Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

Overview
NameSuccinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
Smed IDSMED30001678
Length (bp)1163
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial (SMED30001678) t-SNE clustered cells

Violin plots show distribution of expression levels for Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial (SMED30001678) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial (SMED30001678) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial (SMED30001678) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001678

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30001678SMESG000020764.1 Contig4636newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001678SMESG000020764.1 Contig4636uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001678SMESG000079844.1 Contig4636newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001678SMESG000079844.1 Contig4636uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30001678SMESG000020764.1 dd_Smed_v4_925_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001678SMESG000020764.1 dd_Smed_v4_925_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Human
Match: SDHB (succinate dehydrogenase complex iron sulfur subunit B [Source:HGNC Symbol;Acc:HGNC:10681])

HSP 1 Score: 393.66 bits (1010), Expect = 4.960e-137
Identity = 185/249 (74.30%), Postives = 209/249 (83.94%), Query Frame = 3
Query:  123 VAATQGPRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPKGLNPGLAIGKIKVMLMNLNSYK 869
             AA   PRIKKFAIYRW+PDK  +KP M TYE+DLNKCGPMVLDALIKIKNE+D TLTFRRSCREGICGSCAMNI G NTLAC   ID N+ K +KIYPLPHM+VIKDLVPD+SNFYAQY+ IEPYLKKK E++   GK+   QS+++R+ LDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRD+FT ERL ++ + +S YRCHTIMNCT+TCPKGLNPG AI +IK M+      K
Sbjct:   31 TAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQE--GKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKK 277          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Human
Match: SDHB (succinate dehydrogenase complex iron sulfur subunit B [Source:HGNC Symbol;Acc:HGNC:10681])

HSP 1 Score: 303.908 bits (777), Expect = 7.950e-103
Identity = 144/186 (77.42%), Postives = 160/186 (86.02%), Query Frame = 3
Query:  123 VAATQGPRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQ 680
             AA   PRIKKFAIYRW+PDK  +KP M TYE+DLNKCGPMVLDALIKIKNE+D TLTFRRSCREGICGSCAMNI G NTLAC   ID N+ K +KIYPLPHM+VIKDLVPD+SNFYAQY+ IEPYLKKK E++   GK+   QS+++R+ LDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQ
Sbjct:   17 TAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQE--GKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQ 200          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Human
Match: SDHB (succinate dehydrogenase complex iron sulfur subunit B [Source:HGNC Symbol;Acc:HGNC:10681])

HSP 1 Score: 191.815 bits (486), Expect = 4.511e-60
Identity = 92/125 (73.60%), Postives = 106/125 (84.80%), Query Frame = 3
Query:  204 MDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVL 578
            M TYE+DLNKCGPMVLDALIKIKNE+D TLTFRRSCREGICGSCAMNI G NTLAC   ID N+ K +KIYPLPHM+VIKDLVPD+SNFYAQY+ IEPYLKKK E++   GK+   QS+++R+ L
Sbjct:    1 MQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQE--GKQQYLQSIEEREKL 123          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Celegans
Match: sdhb-1 (Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q09545])

HSP 1 Score: 367.851 bits (943), Expect = 4.577e-127
Identity = 169/250 (67.60%), Postives = 203/250 (81.20%), Query Frame = 3
Query:  138 GPRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPKGLNPGLAIGKIKVMLMNLNSYKRDEVKA 887
            G RIK F IYR+NP+ P  KP +  +++DL++CG M+LDALIKIKNE+DPTLTFRRSCREGICGSCAMNIGG NTLACIC ID +  K+TKIYPLPHM V+KDLVPDM+ FYAQY  I+P+++KK+     +G+K  +QSV +RD LDGLYECILCACCSTSCPSYWWN DKYLGPAVLMQAYRW+IDSRD++  ERL +M++ +SA++CHTIMNCTKTCPK LNP  AIG+IK +L    S    E  A
Sbjct:   50 GNRIKTFEIYRFNPEAPGAKPTVQKFDVDLDQCGTMILDALIKIKNEVDPTLTFRRSCREGICGSCAMNIGGQNTLACICKIDSDTSKSTKIYPLPHMFVVKDLVPDMNLFYAQYASIQPWIQKKT--PLTLGEKQMHQSVAERDRLDGLYECILCACCSTSCPSYWWNADKYLGPAVLMQAYRWVIDSRDDYATERLHRMHDSFSAFKCHTIMNCTKTCPKHLNPAKAIGEIKSLLTGFTSKPAAEPSA 297          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Celegans
Match: sdhb-1 (Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q09545])

HSP 1 Score: 367.851 bits (943), Expect = 4.577e-127
Identity = 169/250 (67.60%), Postives = 203/250 (81.20%), Query Frame = 3
Query:  138 GPRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPKGLNPGLAIGKIKVMLMNLNSYKRDEVKA 887
            G RIK F IYR+NP+ P  KP +  +++DL++CG M+LDALIKIKNE+DPTLTFRRSCREGICGSCAMNIGG NTLACIC ID +  K+TKIYPLPHM V+KDLVPDM+ FYAQY  I+P+++KK+     +G+K  +QSV +RD LDGLYECILCACCSTSCPSYWWN DKYLGPAVLMQAYRW+IDSRD++  ERL +M++ +SA++CHTIMNCTKTCPK LNP  AIG+IK +L    S    E  A
Sbjct:   50 GNRIKTFEIYRFNPEAPGAKPTVQKFDVDLDQCGTMILDALIKIKNEVDPTLTFRRSCREGICGSCAMNIGGQNTLACICKIDSDTSKSTKIYPLPHMFVVKDLVPDMNLFYAQYASIQPWIQKKT--PLTLGEKQMHQSVAERDRLDGLYECILCACCSTSCPSYWWNADKYLGPAVLMQAYRWVIDSRDDYATERLHRMHDSFSAFKCHTIMNCTKTCPKHLNPAKAIGEIKSLLTGFTSKPAAEPSA 297          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Fly
Match: SdhB (gene:FBgn0014028 transcript:FBtr0086156)

HSP 1 Score: 384.03 bits (985), Expect = 2.440e-133
Identity = 180/266 (67.67%), Postives = 209/266 (78.57%), Query Frame = 3
Query:   66 RNSVKLINEVVRFSKINYSVAATQGPRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPKGLNPGLAIGKIKVMLMNLNS 863
            RN ++ I+      +        Q P+IKKF IYRWNPD   EKP M TYE+DL +CGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGG NTLACI  ID N  K+ K+YPLPHM+V++DLVPDM+NFY QYR I+P+L++K+E     GK    QSV+DR  LDGLYECILCACCSTSCPSYWWN +KYLGPAVLMQAYRW+IDSRDE + ERL ++ + +S YRCHTIMNCT+TCPKGLNPG AI +IK +L  L S
Sbjct:   19 RNQMRAISNGTAQLEQQAQPKEAQEPQIKKFEIYRWNPDNAGEKPYMQTYEVDLRECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGTNTLACISKIDINTSKSLKVYPLPHMYVVRDLVPDMNNFYEQYRNIQPWLQRKNEAGEKKGKAQYLQSVEDRSKLDGLYECILCACCSTSCPSYWWNAEKYLGPAVLMQAYRWIIDSRDENSAERLNKLKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLAS 284          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Fly
Match: SdhBL (gene:FBgn0030975 transcript:FBtr0074648)

HSP 1 Score: 343.969 bits (881), Expect = 1.628e-115
Identity = 161/248 (64.92%), Postives = 195/248 (78.63%), Query Frame = 3
Query:  141 PRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPKGLNPGLAIGKIKVMLMNLNSYKRDEVK 884
            PR+K F IYRW   KP ++P+  TYE+DL +CG MVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNI G NTLAC+ +ID+N  K  +IYPLPH++V++DLVPDMS FY QYR I+P+L++K + + + G     QSV DR VLDGLYECILCACC TSCPSYWWN +KYLGPAVLMQAYRW+IDSRDE T +RL  + + W  YRCH+IMNCT TCPK LNP  AI ++K +L+ L    + ++K
Sbjct:  185 PRLKTFEIYRW---KPGDQPQTQTYEVDLEQCGAMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNINGTNTLACVSSIDQNESKCCRIYPLPHLYVVRDLVPDMSQFYDQYRSIQPWLQRK-DLKREAGTAQYLQSVDDRLVLDGLYECILCACCQTSCPSYWWNSNKYLGPAVLMQAYRWVIDSRDEATEQRLDFLKDPWKLYRCHSIMNCTNTCPKHLNPARAIIQLKQLLVGLKKKGKPQLK 428          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Fly
Match: SdhBL (gene:FBgn0030975 transcript:FBtr0344973)

HSP 1 Score: 343.969 bits (881), Expect = 1.628e-115
Identity = 161/248 (64.92%), Postives = 195/248 (78.63%), Query Frame = 3
Query:  141 PRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPKGLNPGLAIGKIKVMLMNLNSYKRDEVK 884
            PR+K F IYRW   KP ++P+  TYE+DL +CG MVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNI G NTLAC+ +ID+N  K  +IYPLPH++V++DLVPDMS FY QYR I+P+L++K + + + G     QSV DR VLDGLYECILCACC TSCPSYWWN +KYLGPAVLMQAYRW+IDSRDE T +RL  + + W  YRCH+IMNCT TCPK LNP  AI ++K +L+ L    + ++K
Sbjct:  185 PRLKTFEIYRW---KPGDQPQTQTYEVDLEQCGAMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNINGTNTLACVSSIDQNESKCCRIYPLPHLYVVRDLVPDMSQFYDQYRSIQPWLQRK-DLKREAGTAQYLQSVDDRLVLDGLYECILCACCQTSCPSYWWNSNKYLGPAVLMQAYRWVIDSRDEATEQRLDFLKDPWKLYRCHSIMNCTNTCPKHLNPARAIIQLKQLLVGLKKKGKPQLK 428          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Zebrafish
Match: sdhb (succinate dehydrogenase complex, subunit B, iron sulfur (Ip) [Source:NCBI gene;Acc:562149])

HSP 1 Score: 384.8 bits (987), Expect = 9.067e-134
Identity = 184/248 (74.19%), Postives = 207/248 (83.47%), Query Frame = 3
Query:  144 RIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPKGLNPGLAIGKIKVMLMNLNSYKRDEVKA 887
            RIKKF IYRW+PD   +KP+M TYEIDLN CGPMVLDALIKIKNEMD TLTFRRSCREGICGSCAMNI G NTLAC+  ID N  K TKIYPLPHM+V+KDLVPDMSNFYAQY+ IEPYLKKK E++   GK+   QSV+DR  LDGLYECILCACCSTSCPSYWWN DKYLGPAVLMQAYRWMIDSRD+FT +RL ++ + +S YRCHTIMNCT+TCPKGLNPG AI +IK M++     ++D V A
Sbjct:   37 RIKKFQIYRWDPDTVGDKPRMQTYEIDLNTCGPMVLDALIKIKNEMDSTLTFRRSCREGICGSCAMNINGGNTLACLNKIDTNTSKVTKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDESQQ--GKQQYLQSVEDRQKLDGLYECILCACCSTSCPSYWWNADKYLGPAVLMQAYRWMIDSRDDFTEDRLSKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMVTYK--QKDAVAA 280          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Zebrafish
Match: SDHB (si:dkey-31b16.7 [Source:ZFIN;Acc:ZDB-GENE-090313-305])

HSP 1 Score: 122.865 bits (307), Expect = 5.226e-33
Identity = 81/198 (40.91%), Postives = 103/198 (52.02%), Query Frame = 3
Query:   93 VVRFSKINYSVAATQGPRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREG--ICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQ 680
            +VR+ +   + A    P+IKKF IYRW+P  P +K +M TYEIDLN CG MVLDALIK+K    P      S R    +  S    +  L+      N  K       + P  H+   +  V D SNFY  Y+ I+PYLKKK E++ +           +    + LYECILC CC   C S WWNG KYL  AVLMQ
Sbjct:    2 LVRYGQT--AAAPAPEPKIKKFQIYRWDPGTPGDKLRMQTYEIDLNTCGLMVLDALIKMKKLNGPLTLDVNSNRFSAFLKMSSTSTLEHLHISLFKQNRFKYQQSDKDLPPASHVCCERYTVEDTSNFYKLYKSIKPYLKKKDESKHE-----------EEPADNRLYECILCVCCRIICLS-WWNGGKYLDSAVLMQ 185          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Mouse
Match: Sdhb (succinate dehydrogenase complex, subunit B, iron sulfur (Ip) [Source:MGI Symbol;Acc:MGI:1914930])

HSP 1 Score: 389.423 bits (999), Expect = 1.728e-135
Identity = 182/236 (77.12%), Postives = 207/236 (87.71%), Query Frame = 3
Query:  141 PRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPKGLNPGLAIGKIKVML 848
            PRIKKFAIYRW+PDK  +KP+M TYE+DLNKCGPMVLDALIKIKNE+D TLTFRRSCREGICGSCAMNI G NTLAC   ID ++ K +KIYPLPHM+VIKDLVPD+SNFYAQY+ IEPYLKKK E++   GK+   QS++DR+ LDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRD+FT ERL ++ + +S YRCHTIMNCT+TCPKGLNPG AI +IK M+
Sbjct:   39 PRIKKFAIYRWDPDKTGDKPRMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTDLSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQE--GKQQYLQSIEDREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSVYRCHTIMNCTQTCPKGLNPGKAIAEIKKMM 272          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9YHT2|SDHB_CHICK (Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Gallus gallus OX=9031 GN=SDHB PE=1 SV=1)

HSP 1 Score: 394.43 bits (1012), Expect = 1.578e-136
Identity = 189/266 (71.05%), Postives = 217/266 (81.58%), Query Frame = 3
Query:   57 RMLRNSVKLIN--EVVRFSKINYSVAATQGPRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPKGLNPGLAIGKIKVML 848
            R LR  ++ +   E V         AA    RIKKF+IYRW+PDKP +KP+M TYE+DLNKCGPMVLDALIKIKNE+D TLTFRRSCREGICGSCAMNI G NTLAC   ID ++ KTTKIYPLPHM+V+KDLVPD+SNFYAQY+ IEPYLKKK E++   GK+   QS++DR  LDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRD++T ERL Q+ + +S YRCHTIMNCT+TCPKGLNPG AI +IK M+
Sbjct:   17 RFLRAGLRPVRGLEAVHGICRGAQTAAAATSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQ--GKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMM 280          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. UniProt/SwissProt
Match: sp|P21912|SDHB_HUMAN (Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHB PE=1 SV=3)

HSP 1 Score: 393.66 bits (1010), Expect = 2.382e-136
Identity = 185/249 (74.30%), Postives = 209/249 (83.94%), Query Frame = 3
Query:  123 VAATQGPRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPKGLNPGLAIGKIKVMLMNLNSYK 869
             AA   PRIKKFAIYRW+PDK  +KP M TYE+DLNKCGPMVLDALIKIKNE+D TLTFRRSCREGICGSCAMNI G NTLAC   ID N+ K +KIYPLPHM+VIKDLVPD+SNFYAQY+ IEPYLKKK E++   GK+   QS+++R+ LDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRD+FT ERL ++ + +S YRCHTIMNCT+TCPKGLNPG AI +IK M+      K
Sbjct:   31 TAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQE--GKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKK 277          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. UniProt/SwissProt
Match: sp|Q3B8J8|SDHB_XENLA (Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Xenopus laevis OX=8355 GN=sdhb PE=2 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 1.117e-135
Identity = 181/235 (77.02%), Postives = 206/235 (87.66%), Query Frame = 3
Query:  144 RIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPKGLNPGLAIGKIKVML 848
            RIKKFAIYRW+PDKP +KP+M TYE+DLN CGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNI G NTLAC   ID N+ K +KIYPLPHM+V+KDLVPD+SNFYAQY+ IEPYLKKK +++   GK+   QS++DRD LDGLYECILCACCSTSCPSYWWN DKYLGPAVLMQAYRWMIDSRD+FT ERL ++ + +S YRCHTIMNCT+TCPKGLNPG AI +IK M+
Sbjct:   40 RIKKFAIYRWDPDKPGDKPRMQTYEVDLNTCGPMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNINGGNTLACTVRIDTNLSKVSKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDKSQQ--GKEQYLQSIEDRDKLDGLYECILCACCSTSCPSYWWNADKYLGPAVLMQAYRWMIDSRDDFTEERLSKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMM 272          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. UniProt/SwissProt
Match: sp|Q3T189|SDHB_BOVIN (Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Bos taurus OX=9913 GN=SDHB PE=2 SV=1)

HSP 1 Score: 390.193 bits (1001), Expect = 5.243e-135
Identity = 186/249 (74.70%), Postives = 210/249 (84.34%), Query Frame = 3
Query:  141 PRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPKGLNPGLAIGKIKVMLMNLNSYKRDEVKA 887
            PRIKKFAIYRW+PDK  +KP M TYEIDLN CGPMVLDALIKIKNE+D TLTFRRSCREGICGSCAMNI G NTLAC   ID N+ K +KIYPLPHM+VIKDLVPD+SNFYAQY+ IEPYLKKK E++   GK+   QS++DR+ LDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRD+FT ERL ++ + +S YRCHTIMNCT+TCPKGLNPG AI +IK M+    +YK  +  A
Sbjct:   37 PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQG--GKEQYLQSIEDREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTQTCPKGLNPGKAIAEIKKMMA---TYKEKQASA 280          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. UniProt/SwissProt
Match: sp|P21913|SDHB_RAT (Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sdhb PE=2 SV=2)

HSP 1 Score: 389.808 bits (1000), Expect = 9.300e-135
Identity = 182/236 (77.12%), Postives = 207/236 (87.71%), Query Frame = 3
Query:  141 PRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPKGLNPGLAIGKIKVML 848
            PRIK FAIYRW+PDK  +KP+M TY++DLNKCGPMVLDALIKIKNE+D TLTFRRSCREGICGSCAMNI G NTLAC   ID ++GK +KIYPLPHM+VIKDLVPD+SNFYAQY+ IEPYLKKK E++   GK+   QS++DR+ LDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFT ERL ++ + +S YRCHTIMNCT+TCPKGLNPG AI +IK M+
Sbjct:   39 PRIKTFAIYRWDPDKAGDKPRMQTYKVDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTDLGKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQE--GKQQYLQSIEDREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTEERLAKLQDPFSLYRCHTIMNCTQTCPKGLNPGKAIAEIKKMM 272          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. TrEMBL
Match: A0A0X3PZW1 (Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial (Fragment) OS=Schistocephalus solidus OX=70667 GN=SDHB PE=3 SV=1)

HSP 1 Score: 429.869 bits (1104), Expect = 7.132e-148
Identity = 200/267 (74.91%), Postives = 227/267 (85.02%), Query Frame = 3
Query:   69 NSVKLINEVVRFSKINYSVAATQGPRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPKGLNPGLAIGKIKVMLMNLNSYK 869
            NS+ +I+  +       +  A+  PR+KKFAIYR+NPDKP +KP M TYE+DLN+CGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMN+ G N LACIC IDKN  KT+KIYPLPHM+V+KDLVPDMSNFYAQYRWIEPYLKKK   E ++G+K   QS+KDRD +DGLYECILCACCSTSCPSYWWN DKYLGPAVLMQAYRWMIDSRD++T+ERL Q+ N WS YRCHTIMNCT+TCPKGLNPG AIG+IK ML+  NSYK
Sbjct:   23 NSLSVISPRLGCFLFQSTRFASSAPRMKKFAIYRYNPDKPSQKPYMQTYEVDLNECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNVDGGNRLACICAIDKNTSKTSKIYPLPHMYVVKDLVPDMSNFYAQYRWIEPYLKKKEFKEENVGEKAFMQSIKDRDKIDGLYECILCACCSTSCPSYWWNSDKYLGPAVLMQAYRWMIDSRDDYTFERLTQLQNKWSVYRCHTIMNCTETCPKGLNPGKAIGEIKKMLIYYNSYK 289          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. TrEMBL
Match: A0A183T1A6 (Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS10254 PE=3 SV=1)

HSP 1 Score: 422.165 bits (1084), Expect = 4.595e-145
Identity = 200/275 (72.73%), Postives = 227/275 (82.55%), Query Frame = 3
Query:   69 NSVKLINEVVRFSKINYSVAATQGPRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPK--------GLNPGLAIGKIKVMLMNLNSYK 869
            NS+ +I+  +       +  A+  PR+KKFAIYR+NPDKP +KP M TYE+DLN+CGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMN+ G N LACIC IDKN  KT+KIYPLPHM+V+KDLVPDMSNFYAQYRWIEPYLKKK   E ++G+K   QS+KDRD +DGLYECILCACCSTSCPSYWWN DKYLGPAVLMQAYRWMIDSRD++T+ERL Q+ N WS YRCHTIMNCT+TCPK        GLNPG AIG+IK ML+  NSYK
Sbjct:    2 NSLSVISPRLGCFLFQSTRFASSAPRMKKFAIYRYNPDKPSQKPYMQTYEVDLNECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNVDGGNRLACICAIDKNTSKTSKIYPLPHMYVVKDLVPDMSNFYAQYRWIEPYLKKKEFKEENVGEKAFMQSIKDRDKIDGLYECILCACCSTSCPSYWWNSDKYLGPAVLMQAYRWMIDSRDDYTFERLTQLQNKWSVYRCHTIMNCTETCPKASYYTIKLGLNPGKAIGEIKKMLIYYNSYK 276          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. TrEMBL
Match: A0A075AJ94 (Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Opisthorchis viverrini OX=6198 GN=T265_01077 PE=3 SV=1)

HSP 1 Score: 421.779 bits (1083), Expect = 5.604e-145
Identity = 198/257 (77.04%), Postives = 219/257 (85.21%), Query Frame = 3
Query:  102 FSKINY-SVAATQGPRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPKGLNPGLAIGKIKVMLMNLNSYK 869
            FS + + S AA   PR+K F++YRWNPDKP EKP M  Y+IDLN+CGPMVLDALIKIKNE DPTLTFRRSCREGICGSCAMNI G N LAC+  IDK++ K TKIYPLPHM VIKDLVPDM+NFYAQYRWIEPYLKKK  +E DIGK   YQSV+DR  LDGLYECILCACC+TSCPSYWWNGDKYLGPAVL+QAYRW+IDSRD++TYERL Q  N WS YRCHTIMNCT+TCPKGLNPGLAIG+IK ML+  N YK
Sbjct:   13 FSMVRHASTAAATAPRMKTFSVYRWNPDKPGEKPYMKDYKIDLNECGPMVLDALIKIKNEQDPTLTFRRSCREGICGSCAMNIAGRNHLACLWEIDKDLSKPTKIYPLPHMFVIKDLVPDMNNFYAQYRWIEPYLKKKGVSEEDIGKATYYQSVEDRAKLDGLYECILCACCATSCPSYWWNGDKYLGPAVLLQAYRWLIDSRDDYTYERLTQFQNKWSLYRCHTIMNCTETCPKGLNPGLAIGEIKKMLIYYNQYK 269          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. TrEMBL
Match: Q5MB10 (Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Schistosoma japonicum OX=6182 GN=SDISP PE=2 SV=1)

HSP 1 Score: 421.394 bits (1082), Expect = 7.611e-145
Identity = 196/261 (75.10%), Postives = 220/261 (84.29%), Query Frame = 3
Query:   90 EVVRFSKINY-SVAATQGPRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPKGLNPGLAIGKIKVMLMNLNSYK 869
            +   F  + Y S A+   PRIK F+IYRWNPDKP EKP M  Y++DLN CGPMVLDALIKIKNE D TLTFRRSCREGICGSCAMNIGG N LACI  ID+++ K TKIYPLPHM+VIKDL+PDM+NFYAQYR+IEPYLKKK+  E DIGKK  YQSV+DR  LDGLYECILCACCSTSCPSYWWNGDKYLGPAVL+QAYRW++DSRD++TYERL +  N WS YRCHTIMNCT+TCPKGLNPGLAIG+IK ML+  N YK
Sbjct:    9 QSASFKLVRYVSTASELAPRIKTFSIYRWNPDKPGEKPSMQNYQVDLNDCGPMVLDALIKIKNEQDSTLTFRRSCREGICGSCAMNIGGRNHLACIWEIDQDVSKPTKIYPLPHMYVIKDLIPDMNNFYAQYRFIEPYLKKKNVTEEDIGKKTYYQSVEDRAKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLLQAYRWLVDSRDDYTYERLSEFQNKWSLYRCHTIMNCTETCPKGLNPGLAIGEIKKMLIYFNQYK 269          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. TrEMBL
Match: A0A4V3SFT3 (Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Opisthorchis felineus OX=147828 GN=CRM22_003601 PE=3 SV=1)

HSP 1 Score: 419.853 bits (1078), Expect = 7.758e-144
Identity = 196/257 (76.26%), Postives = 218/257 (84.82%), Query Frame = 3
Query:  102 FSKINY-SVAATQGPRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPKGLNPGLAIGKIKVMLMNLNSYK 869
            FS + + S AA   PRIK F++YRWNPDKP EKP M  Y++DLN+CGPMVLDALIKIKNE DPTLTFRRSCREGICGSCAMNI G N LAC+  ID+++ K  KIYPLPHM VIKDLVPDM+NFYAQYRWIEPYLKKK  +E DIGK   YQSV+DR  LDGLYECILCACC+TSCPSYWWNGDKYLGPAVL+QAYRW+IDSRD++TYERL Q  N WS YRCHTIMNCT+TCPKGLNPGLAIG+IK ML+  N YK
Sbjct:   38 FSMVRHASTAAATAPRIKTFSVYRWNPDKPGEKPYMKDYKVDLNECGPMVLDALIKIKNEQDPTLTFRRSCREGICGSCAMNIAGRNHLACLWEIDQDLNKPMKIYPLPHMFVIKDLVPDMNNFYAQYRWIEPYLKKKGVSEEDIGKATYYQSVEDRAKLDGLYECILCACCATSCPSYWWNGDKYLGPAVLLQAYRWLIDSRDDYTYERLTQFQNKWSLYRCHTIMNCTETCPKGLNPGLAIGEIKKMLIYYNQYK 294          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Cavefish
Match: sdhb (succinate dehydrogenase complex iron sulfur subunit B [Source:NCBI gene;Acc:103031341])

HSP 1 Score: 391.734 bits (1005), Expect = 1.620e-136
Identity = 188/262 (71.76%), Postives = 216/262 (82.44%), Query Frame = 3
Query:   63 LRNSVKLINEVVRFSKINYSVAATQGPRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPKGLNPGLAIGKIKVML 848
            LR+S  L+   +R+ +   + A    PRIKKF IYRW+PD P +KP M TYE+DLN CGPMVLDALIKIKNEMD TLTFRRSCREGICGSCAMNI G NTLAC+  ID NI K +KIYPLPHM+V+KDLVPDMSNFYAQY+ IEPYLKKK E++   GK+   Q+V+DR  LDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRD++T ERL ++ + +S YRCHTIMNCT+TCPKGLNPG AI +IK M+
Sbjct:   16 LRSSSGLL--ALRYVQTAAAAAPAVQPRIKKFQIYRWDPDTPGDKPCMQTYEVDLNACGPMVLDALIKIKNEMDSTLTFRRSCREGICGSCAMNINGGNTLACLNKIDTNISKVSKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDESKQ--GKEQYLQTVEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLSKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMM 273          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Yeast
Match: SDH2 (Iron-sulfur protein subunit of succinate dehydrogenase; the complex couples the oxidation of succinate to the transfer of electrons to ubiquinone as part of the TCA cycle and the mitochondrial respiratory chain; other members are Sdh1p, Sdh3p, and Sdh4p [Source:SGD;Acc:S000003964])

HSP 1 Score: 356.681 bits (914), Expect = 7.117e-124
Identity = 165/236 (69.92%), Postives = 194/236 (82.20%), Query Frame = 3
Query:  141 PRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPKGLNPGLAIGKIKVML 848
            PR+K F +YRWNPD+P  KP + +Y++DLN CGPMVLDAL+KIK+E D TLTFRRSCREGICGSCAMNIGG NTLACIC ID+N  K  KIYPLPHM ++KDLVPD++NFY QY+ I+PYL++ S  +   G +V  QS++DR  LDGLYECILCACCSTSCPSYWWN ++YLGPAVLMQAYRW+IDSRD+ T  R   +NN  S YRCHTIMNCT+TCPKGLNPGLAI +IK  L
Sbjct:   31 PRLKTFKVYRWNPDEPSAKPHLQSYQVDLNDCGPMVLDALLKIKDEQDSTLTFRRSCREGICGSCAMNIGGRNTLACICKIDQNESKQLKIYPLPHMFIVKDLVPDLTNFYQQYKSIQPYLQRSSFPKD--GTEV-LQSIEDRKKLDGLYECILCACCSTSCPSYWWNQEQYLGPAVLMQAYRWLIDSRDQATKTRKAMLNNSMSLYRCHTIMNCTRTCPKGLNPGLAIAEIKKSL 263          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Nematostella
Match: EDO44939 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU24])

HSP 1 Score: 374.015 bits (959), Expect = 5.855e-130
Identity = 176/244 (72.13%), Postives = 205/244 (84.02%), Query Frame = 3
Query:  120 SVAATQGPRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMN-NGWSAYRCHTIMNCTKTCPKGLNPGLAIGKIKVML 848
            + A +Q PR K F++YRW+PDK  +KP+M  +++DLN CGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNIGG NTLACIC I+ ++ K TKIYPLPHM+V+KDLVPDM++FY QYR IEPYLKKK + E   GK+   QS+ DR  LDGLYECILCACCSTSCPSYWWN DKYLGPAVLMQAYRWMIDSRD+FT ER+  M+ + +  +RCHTIMNCT TCPKGLNPGLAI +IK M+
Sbjct:   32 AAATSQEPRYKTFSVYRWDPDKAGDKPRMQEFKVDLNDCGPMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIGGKNTLACICRIE-DLNKPTKIYPLPHMYVVKDLVPDMAHFYEQYRSIEPYLKKKEQVE--YGKEQYLQSIDDRKKLDGLYECILCACCSTSCPSYWWNADKYLGPAVLMQAYRWMIDSRDDFTAERVAFMDTDEYKVFRCHTIMNCTLTCPKGLNPGLAIAEIKKMV 272          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Nematostella
Match: EDO27683 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8K2])

HSP 1 Score: 141.354 bits (355), Expect = 9.496e-42
Identity = 63/85 (74.12%), Postives = 74/85 (87.06%), Query Frame = 3
Query:  120 SVAATQGPRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACI 374
            + A +Q PR K F++YRW+PDK  +KP+M  +++DLN CGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNIGG NTLACI
Sbjct:    9 AAATSQEPRYKTFSVYRWDPDKAGDKPRMQEFKVDLNDCGPMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIGGKNTLACI 93          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Medaka
Match: si:dkey-31b16.7 (succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial [Source:NCBI gene;Acc:101170091])

HSP 1 Score: 395.201 bits (1014), Expect = 5.757e-138
Identity = 188/263 (71.48%), Postives = 212/263 (80.61%), Query Frame = 3
Query:   66 RNSVKLIN--EVVRFSKINYSVAATQGPRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPKGLNPGLAIGKIKVML 848
            RN +   N   +V         AA   PR+K F +YRW+PD+P +KP+M TYE+DLN CGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNI G NTLAC+  I+ N  K TKIYPLPHM+V+KDLVPDMSNFYAQY+ IEPYLKKK  ++   GK   +QSV+DR  LDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFT ERL ++ + +S YRCHTIMNCTKTCPKGLNPG AI +IK M+
Sbjct:    8 RNLLAFTNGGTMVMVRSTQTVAAAAPEPRMKAFQVYRWDPDRPGDKPRMQTYEVDLNTCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNINGENTLACLNRINANSSKATKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDGSQE--GKTQYFQSVEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTEERLSKLQDPFSLYRCHTIMNCTKTCPKGLNPGKAIAEIKKMM 268          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Medaka
Match: SDHB (succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial [Source:NCBI gene;Acc:101171309])

HSP 1 Score: 389.423 bits (999), Expect = 1.566e-135
Identity = 185/242 (76.45%), Postives = 205/242 (84.71%), Query Frame = 3
Query:  144 RIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPKGLNPGLAIGKIKVMLMNLNSYK 869
            RIKKF +YRW+PD P +KP+M TY+IDLN CGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNI G NTLAC+  ID N+ K TKIYPLPHM+V+KDLVPDMSNFYAQY+ IEPYLKKK E+    GK+   QSV+DR  LDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFT ERL ++ + +S YRCHTIMNCT+TCPKGLNPG AI +IK M+      K
Sbjct:   42 RIKKFQVYRWDPDTPGDKPRMQTYDIDLNACGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNINGGNTLACLQRIDPNLSKPTKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDESRE--GKEQYLQSVEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTDERLSKLQDPFSLYRCHTIMNCTQTCPKGLNPGKAIAEIKKMMATYKERK 281          
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Planmine SMEST
Match: SMESG000020764.1 (SMESG000020764.1)

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 276/276 (100.00%), Postives = 276/276 (100.00%), Query Frame = 3
Query:   60 MLRNSVKLINEVVRFSKINYSVAATQGPRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPKGLNPGLAIGKIKVMLMNLNSYKRDEVKA 887
            MLRNSVKLINEVVRFSKINYSVAATQGPRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPKGLNPGLAIGKIKVMLMNLNSYKRDEVKA
Sbjct:    1 MLRNSVKLINEVVRFSKINYSVAATQGPRIKKFAIYRWNPDKPKEKPKMDTYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLNTLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKKKSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPKGLNPGLAIGKIKVMLMNLNSYKRDEVKA 276          
The following BLAST results are available for this feature:
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SDHB4.960e-13774.30succinate dehydrogenase complex iron sulfur subuni... [more]
SDHB7.950e-10377.42succinate dehydrogenase complex iron sulfur subuni... [more]
SDHB4.511e-6073.60succinate dehydrogenase complex iron sulfur subuni... [more]
back to top
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sdhb-14.577e-12767.60Succinate dehydrogenase [ubiquinone] iron-sulfur s... [more]
sdhb-14.577e-12767.60Succinate dehydrogenase [ubiquinone] iron-sulfur s... [more]
back to top
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SdhB2.440e-13367.67gene:FBgn0014028 transcript:FBtr0086156[more]
SdhBL1.628e-11564.92gene:FBgn0030975 transcript:FBtr0074648[more]
SdhBL1.628e-11564.92gene:FBgn0030975 transcript:FBtr0344973[more]
back to top
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sdhb9.067e-13474.19succinate dehydrogenase complex, subunit B, iron s... [more]
SDHB5.226e-3340.91si:dkey-31b16.7 [Source:ZFIN;Acc:ZDB-GENE-090313-3... [more]
back to top
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Sdhb1.728e-13577.12succinate dehydrogenase complex, subunit B, iron s... [more]
back to top
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9YHT2|SDHB_CHICK1.578e-13671.05Succinate dehydrogenase [ubiquinone] iron-sulfur s... [more]
sp|P21912|SDHB_HUMAN2.382e-13674.30Succinate dehydrogenase [ubiquinone] iron-sulfur s... [more]
sp|Q3B8J8|SDHB_XENLA1.117e-13577.02Succinate dehydrogenase [ubiquinone] iron-sulfur s... [more]
sp|Q3T189|SDHB_BOVIN5.243e-13574.70Succinate dehydrogenase [ubiquinone] iron-sulfur s... [more]
sp|P21913|SDHB_RAT9.300e-13577.12Succinate dehydrogenase [ubiquinone] iron-sulfur s... [more]
back to top
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PZW17.132e-14874.91Succinate dehydrogenase [ubiquinone] iron-sulfur s... [more]
A0A183T1A64.595e-14572.73Succinate dehydrogenase [ubiquinone] iron-sulfur s... [more]
A0A075AJ945.604e-14577.04Succinate dehydrogenase [ubiquinone] iron-sulfur s... [more]
Q5MB107.611e-14575.10Succinate dehydrogenase [ubiquinone] iron-sulfur s... [more]
A0A4V3SFT37.758e-14476.26Succinate dehydrogenase [ubiquinone] iron-sulfur s... [more]
back to top
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sdhb1.620e-13671.76succinate dehydrogenase complex iron sulfur subuni... [more]
back to top
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SDH27.117e-12469.92Iron-sulfur protein subunit of succinate dehydroge... [more]
back to top
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO449395.855e-13072.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO276839.496e-4274.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:dkey-31b16.75.757e-13871.48succinate dehydrogenase [ubiquinone] iron-sulfur s... [more]
SDHB1.566e-13576.45succinate dehydrogenase [ubiquinone] iron-sulfur s... [more]
back to top
BLAST of Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000020764.10.000e+0100.00SMESG000020764.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001678 ID=SMED30001678|Name=Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=1163bp
TAATTTGCCAAGCTTAGCTTTTTAATTTTTATAAACATTTTAAAAAATAA
GTATAAAGAATGTTACGTAATTCTGTAAAATTAATTAATGAAGTTGTTCG
ATTTTCGAAAATTAATTATTCCGTCGCAGCAACACAAGGTCCAAGAATTA
AGAAATTTGCAATATATAGATGGAATCCCGACAAGCCGAAAGAGAAGCCT
AAAATGGACACATATGAAATCGATTTAAATAAATGTGGACCTATGGTTTT
GGATGCATTGATTAAAATCAAAAACGAAATGGATCCCACTTTAACATTTC
GAAGATCATGCCGTGAAGGCATTTGTGGATCTTGCGCAATGAATATCGGT
GGTCTAAATACACTTGCTTGCATTTGTAACATCGACAAGAATATTGGTAA
AACGACAAAAATTTACCCATTACCACACATGCACGTGATCAAAGACCTTG
TGCCAGATATGAGCAATTTTTACGCTCAATACCGATGGATAGAGCCATAT
TTGAAAAAGAAGTCGGAAAATGAGGCAGATATCGGTAAAAAAGTTAATTA
CCAATCTGTGAAAGATCGTGATGTACTCGATGGATTGTATGAATGTATCC
TATGTGCTTGCTGTTCTACCAGCTGCCCGAGTTATTGGTGGAACGGAGAC
AAATATCTCGGTCCAGCGGTACTGATGCAAGCATATAGATGGATGATTGA
TTCCAGAGATGAATTCACTTATGAGCGCTTACAACAAATGAACAATGGAT
GGTCGGCATATCGTTGCCATACGATTATGAATTGCACTAAAACCTGTCCG
AAAGGCCTCAATCCAGGATTGGCAATCGGGAAGATCAAAGTGATGCTTAT
GAATTTGAATAGTTACAAAAGAGATGAAGTGAAAGCATGATGATGATTTG
AAATTTATTTCAAAATCAAACTGGCGCTTGAATTTATCAAAAATATATTC
ATACAAATTTTGCGTAGAAATGTAAATTAGTTTATCATTTGGTTTTTAAA
TCTAATGCAGAAATAATGAAATTGAATTCAATTATATAATCAATTATATA
ATCAATTGTAATATCAATTATACAATTATATTTTTTTCATTTCCATCCTA
TATTGGTATTTTACAATTTGTCTTTTTCGTATTTTCATGTTGAACAATTT
AATTATTATGGAG
back to top

protein sequence of SMED30001678-orf-1

>SMED30001678-orf-1 ID=SMED30001678-orf-1|Name=SMED30001678-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=277bp
MLRNSVKLINEVVRFSKINYSVAATQGPRIKKFAIYRWNPDKPKEKPKMD
TYEIDLNKCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGLN
TLACICNIDKNIGKTTKIYPLPHMHVIKDLVPDMSNFYAQYRWIEPYLKK
KSENEADIGKKVNYQSVKDRDVLDGLYECILCACCSTSCPSYWWNGDKYL
GPAVLMQAYRWMIDSRDEFTYERLQQMNNGWSAYRCHTIMNCTKTCPKGL
NPGLAIGKIKVMLMNLNSYKRDEVKA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0022900electron transport chain
GO:0006099tricarboxylic acid cycle
GO:0055114oxidation-reduction process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR004489Succ_DH/fum_Rdtase_Fe-S
IPR0360102Fe-2S_ferredoxin-like_sf
IPR025192Succ_DH/fum_Rdtase_N
IPR012675Beta-grasp_dom_sf
IPR0060582Fe2S_fd_BS
IPR0179004Fe4S_Fe_S_CS
IPR0178964Fe4S_Fe-S-bd
IPR0010412Fe-2S_ferredoxin-type
IPR009051Helical_ferredxn
Vocabulary: molecular function
TermDefinition
GO:0009055electron carrier activity
GO:0051536iron-sulfur cluster binding
GO:00515372 iron, 2 sulfur cluster binding
GO:0008177succinate dehydrogenase (ubiquinone) activity
GO:0016491oxidoreductase activity
GO:0046872metal ion binding
GO:00515383 iron, 4 sulfur cluster binding
GO:00515394 iron, 4 sulfur cluster binding
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004489Succinate dehydrogenase/fumarate reductase iron-sulphur proteinTIGRFAMTIGR00384TIGR00384coord: 35..260
e-value: 1.3E-81
score: 271.2
IPR012675Beta-grasp domain superfamilyGENE3DG3DSA:3.10.20.30coord: 21..133
e-value: 4.2E-49
score: 167.2
NoneNo IPR availablePFAMPF13534Fer4_17coord: 178..251
e-value: 2.4E-9
score: 37.6
NoneNo IPR availablePANTHERPTHR11921:SF29SUCCINATE DEHYDROGENASE [UBIQUINONE] IRON-SULFUR SUBUNIT, MITOCHONDRIALcoord: 23..267
NoneNo IPR availablePANTHERPTHR11921SUCCINATE DEHYDROGENASE IRON-SULFUR PROTEINcoord: 23..267
IPR025192Succinate dehydogenase/fumarate reductase N-terminalPFAMPF13085Fer2_3coord: 33..138
e-value: 4.0E-33
score: 113.7
IPR009051Alpha-helical ferredoxinGENE3DG3DSA:1.10.1060.10coord: 134..275
e-value: 1.2E-58
score: 198.7
IPR009051Alpha-helical ferredoxinSUPERFAMILYSSF46548alpha-helical ferredoxincoord: 134..264
IPR0060582Fe-2S ferredoxin, iron-sulphur binding sitePROSITEPS001972FE2S_FER_1coord: 84..92
IPR0179004Fe-4S ferredoxin, iron-sulphur binding, conserved sitePROSITEPS001984FE4S_FER_1coord: 179..190
IPR0178964Fe-4S ferredoxin-type, iron-sulphur binding domainPROSITEPS513794FE4S_FER_2coord: 169..199
score: 7.416
IPR0010412Fe-2S ferredoxin-type iron-sulfur binding domainPROSITEPS510852FE2S_FER_2coord: 31..124
score: 8.76
IPR0010412Fe-2S ferredoxin-type iron-sulfur binding domainCDDcd00207fer2coord: 63..96
e-value: 0.00686297
score: 33.1372
IPR0360102Fe-2S ferredoxin-like superfamilySUPERFAMILYSSF542922Fe-2S ferredoxin-likecoord: 30..133