptr_C
IPR008250ATPase_P-typ_transduc_dom_A_sf
IPR023214HAD_sf
IPR022141ATP_Ca_trans_C
IPR018303ATPase_P-typ_P_site
IPR023299ATPase_P-typ_cyto_dom_N
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0000166nucleotide binding
GO:0005388calcium-transporting ATPase activity
GO:0005524ATP binding
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0006816calcium ion transport
GO:0070588calcium ion transmembrane transport
GO:0099132ATP hydrolysis coupled cation transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00119CATATPASEcoord: 222..236
score: 58.96
coord: 460..474
score: 80.68
coord: 819..831
score: 61.82
coord: 795..814
score: 75.78
coord: 677..688
score: 42.43
coord: 699..709
score: 69.84
NoneNo IPR availableGENE3DG3DSA:1.20.1110.10coord: 806..1066
e-value: 1.4E-71
score: 243.3
NoneNo IPR availablePFAMPF00122E1-E2_ATPasecoord: 174..282
e-value: 1.3E-23
score: 83.5
coord: 350..439
e-value: 1.6E-8
score: 34.3
NoneNo IPR availableGENE3DG3DSA:2.70.150.10coord: 155..275
e-value: 2.8E-25
score: 91.1
NoneNo IPR availablePFAMPF00702Hydrolasecoord: 649..809
e-value: 8.2E-11
score: 42.6
NoneNo IPR availablePFAMPF13246Cation_ATPasecoord: 525..603
e-value: 3.1E-17
score: 62.4
NoneNo IPR availableGENE3DG3DSA:1.20.1110.10coord: 320..488
e-value: 6.3E-40
score: 139.2
NoneNo IPR availableSFLDSFLDG00002C1.7:_P-type_atpase_likecoord: 442..847
e-value: 0.0
score: 265.2
NoneNo IPR availableSFLDSFLDF00027p-type_atpasecoord: 442..847
e-value: 0.0
score: 265.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1220..1250
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1091..1109
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1091..1111
NoneNo IPR availablePANTHERPTHR24093CATION TRANSPORTING ATPASEcoord: 10..1098
NoneNo IPR availableCDDcd02081P-type_ATPase_Ca_PMCA-likecoord: 73..928
e-value: 0.0
score: 1171.21
NoneNo IPR availableTMHMMTMhelixcoord: 931..953
NoneNo IPR availableTMHMMTMhelixcoord: 256..278
NoneNo IPR availableTMHMMTMhelixcoord: 363..385
NoneNo IPR availableTMHMMTMhelixcoord: 134..156
NoneNo IPR availableTMHMMTMhelixcoord: 973..990
NoneNo IPR availableTMHMMTMhelixcoord: 1047..1069
NoneNo IPR availableTMHMMTMhelixcoord: 102..124
NoneNo IPR availableTMHMMTMhelixcoord: 406..428
NoneNo IPR availableTMHMMTMhelixcoord: 855..877
NoneNo IPR availableTMHMMTMhelixcoord: 1010..1032
IPR004014Cation-transporting P-type ATPase, N-terminalSMARTSM00831Cation_ATPase_N_a_2coord: 47..119
e-value: 2.6E-7
score: 40.3
IPR004014Cation-transporting P-type ATPase, N-terminalPFAMPF00690Cation_ATPase_Ncoord: 50..114
e-value: 1.1E-13
score: 50.6
IPR023299P-type ATPase, cytoplasmic domain NGENE3DG3DSA:3.40.1110.10coord: 518..685
e-value: 1.3E-16
score: 62.1
IPR023299P-type ATPase, cytoplasmic domain NSUPERFAMILYSSF81660Metal cation-transporting ATPase, ATP-binding domain Ncoord: 466..689
IPR006408P-type ATPase, subfamily IIBTIGRFAMTIGR01517TIGR01517coord: 347..954
e-value: 2.8E-218
score: 725.2
IPR022141Plasma membrane calcium transporting P-type ATPase, C-terminalPFAMPF12424ATP_Ca_trans_Ccoord: 1124..1164
e-value: 3.2E-8
score: 33.9
IPR006068Cation-transporting P-type ATPase, C-terminalPFAMPF00689Cation_ATPase_Ccoord: 880..1059
e-value: 4.5E-39
score: 134.0
IPR001757P-type ATPaseTIGRFAMTIGR01494TIGR01494coord: 311..483
e-value: 2.0E-21
score: 73.9
coord: 761..877
e-value: 1.7E-29
score: 100.5
IPR030320Plasma membrane calcium-transporting ATPase 1PANTHERPTHR24093:SF245PLASMA MEMBRANE CALCIUM-TRANSPORTING ATPASE 1coord: 10..1098
IPR018303P-type ATPase, phosphorylation sitePROSITEPS00154ATPASE_E1_E2coord: 462..468
IPR023298P-type ATPase, transmembrane domain superfamilySUPERFAMILYSSF81665Calcium ATPase, transmembrane domain Mcoord: 48..1064
IPR036412HAD-like superfamilySUPERFAMILYSSF56784HAD-likecoord: 459..899
IPR008250P-type ATPase, A domain superfamilySUPERFAMILYSSF81653Calcium ATPase, transduction domain Acoord: 176..273