E3 SUMO-protein ligase PIAS1

Overview
NameE3 SUMO-protein ligase PIAS1
Smed IDSMED30001673
Length (bp)3502
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 SUMO-protein ligase PIAS1 (SMED30001673) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 SUMO-protein ligase PIAS1 (SMED30001673) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 SUMO-protein ligase PIAS1 (SMED30001673) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 SUMO-protein ligase PIAS1 (SMED30001673) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001673

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30001673SMESG000069251.1 dd_Smed_v4_10997_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30001673SMESG000069251.1 dd_Smed_v4_10997_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Human
Match: PIAS2 (protein inhibitor of activated STAT 2 [Source:HGNC Symbol;Acc:HGNC:17311])

HSP 1 Score: 129.028 bits (323), Expect = 2.989e-30
Identity = 88/296 (29.73%), Postives = 144/296 (48.65%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR----TKSIKLDVRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T    ++ +SS +R   K    F F L    ++ +  SR           V++ +R C        E       D +P  L I ++GK   L  Y P   +  + +R  R +++T  V  + ++ +QI I W   +  + +S S+YLVR+ +   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R+  P R   CTHLQCFD   +L MN  KPTWICP+CD+   +  L +DGL + ILN+     + EIKF E+G W
Sbjct:  152 PFYDVLDVLIKPT----SLVQSSIQRFQEK---FFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQE-------DNYPNSLCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWA-SEIGKNYSMSVYLVRQLTSAMLLQRLKMKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLMCPLGKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILND--CSDVDEIKFQEDGSW 424          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Human
Match: PIAS2 (protein inhibitor of activated STAT 2 [Source:HGNC Symbol;Acc:HGNC:17311])

HSP 1 Score: 129.028 bits (323), Expect = 5.200e-30
Identity = 88/296 (29.73%), Postives = 144/296 (48.65%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR----TKSIKLDVRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T    ++ +SS +R   K    F F L    ++ +  SR           V++ +R C        E       D +P  L I ++GK   L  Y P   +  + +R  R +++T  V  + ++ +QI I W   +  + +S S+YLVR+ +   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R+  P R   CTHLQCFD   +L MN  KPTWICP+CD+   +  L +DGL + ILN+     + EIKF E+G W
Sbjct:  152 PFYDVLDVLIKPT----SLVQSSIQRFQEK---FFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQE-------DNYPNSLCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWA-SEIGKNYSMSVYLVRQLTSAMLLQRLKMKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLMCPLGKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILND--CSDVDEIKFQEDGSW 424          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Human
Match: PIAS2 (protein inhibitor of activated STAT 2 [Source:HGNC Symbol;Acc:HGNC:17311])

HSP 1 Score: 127.872 bits (320), Expect = 5.364e-30
Identity = 88/296 (29.73%), Postives = 144/296 (48.65%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR----TKSIKLDVRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T    ++ +SS +R   K    F F L    ++ +  SR           V++ +R C        E       D +P  L I ++GK   L  Y P   +  + +R  R +++T  V  + ++ +QI I W   +  + +S S+YLVR+ +   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R+  P R   CTHLQCFD   +L MN  KPTWICP+CD+   +  L +DGL + ILN+     + EIKF E+G W
Sbjct:  181 PFYDVLDVLIKPT----SLVQSSIQRFQEK---FFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQE-------DNYPNSLCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWA-SEIGKNYSMSVYLVRQLTSAMLLQRLKMKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLMCPLGKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILND--CSDVDEIKFQEDGSW 453          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Human
Match: PIAS1 (protein inhibitor of activated STAT 1 [Source:HGNC Symbol;Acc:HGNC:2752])

HSP 1 Score: 125.176 bits (313), Expect = 1.168e-28
Identity = 89/314 (28.34%), Postives = 151/314 (48.09%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR-TKSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWKSNDFIYEDDIDDGNYFGI 1078
            PFY+ +  ++  T L      +S     F+ +  F F L    ++ +S S      K D  V++ +RFC        E       D FP +L + ++ KP +L  YLP   +  + +R +R I++T  V  + ++ + I++ W  +     +S ++YLV++ S   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R+  P R   C+HLQCFD   ++ MN  KPTW+CP+CD+   +  L IDGL + IL  K      EI+F E+G W       E      +Y G+
Sbjct:  142 PFYDLLDELIKPTSL------ASDNSQRFRET-CFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQE-------DHFPPNLCVKVNTKPCSLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRN-YSMAVYLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEIL--KYCTDCDEIQFKEDGTWAPMRSKKEVQEVSASYNGV 432          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Human
Match: PIAS3 (protein inhibitor of activated STAT 3 [Source:HGNC Symbol;Acc:HGNC:16861])

HSP 1 Score: 124.02 bits (310), Expect = 1.510e-28
Identity = 86/296 (29.05%), Postives = 143/296 (48.31%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESRT--KSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFYE    ++  T     +  +S +R  F+ +H F F L    ++ +  SR      K D  +++ +RFC        E       D FP +L + ++GK   L  YLP   +  + +R +R I++T     + ++ + I++ W   +    +S S+YLVR+ +   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R+  P R   C HLQ FD   +L MN  KPTW CP+CD+   +  L IDGL + IL+        EI+F E+G W
Sbjct:   98 PFYEVYGELIRPT----TLASTSSQR--FEEAH-FTFALTPQQVQQILTSREVLPGAKCDYTIQVQLRFCLCETSCPQE-------DYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSRPINITPLARLSATVPNTIVVNW-SSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHSRALIKEKL---TADPDSEVATTSLRV---SLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEKKPTWTCPVCDKKAPYESLIIDGLFMEILSS--CSDCDEIQFMEDGSW 370          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Celegans
Match: gei-17 (E3 SUMO-protein ligase gei-17 [Source:UniProtKB/Swiss-Prot;Acc:Q94361])

HSP 1 Score: 98.9821 bits (245), Expect = 8.793e-21
Identity = 79/301 (26.25%), Postives = 141/301 (46.84%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESRTKSIKLDVRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWKSNDFIYED 1048
            PFY+ +  +L   P++L+   S    L       F F L  + I  +S     +      L +RF  +   V    K     D FP +    +D   + L   +P +    + +R +R +++T  +   K  +H + ++W+ D    +++  +Y V R +   L   L  +Q  S  R+  + ++ +    S  + +  +  +   N SL+ P+   R+ TP+R   CTHLQCFDL ++L+MN  KPTW CP+C  N  +  L +D   L +L  K  ++ +E++  E+G +   D I E+
Sbjct:   99 PFYDVISVLLK--PVELH--SSDSPTLKQTKQLQFPFLLTAEHISKISYRADVTPLPRYELQLRFFNLTEPVQGPQK-----DDFPLNCYARVDDSVVQLPNVIPTNKTNAEPKRPSRPVNITSNMNRYKK-EHTVAVEWLADK--RVWAAGVYFVHRVNSDILFKRL--NQNVSRHRSLEVTKQEVIKKLSGGEDDIAMDRL---NISLLDPLCKTRMTTPSRCQDCTHLQCFDLLSYLMMNEKKPTWQCPVCSSNCPYDRLIVDDYFLDML-AKVDKNTTEVELKEDGSY---DVIKEE 378          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Celegans
Match: gei-17 (E3 SUMO-protein ligase gei-17 [Source:UniProtKB/Swiss-Prot;Acc:Q94361])

HSP 1 Score: 98.9821 bits (245), Expect = 8.793e-21
Identity = 79/301 (26.25%), Postives = 141/301 (46.84%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESRTKSIKLDVRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWKSNDFIYED 1048
            PFY+ +  +L   P++L+   S    L       F F L  + I  +S     +      L +RF  +   V    K     D FP +    +D   + L   +P +    + +R +R +++T  +   K  +H + ++W+ D    +++  +Y V R +   L   L  +Q  S  R+  + ++ +    S  + +  +  +   N SL+ P+   R+ TP+R   CTHLQCFDL ++L+MN  KPTW CP+C  N  +  L +D   L +L  K  ++ +E++  E+G +   D I E+
Sbjct:   99 PFYDVISVLLK--PVELH--SSDSPTLKQTKQLQFPFLLTAEHISKISYRADVTPLPRYELQLRFFNLTEPVQGPQK-----DDFPLNCYARVDDSVVQLPNVIPTNKTNAEPKRPSRPVNITSNMNRYKK-EHTVAVEWLADK--RVWAAGVYFVHRVNSDILFKRL--NQNVSRHRSLEVTKQEVIKKLSGGEDDIAMDRL---NISLLDPLCKTRMTTPSRCQDCTHLQCFDLLSYLMMNEKKPTWQCPVCSSNCPYDRLIVDDYFLDML-AKVDKNTTEVELKEDGSY---DVIKEE 378          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Celegans
Match: gei-17 (E3 SUMO-protein ligase gei-17 [Source:UniProtKB/Swiss-Prot;Acc:Q94361])

HSP 1 Score: 98.2117 bits (243), Expect = 1.146e-20
Identity = 79/301 (26.25%), Postives = 141/301 (46.84%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESRTKSIKLDVRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWKSNDFIYED 1048
            PFY+ +  +L   P++L+   S    L       F F L  + I  +S     +      L +RF  +   V    K     D FP +    +D   + L   +P +    + +R +R +++T  +   K  +H + ++W+ D    +++  +Y V R +   L   L  +Q  S  R+  + ++ +    S  + +  +  +   N SL+ P+   R+ TP+R   CTHLQCFDL ++L+MN  KPTW CP+C  N  +  L +D   L +L  K  ++ +E++  E+G +   D I E+
Sbjct:  166 PFYDVISVLLK--PVELH--SSDSPTLKQTKQLQFPFLLTAEHISKISYRADVTPLPRYELQLRFFNLTEPVQGPQK-----DDFPLNCYARVDDSVVQLPNVIPTNKTNAEPKRPSRPVNITSNMNRYKK-EHTVAVEWLADK--RVWAAGVYFVHRVNSDILFKRL--NQNVSRHRSLEVTKQEVIKKLSGGEDDIAMDRL---NISLLDPLCKTRMTTPSRCQDCTHLQCFDLLSYLMMNEKKPTWQCPVCSSNCPYDRLIVDDYFLDML-AKVDKNTTEVELKEDGSY---DVIKEE 445          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Celegans
Match: gei-17 (E3 SUMO-protein ligase gei-17 [Source:UniProtKB/Swiss-Prot;Acc:Q94361])

HSP 1 Score: 98.2117 bits (243), Expect = 1.146e-20
Identity = 79/301 (26.25%), Postives = 141/301 (46.84%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESRTKSIKLDVRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWKSNDFIYED 1048
            PFY+ +  +L   P++L+   S    L       F F L  + I  +S     +      L +RF  +   V    K     D FP +    +D   + L   +P +    + +R +R +++T  +   K  +H + ++W+ D    +++  +Y V R +   L   L  +Q  S  R+  + ++ +    S  + +  +  +   N SL+ P+   R+ TP+R   CTHLQCFDL ++L+MN  KPTW CP+C  N  +  L +D   L +L  K  ++ +E++  E+G +   D I E+
Sbjct:  166 PFYDVISVLLK--PVELH--SSDSPTLKQTKQLQFPFLLTAEHISKISYRADVTPLPRYELQLRFFNLTEPVQGPQK-----DDFPLNCYARVDDSVVQLPNVIPTNKTNAEPKRPSRPVNITSNMNRYKK-EHTVAVEWLADK--RVWAAGVYFVHRVNSDILFKRL--NQNVSRHRSLEVTKQEVIKKLSGGEDDIAMDRL---NISLLDPLCKTRMTTPSRCQDCTHLQCFDLLSYLMMNEKKPTWQCPVCSSNCPYDRLIVDDYFLDML-AKVDKNTTEVELKEDGSY---DVIKEE 445          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Celegans
Match: gei-17 (E3 SUMO-protein ligase gei-17 [Source:UniProtKB/Swiss-Prot;Acc:Q94361])

HSP 1 Score: 98.2117 bits (243), Expect = 1.146e-20
Identity = 79/301 (26.25%), Postives = 141/301 (46.84%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESRTKSIKLDVRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWKSNDFIYED 1048
            PFY+ +  +L   P++L+   S    L       F F L  + I  +S     +      L +RF  +   V    K     D FP +    +D   + L   +P +    + +R +R +++T  +   K  +H + ++W+ D    +++  +Y V R +   L   L  +Q  S  R+  + ++ +    S  + +  +  +   N SL+ P+   R+ TP+R   CTHLQCFDL ++L+MN  KPTW CP+C  N  +  L +D   L +L  K  ++ +E++  E+G +   D I E+
Sbjct:  166 PFYDVISVLLK--PVELH--SSDSPTLKQTKQLQFPFLLTAEHISKISYRADVTPLPRYELQLRFFNLTEPVQGPQK-----DDFPLNCYARVDDSVVQLPNVIPTNKTNAEPKRPSRPVNITSNMNRYKK-EHTVAVEWLADK--RVWAAGVYFVHRVNSDILFKRL--NQNVSRHRSLEVTKQEVIKKLSGGEDDIAMDRL---NISLLDPLCKTRMTTPSRCQDCTHLQCFDLLSYLMMNEKKPTWQCPVCSSNCPYDRLIVDDYFLDML-AKVDKNTTEVELKEDGSY---DVIKEE 445          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Fly
Match: Su(var)2-10 (gene:FBgn0003612 transcript:FBtr0088572)

HSP 1 Score: 115.161 bits (287), Expect = 5.715e-26
Identity = 76/279 (27.24%), Postives = 137/279 (49.10%), Query Frame = 2
Query:  248 FDFTLNFDTIKLLSESR----TKSIKLDVRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKR---TASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQS-ISEIKFNEEGHWKSNDFIYEDDIDD 1060
            F FTL       ++ +R    +  ++  +++ +RFC +    D E       D FP ++ + ++ K   L   +P +    + +R  R ++VT  V  + ++ + I +QW  D     +  ++YLV++ +   L   L R +T  +K    T  L +E++      +D +  + T ++K  SL CP+   +++ P R + C+HLQCFD   +L MN  KPTW CP+CD+   +  L IDG    +L     +S  +EI+ +++G W +     E  I D
Sbjct:  205 FYFTLTPQQATEIASNRDIRNSSKVEHAIQVQLRFCLVETSCDQE-------DCFPPNVNVKVNNKLCQLPNVIPTNRPNVEPKRPPRPVNVTSNVKLSPTVTNTITVQWCPDYTRS-YCLAVYLVKKLTSTQL---LQRMKTKGVKPADYTRGLIKEKL-----TEDADCEIATTMLK-VSLNCPLGKMKMLLPCRASTCSHLQCFDASLYLQMNERKPTWNCPVCDKPAIYDNLVIDGYFQEVLGSSLLKSDDTEIQLHQDGSWSTPGLRSETQILD 466          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Fly
Match: Su(var)2-10 (gene:FBgn0003612 transcript:FBtr0343996)

HSP 1 Score: 114.775 bits (286), Expect = 6.188e-26
Identity = 76/279 (27.24%), Postives = 137/279 (49.10%), Query Frame = 2
Query:  248 FDFTLNFDTIKLLSESR----TKSIKLDVRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKR---TASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQS-ISEIKFNEEGHWKSNDFIYEDDIDD 1060
            F FTL       ++ +R    +  ++  +++ +RFC +    D E       D FP ++ + ++ K   L   +P +    + +R  R ++VT  V  + ++ + I +QW  D     +  ++YLV++ +   L   L R +T  +K    T  L +E++      +D +  + T ++K  SL CP+   +++ P R + C+HLQCFD   +L MN  KPTW CP+CD+   +  L IDG    +L     +S  +EI+ +++G W +     E  I D
Sbjct:  205 FYFTLTPQQATEIASNRDIRNSSKVEHAIQVQLRFCLVETSCDQE-------DCFPPNVNVKVNNKLCQLPNVIPTNRPNVEPKRPPRPVNVTSNVKLSPTVTNTITVQWCPDYTRS-YCLAVYLVKKLTSTQL---LQRMKTKGVKPADYTRGLIKEKL-----TEDADCEIATTMLK-VSLNCPLGKMKMLLPCRASTCSHLQCFDASLYLQMNERKPTWNCPVCDKPAIYDNLVIDGYFQEVLGSSLLKSDDTEIQLHQDGSWSTPGLRSETQILD 466          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Fly
Match: Su(var)2-10 (gene:FBgn0003612 transcript:FBtr0302507)

HSP 1 Score: 114.775 bits (286), Expect = 6.422e-26
Identity = 76/279 (27.24%), Postives = 137/279 (49.10%), Query Frame = 2
Query:  248 FDFTLNFDTIKLLSESR----TKSIKLDVRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKR---TASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQS-ISEIKFNEEGHWKSNDFIYEDDIDD 1060
            F FTL       ++ +R    +  ++  +++ +RFC +    D E       D FP ++ + ++ K   L   +P +    + +R  R ++VT  V  + ++ + I +QW  D     +  ++YLV++ +   L   L R +T  +K    T  L +E++      +D +  + T ++K  SL CP+   +++ P R + C+HLQCFD   +L MN  KPTW CP+CD+   +  L IDG    +L     +S  +EI+ +++G W +     E  I D
Sbjct:  205 FYFTLTPQQATEIASNRDIRNSSKVEHAIQVQLRFCLVETSCDQE-------DCFPPNVNVKVNNKLCQLPNVIPTNRPNVEPKRPPRPVNVTSNVKLSPTVTNTITVQWCPDYTRS-YCLAVYLVKKLTSTQL---LQRMKTKGVKPADYTRGLIKEKL-----TEDADCEIATTMLK-VSLNCPLGKMKMLLPCRASTCSHLQCFDASLYLQMNERKPTWNCPVCDKPAIYDNLVIDGYFQEVLGSSLLKSDDTEIQLHQDGSWSTPGLRSETQILD 466          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Fly
Match: Su(var)2-10 (gene:FBgn0003612 transcript:FBtr0088571)

HSP 1 Score: 114.775 bits (286), Expect = 6.877e-26
Identity = 76/279 (27.24%), Postives = 137/279 (49.10%), Query Frame = 2
Query:  248 FDFTLNFDTIKLLSESR----TKSIKLDVRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKR---TASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQS-ISEIKFNEEGHWKSNDFIYEDDIDD 1060
            F FTL       ++ +R    +  ++  +++ +RFC +    D E       D FP ++ + ++ K   L   +P +    + +R  R ++VT  V  + ++ + I +QW  D     +  ++YLV++ +   L   L R +T  +K    T  L +E++      +D +  + T ++K  SL CP+   +++ P R + C+HLQCFD   +L MN  KPTW CP+CD+   +  L IDG    +L     +S  +EI+ +++G W +     E  I D
Sbjct:  205 FYFTLTPQQATEIASNRDIRNSSKVEHAIQVQLRFCLVETSCDQE-------DCFPPNVNVKVNNKLCQLPNVIPTNRPNVEPKRPPRPVNVTSNVKLSPTVTNTITVQWCPDYTRS-YCLAVYLVKKLTSTQL---LQRMKTKGVKPADYTRGLIKEKL-----TEDADCEIATTMLK-VSLNCPLGKMKMLLPCRASTCSHLQCFDASLYLQMNERKPTWNCPVCDKPAIYDNLVIDGYFQEVLGSSLLKSDDTEIQLHQDGSWSTPGLRSETQILD 466          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Fly
Match: Su(var)2-10 (gene:FBgn0003612 transcript:FBtr0306705)

HSP 1 Score: 114.775 bits (286), Expect = 6.925e-26
Identity = 76/279 (27.24%), Postives = 137/279 (49.10%), Query Frame = 2
Query:  248 FDFTLNFDTIKLLSESR----TKSIKLDVRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKR---TASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQS-ISEIKFNEEGHWKSNDFIYEDDIDD 1060
            F FTL       ++ +R    +  ++  +++ +RFC +    D E       D FP ++ + ++ K   L   +P +    + +R  R ++VT  V  + ++ + I +QW  D     +  ++YLV++ +   L   L R +T  +K    T  L +E++      +D +  + T ++K  SL CP+   +++ P R + C+HLQCFD   +L MN  KPTW CP+CD+   +  L IDG    +L     +S  +EI+ +++G W +     E  I D
Sbjct:  205 FYFTLTPQQATEIASNRDIRNSSKVEHAIQVQLRFCLVETSCDQE-------DCFPPNVNVKVNNKLCQLPNVIPTNRPNVEPKRPPRPVNVTSNVKLSPTVTNTITVQWCPDYTRS-YCLAVYLVKKLTSTQL---LQRMKTKGVKPADYTRGLIKEKL-----TEDADCEIATTMLK-VSLNCPLGKMKMLLPCRASTCSHLQCFDASLYLQMNERKPTWNCPVCDKPAIYDNLVIDGYFQEVLGSSLLKSDDTEIQLHQDGSWSTPGLRSETQILD 466          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Zebrafish
Match: pias1b (protein inhibitor of activated STAT, 1b [Source:ZFIN;Acc:ZDB-GENE-050419-202])

HSP 1 Score: 131.339 bits (329), Expect = 7.267e-31
Identity = 87/295 (29.49%), Postives = 149/295 (50.51%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR-TKSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T L      +S     F+ +  F F L    ++ +S S      K D  V++ +RFC        E       D FP +L + ++GKP  L  YLP   +  + +R +R I++T  V  + ++ + I++ W   +    +S ++YLVR++S   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R++ P R   C+HLQCFD   ++ MN  KPTW+CP+CD+   +  L IDGL + IL+        EI+F E+G+W
Sbjct:  133 PFYDVLDELIKPTSL------ASDNSQRFQET-CFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQE-------DHFPPNLCVKVNGKPCNLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWT-SEIGRSYSMAVYLVRQQSSSVLLQRLRSKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLLCPLGKMRLMIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILSS--CVDCDEIQFKEDGNW 404          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Zebrafish
Match: pias1b (protein inhibitor of activated STAT, 1b [Source:ZFIN;Acc:ZDB-GENE-050419-202])

HSP 1 Score: 130.954 bits (328), Expect = 8.953e-31
Identity = 87/295 (29.49%), Postives = 149/295 (50.51%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR-TKSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T L      +S     F+ +  F F L    ++ +S S      K D  V++ +RFC        E       D FP +L + ++GKP  L  YLP   +  + +R +R I++T  V  + ++ + I++ W   +    +S ++YLVR++S   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R++ P R   C+HLQCFD   ++ MN  KPTW+CP+CD+   +  L IDGL + IL+        EI+F E+G+W
Sbjct:  142 PFYDVLDELIKPTSL------ASDNSQRFQET-CFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQE-------DHFPPNLCVKVNGKPCNLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWT-SEIGRSYSMAVYLVRQQSSSVLLQRLRSKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLLCPLGKMRLMIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILSS--CVDCDEIQFKEDGNW 413          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Zebrafish
Match: BX890624.1 (protein inhibitor of activated STAT, 1b [Source:NCBI gene;Acc:562982])

HSP 1 Score: 130.568 bits (327), Expect = 9.283e-31
Identity = 87/295 (29.49%), Postives = 149/295 (50.51%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR-TKSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T L      +S     F+ +  F F L    ++ +S S      K D  V++ +RFC        E       D FP +L + ++GKP  L  YLP   +  + +R +R I++T  V  + ++ + I++ W   +    +S ++YLVR++S   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R++ P R   C+HLQCFD   ++ MN  KPTW+CP+CD+   +  L IDGL + IL+        EI+F E+G+W
Sbjct:  126 PFYDVLDELIKPTSL------ASDNSQRFQET-CFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQE-------DHFPPNLCVKVNGKPCNLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWT-SEIGRSYSMAVYLVRQQSSSVLLQRLRSKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLLCPLGKMRLMIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILSS--CVDCDEIQFKEDGNW 397          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Zebrafish
Match: CR450724.1 (protein inhibitor of activated STAT, 1b [Source:NCBI gene;Acc:562982])

HSP 1 Score: 130.568 bits (327), Expect = 9.283e-31
Identity = 87/295 (29.49%), Postives = 149/295 (50.51%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR-TKSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T L      +S     F+ +  F F L    ++ +S S      K D  V++ +RFC        E       D FP +L + ++GKP  L  YLP   +  + +R +R I++T  V  + ++ + I++ W   +    +S ++YLVR++S   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R++ P R   C+HLQCFD   ++ MN  KPTW+CP+CD+   +  L IDGL + IL+        EI+F E+G+W
Sbjct:  126 PFYDVLDELIKPTSL------ASDNSQRFQET-CFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQE-------DHFPPNLCVKVNGKPCNLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWT-SEIGRSYSMAVYLVRQQSSSVLLQRLRSKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLLCPLGKMRLMIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILSS--CVDCDEIQFKEDGNW 397          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Zebrafish
Match: pias1a (protein inhibitor of activated STAT, 1a [Source:ZFIN;Acc:ZDB-GENE-120727-5])

HSP 1 Score: 130.183 bits (326), Expect = 1.597e-30
Identity = 90/314 (28.66%), Postives = 152/314 (48.41%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR-TKSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWKSNDFIYEDDIDDGNYFGI 1078
            PFY+ +  ++  T L      +S     F+ +  F F L    ++ +S S      K D  V++ +RFC        E       D FP +L + ++GKP  L  YLP   +  + +R +R I++T  +  + ++ + I++ W   +    +S ++YLV++ S   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R++ P R   C+HLQCFD   ++ MN  KPTW+CP+CD+   +  L IDGL + ILN        EI+F E+G W       E      +Y GI
Sbjct:  139 PFYDLLDELIKPTSL------ASDNSQRFQET-CFAFALTPQQVQQVSSSMDISGTKCDFTVQVQLRFCLSETSCPQE-------DHFPPNLCVKVNGKPCNLPGYLPPTKNGVEPKRPSRPINITSLIRLSTTVPNTIVVSWT-SEIGRSYSLAVYLVKQLSSTMLLQRLRGKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLLCPLGKMRLMIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILNS--CLDCDEIQFKEDGSWAPMRSKKEVQEVSASYNGI 429          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Xenopus
Match: PIAS1 (protein inhibitor of activated STAT 1 [Source:NCBI gene;Acc:100488714])

HSP 1 Score: 128.257 bits (321), Expect = 1.071e-29
Identity = 88/295 (29.83%), Postives = 146/295 (49.49%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR-TKSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T L      +S     F+ +  F F L    ++ +S S      K D  V++ +RFC        E       D FP +L + ++GKP  L  YLP   +  + +R +R I++T  V  + ++ + I++ W  +     FS ++YLV++ S   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R+  P R   C+HLQCFD   ++ MN  KPTW+CP+CD+   +  L IDGL + IL  K      EI+F E+G W
Sbjct:  141 PFYDLLDELIKPTSL------ASDNSQRFQET-CFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQE-------DHFPPNLCVKVNGKPCNLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRN-FSLAVYLVKQLSSAILLQRLRAKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLLCPLGKMRLTIPCRSLTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEIL--KCCTDCDEIQFKEDGSW 412          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Xenopus
Match: PIAS1 (protein inhibitor of activated STAT 1 [Source:NCBI gene;Acc:100488714])

HSP 1 Score: 127.872 bits (320), Expect = 1.110e-29
Identity = 88/295 (29.83%), Postives = 146/295 (49.49%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR-TKSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T L      +S     F+ +  F F L    ++ +S S      K D  V++ +RFC        E       D FP +L + ++GKP  L  YLP   +  + +R +R I++T  V  + ++ + I++ W  +     FS ++YLV++ S   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R+  P R   C+HLQCFD   ++ MN  KPTW+CP+CD+   +  L IDGL + IL  K      EI+F E+G W
Sbjct:  134 PFYDLLDELIKPTSL------ASDNSQRFQET-CFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQE-------DHFPPNLCVKVNGKPCNLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRN-FSLAVYLVKQLSSAILLQRLRAKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLLCPLGKMRLTIPCRSLTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEIL--KCCTDCDEIQFKEDGSW 405          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Xenopus
Match: PIAS1 (protein inhibitor of activated STAT 1 [Source:NCBI gene;Acc:100488714])

HSP 1 Score: 127.872 bits (320), Expect = 1.127e-29
Identity = 88/295 (29.83%), Postives = 146/295 (49.49%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR-TKSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T L      +S     F+ +  F F L    ++ +S S      K D  V++ +RFC        E       D FP +L + ++GKP  L  YLP   +  + +R +R I++T  V  + ++ + I++ W  +     FS ++YLV++ S   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R+  P R   C+HLQCFD   ++ MN  KPTW+CP+CD+   +  L IDGL + IL  K      EI+F E+G W
Sbjct:  142 PFYDLLDELIKPTSL------ASDNSQRFQET-CFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQE-------DHFPPNLCVKVNGKPCNLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRN-FSLAVYLVKQLSSAILLQRLRAKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLLCPLGKMRLTIPCRSLTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEIL--KCCTDCDEIQFKEDGSW 413          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Xenopus
Match: rgs11 (regulator of G-protein signaling 11 [Source:Xenbase;Acc:XB-GENE-5761563])

HSP 1 Score: 119.013 bits (297), Expect = 6.531e-27
Identity = 82/296 (27.70%), Postives = 142/296 (47.97%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIK--LLSESRTKSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T L  N  +  +++        F F L    ++  ++S       + D  V++ +R C        E       D +P  L I ++GK   L        +  + +R  R +++T  V  + ++ +Q+ I W   +  + +S S+YLVR+ +   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R+  P R   C+HLQCFD   +L MN  KPTWICP+CD+   +  L IDGL + ILN+     + EIKF ++G W
Sbjct:  142 PFYDVLDVLIKPTSLVQNTLQRFQEKF-------FIFALTPQQVREVVISRDYMPGGRRDYSVQVQLRLCLAETSCPQE-------DNYPSSLCIKVNGKLFPLPGCAVPPKNGVEQKRPGRPLNITSLVRLSSAVPNQVSISWA-SEIGKNYSMSVYLVRQLTSAVLLQKLKMKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLMCPLGKMRLTIPCRAVTCSHLQCFDAALYLQMNEKKPTWICPVCDKKASYESLIIDGLFMEILNQ--CSDVDEIKFQQDGSW 414          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Xenopus
Match: pias3 (protein inhibitor of activated STAT 3 [Source:NCBI gene;Acc:100144644])

HSP 1 Score: 118.242 bits (295), Expect = 1.438e-26
Identity = 81/268 (30.22%), Postives = 131/268 (48.88%), Query Frame = 2
Query:  230 FKGSHIFDFTLNFDTIKLLSESR--TKSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            F+ +H F+F L    +  +  SR      K D  V++ +RFC        E       D FP +L + ++ K   L  YLP   +  + +R  R I++T  +    ++ + I++ W   +    +S S+YLV++ +   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R+  P R   CTHLQCFD   +L MN  KPTW CP+CD+   +  L IDGL + ILN        EI+F E+G W
Sbjct:  152 FEEAH-FNFALTPQQVHQILSSRDILPGAKCDYTVQVQLRFCLCETSCPQE-------DYFPPNLFVKVNQKLCPLPGYLPPTKNGAEPKRPNRPINITPLIRLTSTVPNTIVVNW-SSEFGRNYSLSVYLVKQLTSVTLLQKLRAKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLMCPLGKMRLTVPCRAITCTHLQCFDAALYLQMNEKKPTWTCPVCDKKAPYDMLIIDGLFMDILNS--CTDCDEIQFMEDGSW 402          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Mouse
Match: Pias2 (protein inhibitor of activated STAT 2 [Source:MGI Symbol;Acc:MGI:1096566])

HSP 1 Score: 129.413 bits (324), Expect = 1.741e-30
Identity = 88/296 (29.73%), Postives = 144/296 (48.65%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR----TKSIKLDVRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T    ++ +SS +R   K    F F L    ++ +  SR           V++ +R C        E       D +P  L I ++GK   L  Y P   +  + +R  R +++T  V  + ++ +QI I W   +  + +S S+YLVR+ +   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R+  P R   CTHLQCFD   +L MN  KPTWICP+CD+   +  L +DGL + ILN+     + EIKF E+G W
Sbjct:  145 PFYDVLDVLIKPT----SLVQSSIQRFQEK---FFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQE-------DNYPNSLCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWA-SEIGKNYSMSVYLVRQLTSAMLLQRLKMKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLMCPLGKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILND--CSDVDEIKFQEDGSW 417          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Mouse
Match: Pias2 (protein inhibitor of activated STAT 2 [Source:MGI Symbol;Acc:MGI:1096566])

HSP 1 Score: 128.642 bits (322), Expect = 3.875e-30
Identity = 88/296 (29.73%), Postives = 144/296 (48.65%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR----TKSIKLDVRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T    ++ +SS +R   K    F F L    ++ +  SR           V++ +R C        E       D +P  L I ++GK   L  Y P   +  + +R  R +++T  V  + ++ +QI I W   +  + +S S+YLVR+ +   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R+  P R   CTHLQCFD   +L MN  KPTWICP+CD+   +  L +DGL + ILN+     + EIKF E+G W
Sbjct:  145 PFYDVLDVLIKPT----SLVQSSIQRFQEK---FFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQE-------DNYPNSLCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWA-SEIGKNYSMSVYLVRQLTSAMLLQRLKMKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLMCPLGKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILND--CSDVDEIKFQEDGSW 417          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Mouse
Match: Pias2 (protein inhibitor of activated STAT 2 [Source:MGI Symbol;Acc:MGI:1096566])

HSP 1 Score: 128.642 bits (322), Expect = 4.228e-30
Identity = 89/296 (30.07%), Postives = 146/296 (49.32%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR--TKSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T    ++ +SS +R   K    F F L    ++ +  SR      + D  V++ +R C        E       D +P  L I ++GK   L  Y P   +  + +R  R +++T  V  + ++ +QI I W   +  + +S S+YLVR+ +   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R+  P R   CTHLQCFD   +L MN  KPTWICP+CD+   +  L +DGL + ILN+     + EIKF E+G W
Sbjct:  152 PFYDVLDVLIKPT----SLVQSSIQRFQEK---FFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQE-------DNYPNSLCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWA-SEIGKNYSMSVYLVRQLTSAMLLQRLKMKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLMCPLGKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILND--CSDVDEIKFQEDGSW 424          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Mouse
Match: Pias3 (protein inhibitor of activated STAT 3 [Source:MGI Symbol;Acc:MGI:1913126])

HSP 1 Score: 125.176 bits (313), Expect = 7.109e-30
Identity = 87/296 (29.39%), Postives = 143/296 (48.31%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESRT--KSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFYE    ++  T     +  +S +R  F+ +H F F L    ++ +  SR      K D  +++ +RFC        E       D FP +L + ++GK   L  YLP   +  + +R +R I++T     + ++ + I++ W   +    +S S+YLVR+ +   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R+  P R   C HLQ FD   +L MN  KPTW CP+CD+   +  L IDGL + ILN        EI+F E+G W
Sbjct:  124 PFYEVYGELIRPT----TLASTSSQR--FEEAH-FTFALTPQQLQQILTSREVLPGAKCDYTIQVQLRFCLCETSCPQE-------DYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSRPINITPLARLSATVPNTIVVNW-SSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHSRALIKEKL---TADPDSEVATTSLRV---SLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEKKPTWTCPVCDKKAPYESLIIDGLFMEILNS--CSDCDEIQFMEDGSW 396          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Mouse
Match: Pias1 (protein inhibitor of activated STAT 1 [Source:MGI Symbol;Acc:MGI:1913125])

HSP 1 Score: 125.561 bits (314), Expect = 2.903e-29
Identity = 89/314 (28.34%), Postives = 151/314 (48.09%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR-TKSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWKSNDFIYEDDIDDGNYFGI 1078
            PFY+ +  ++  T L      +S     F+ +  F F L    ++ +S S      K D  V++ +RFC        E       D FP +L + ++ KP +L  YLP   +  + +R +R I++T  V  + ++ + I++ W  +     +S ++YLV++ S   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R+  P R   C+HLQCFD   ++ MN  KPTW+CP+CD+   +  L IDGL + IL  K      EI+F E+G W       E      +Y G+
Sbjct:  142 PFYDLLDELIKPTSL------ASDNSQRFRET-CFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQE-------DHFPPNLCVKVNTKPCSLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWTAE-IGRTYSMAVYLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEIL--KYCTDCDEIQFKEDGSWAPMRSKKEVQEVTASYNGV 432          
BLAST of E3 SUMO-protein ligase PIAS1 vs. UniProt/SwissProt
Match: sp|Q6AZ28|PIAS2_RAT (E3 SUMO-protein ligase PIAS2 OS=Rattus norvegicus OX=10116 GN=Pias2 PE=1 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 1.719e-29
Identity = 88/296 (29.73%), Postives = 144/296 (48.65%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR----TKSIKLDVRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T    ++ +SS +R   K    F F L    ++ +  SR           V++ +R C        E       D +P  L I ++GK   L  Y P   +  + +R  R +++T  V  + ++ +QI I W   +  + +S S+YLVR+ +   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R+  P R   CTHLQCFD   +L MN  KPTWICP+CD+   +  L +DGL + ILN+     + EIKF E+G W
Sbjct:  152 PFYDVLDVLIKPT----SLVQSSIQRFQEK---FFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQE-------DNYPNSLCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWA-SEIGKNYSMSVYLVRQLTSAMLLQRLKMKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLMCPLGKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILND--CSDVDEIKFQEDGSW 424          
BLAST of E3 SUMO-protein ligase PIAS1 vs. UniProt/SwissProt
Match: sp|O75928|PIAS2_HUMAN (E3 SUMO-protein ligase PIAS2 OS=Homo sapiens OX=9606 GN=PIAS2 PE=1 SV=3)

HSP 1 Score: 129.028 bits (323), Expect = 2.497e-29
Identity = 88/296 (29.73%), Postives = 144/296 (48.65%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR----TKSIKLDVRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T    ++ +SS +R   K    F F L    ++ +  SR           V++ +R C        E       D +P  L I ++GK   L  Y P   +  + +R  R +++T  V  + ++ +QI I W   +  + +S S+YLVR+ +   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R+  P R   CTHLQCFD   +L MN  KPTWICP+CD+   +  L +DGL + ILN+     + EIKF E+G W
Sbjct:  152 PFYDVLDVLIKPT----SLVQSSIQRFQEK---FFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQE-------DNYPNSLCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWA-SEIGKNYSMSVYLVRQLTSAMLLQRLKMKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLMCPLGKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILND--CSDVDEIKFQEDGSW 424          
BLAST of E3 SUMO-protein ligase PIAS1 vs. UniProt/SwissProt
Match: sp|Q8C5D8|PIAS2_MOUSE (E3 SUMO-protein ligase PIAS2 OS=Mus musculus OX=10090 GN=Pias2 PE=1 SV=2)

HSP 1 Score: 128.642 bits (322), Expect = 2.957e-29
Identity = 89/296 (30.07%), Postives = 146/296 (49.32%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR--TKSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T    ++ +SS +R   K    F F L    ++ +  SR      + D  V++ +R C        E       D +P  L I ++GK   L  Y P   +  + +R  R +++T  V  + ++ +QI I W   +  + +S S+YLVR+ +   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R+  P R   CTHLQCFD   +L MN  KPTWICP+CD+   +  L +DGL + ILN+     + EIKF E+G W
Sbjct:  152 PFYDVLDVLIKPT----SLVQSSIQRFQEK---FFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQE-------DNYPNSLCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWA-SEIGKNYSMSVYLVRQLTSAMLLQRLKMKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLMCPLGKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILND--CSDVDEIKFQEDGSW 424          
BLAST of E3 SUMO-protein ligase PIAS1 vs. UniProt/SwissProt
Match: sp|O88907|PIAS1_MOUSE (E3 SUMO-protein ligase PIAS1 OS=Mus musculus OX=10090 GN=Pias1 PE=1 SV=2)

HSP 1 Score: 125.946 bits (315), Expect = 2.646e-28
Identity = 86/295 (29.15%), Postives = 146/295 (49.49%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR-TKSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T L      +S     F+ +  F F L    ++ +S S      K D  V++ +RFC        E       D FP +L + ++ KP +L  YLP   +  + +R +R I++T  V  + ++ + I++ W  +     +S ++YLV++ S   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R+  P R   C+HLQCFD   ++ MN  KPTW+CP+CD+   +  L IDGL + IL  K      EI+F E+G W
Sbjct:  142 PFYDLLDELIKPTSL------ASDNSQRFRET-CFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQE-------DHFPPNLCVKVNTKPCSLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWTAE-IGRTYSMAVYLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEIL--KYCTDCDEIQFKEDGSW 413          
BLAST of E3 SUMO-protein ligase PIAS1 vs. UniProt/SwissProt
Match: sp|O70260|PIAS3_RAT (E3 SUMO-protein ligase PIAS3 OS=Rattus norvegicus OX=10116 GN=Pias3 PE=1 SV=2)

HSP 1 Score: 125.946 bits (315), Expect = 2.668e-28
Identity = 87/296 (29.39%), Postives = 143/296 (48.31%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESRT--KSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFYE    ++  T     +  +S +R  F+ +H F F L    ++ +  SR      K D  +++ +RFC        E       D FP +L + ++GK   L  YLP   +  + +R +R I++T     + ++ + I++ W   +    +S S+YLVR+ +   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R+  P R   C HLQ FD   +L MN  KPTW CP+CD+   +  L IDGL + ILN        EI+F E+G W
Sbjct:  133 PFYEVYGELIRPT----TLASTSSQR--FEEAH-FTFALTPQQLQQILTSREVLPGAKCDYTIQVQLRFCLCETSCPQE-------DYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSRPINITPLARLSATVPNTIVVNW-SSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHSRALIKEKL---TADPDSEVATTSLRV---SLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEKKPTWTCPVCDKKAPYESLIIDGLFMEILNS--CSDCDEIQFMEDGSW 405          
BLAST of E3 SUMO-protein ligase PIAS1 vs. TrEMBL
Match: A0A0X3PN85 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR123421 PE=4 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.502e-34
Identity = 102/343 (29.74%), Postives = 178/343 (51.90%), Query Frame = 2
Query:   83 VDNLKIKPNSKIMEIDNC------TLAPFYEHMQTILNST---PLDLNI---KKSSKKRLDFKGSHIFDFTLNFDTIKLLSESRTKSIKLDVRLIIRFCKI-----INVVDSEGKNLSMR-------DAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQD-DCHEIFSYSLYLVRRRSLHNLSYSLTRS--QTCSIKRTASLFRERIYYPSSN--KDIEYMVQ-TIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            +D++ +  +  I  I  C      T +PF++ ++ I   T   P +LN    K+  ++ L+ + S      + + + +L      K +   V++I+RF K+     +N+   E K    +       D FP HL ++++G+P  L   LP      DGRRNAR +++T  +  + ++ + + + W  D   +  F Y++YL R+RS   L  +L R   QT S+ +   + +      S+N  +D + +++ T+ V+   L+CP+S CRI  P RG  C H+QC+D +T+LL+N  KP W CP+CD    F  L +DGL+L IL +  ++++ EI F E+  W
Sbjct:   92 IDSITLATSGGIFRIPTCPPGLSFTSSPFFKVIEVIRPPTILSPSELNFIPGKRPYERALNLRISIDQAEAITYHSQRL----DDKRLDFGVQVIMRFAKLDPADLVNLRIGEPKQQQQQLSLSPQPDNFPIHLMLHVNGRPAQLPPLLPTTRPGLDGRRNARPVNITPLLRVSPAVSNTVKLVWTHDYATYSYFFYAVYLARKRSTRELCEALRRHSFQTASVTKQKIIEKLASTAASTNTMEDADLVIENTLPVQ---LLCPLSKCRIDLPVRGHNCQHIQCYDANTYLLINERKPAWKCPVCDVPAPFHELLVDGLMLEILADTMTENLEEIVFKEDSSW 427          
BLAST of E3 SUMO-protein ligase PIAS1 vs. TrEMBL
Match: A0A0X3PH50 (E3 SUMO-protein ligase PIAS1 (Fragment) OS=Schistocephalus solidus OX=70667 GN=PIAS1 PE=4 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 3.531e-34
Identity = 102/343 (29.74%), Postives = 178/343 (51.90%), Query Frame = 2
Query:   83 VDNLKIKPNSKIMEIDNC------TLAPFYEHMQTILNST---PLDLNI---KKSSKKRLDFKGSHIFDFTLNFDTIKLLSESRTKSIKLDVRLIIRFCKI-----INVVDSEGKNLSMR-------DAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQD-DCHEIFSYSLYLVRRRSLHNLSYSLTRS--QTCSIKRTASLFRERIYYPSSN--KDIEYMVQ-TIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            +D++ +  +  I  I  C      T +PF++ ++ I   T   P +LN    K+  ++ L+ + S      + + + +L      K +   V++I+RF K+     +N+   E K    +       D FP HL ++++G+P  L   LP      DGRRNAR +++T  +  + ++ + + + W  D   +  F Y++YL R+RS   L  +L R   QT S+ +   + +      S+N  +D + +++ T+ V+   L+CP+S CRI  P RG  C H+QC+D +T+LL+N  KP W CP+CD    F  L +DGL+L IL +  ++++ EI F E+  W
Sbjct:  168 IDSITLATSGGIFRIPTCPPGLSFTSSPFFKVIEVIRPPTILSPSELNFIPGKRPYERALNLRISIDQAEAITYHSQRL----DDKRLDFGVQVIMRFAKLDPADLVNLRIGEPKQQQQQLSLSPQPDNFPIHLMLHVNGRPAQLPPLLPTTRPGLDGRRNARPVNITPLLRVSPAVSNTVKLVWTHDYATYSYFFYAVYLARKRSTRELCEALRRHSFQTASVTKQKIIEKLASTAASTNTMEDADLVIENTLPVQ---LLCPLSKCRIDLPVRGHNCQHIQCYDANTYLLINERKPAWKCPVCDVPAPFHELLVDGLMLEILADTMTENLEEIVFKEDSSW 503          
BLAST of E3 SUMO-protein ligase PIAS1 vs. TrEMBL
Match: A0A0V0J591 (Uncharacterized protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR123421 PE=4 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 6.648e-34
Identity = 102/343 (29.74%), Postives = 178/343 (51.90%), Query Frame = 2
Query:   83 VDNLKIKPNSKIMEIDNC------TLAPFYEHMQTILNST---PLDLNI---KKSSKKRLDFKGSHIFDFTLNFDTIKLLSESRTKSIKLDVRLIIRFCKI-----INVVDSEGKNLSMR-------DAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQD-DCHEIFSYSLYLVRRRSLHNLSYSLTRS--QTCSIKRTASLFRERIYYPSSN--KDIEYMVQ-TIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            +D++ +  +  I  I  C      T +PF++ ++ I   T   P +LN    K+  ++ L+ + S      + + + +L      K +   V++I+RF K+     +N+   E K    +       D FP HL ++++G+P  L   LP      DGRRNAR +++T  +  + ++ + + + W  D   +  F Y++YL R+RS   L  +L R   QT S+ +   + +      S+N  +D + +++ T+ V+   L+CP+S CRI  P RG  C H+QC+D +T+LL+N  KP W CP+CD    F  L +DGL+L IL +  ++++ EI F E+  W
Sbjct:   92 IDSITLATSGGIFRIPTCPPGLSFTSSPFFKVIEVIRPPTILSPSELNFIPGKRPYERALNLRISIDQAEAITYHSQRL----DDKRLDFGVQVIMRFAKLDPADLVNLRIGEPKQQQQQLSLSPQPDNFPIHLMLHVNGRPAQLPPLLPTTRPGLDGRRNARPVNITPLLRVSPAVSNTVKLVWTHDYATYSYFFYAVYLARKRSTRELCEALRRHSFQTASVTKQKIIEKLASTAASTNTMEDADLVIENTLPVQ---LLCPLSKCRIDLPVRGHNCQHIQCYDANTYLLINERKPAWKCPVCDVPAPFHELLVDGLMLEILADTMTENLEEIVFKEDSSW 427          
BLAST of E3 SUMO-protein ligase PIAS1 vs. TrEMBL
Match: A0A0X3PX66 (E3 SUMO-protein ligase PIAS1 (Fragment) OS=Schistocephalus solidus OX=70667 GN=PIAS1 PE=4 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 9.221e-34
Identity = 102/343 (29.74%), Postives = 178/343 (51.90%), Query Frame = 2
Query:   83 VDNLKIKPNSKIMEIDNC------TLAPFYEHMQTILNST---PLDLNI---KKSSKKRLDFKGSHIFDFTLNFDTIKLLSESRTKSIKLDVRLIIRFCKI-----INVVDSEGKNLSMR-------DAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQD-DCHEIFSYSLYLVRRRSLHNLSYSLTRS--QTCSIKRTASLFRERIYYPSSN--KDIEYMVQ-TIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            +D++ +  +  I  I  C      T +PF++ ++ I   T   P +LN    K+  ++ L+ + S      + + + +L      K +   V++I+RF K+     +N+   E K    +       D FP HL ++++G+P  L   LP      DGRRNAR +++T  +  + ++ + + + W  D   +  F Y++YL R+RS   L  +L R   QT S+ +   + +      S+N  +D + +++ T+ V+   L+CP+S CRI  P RG  C H+QC+D +T+LL+N  KP W CP+CD    F  L +DGL+L IL +  ++++ EI F E+  W
Sbjct:  168 IDSITLATSGGIFRIPTCPPGLSFTSSPFFKVIEVIRPPTILSPSELNFIPGKRPYERALNLRISIDQAEAITYHSQRL----DDKRLDFGVQVIMRFAKLDPADLVNLRIGEPKQQQQQLSLSPQPDNFPIHLMLHVNGRPAQLPPLLPTTRPGLDGRRNARPVNITPLLRVSPAVSNTVKLVWTHDYATYSYFFYAVYLARKRSTRELCEALRRHSFQTASVTKQKIIEKLASTAASTNTMEDADLVIENTLPVQ---LLCPLSKCRIDLPVRGHNCQHIQCYDANTYLLINERKPAWKCPVCDVPAPFHELLVDGLMLEILADTMTENLEEIVFKEDSSW 503          
BLAST of E3 SUMO-protein ligase PIAS1 vs. TrEMBL
Match: A0A4Z2CS40 (E3 SUMO-protein ligase PIAS1 isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_007975 PE=4 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 1.163e-32
Identity = 91/283 (32.16%), Postives = 144/283 (50.88%), Query Frame = 2
Query:  308 IKLDVRLIIRFCKI--------INVVDSEG----KNLSM---------RDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSY---SLYLVRRRS-------LHNLSYSLTR----------SQTCSIKRTASLFRERIYYPSSNKDIE--YMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWKS 1027
            ++  V++I+RF ++        + + +  G     +LSM          D+ P HL I ++G+PI L   LP +    DGRRN R I++T ++  + ++ + I + W  D  +  F+Y    +YL+RRRS       LH+ S+              S   ++  + S+  +      S +D +   M  T+ V    L+CP+S CRI  P RG  C H+QC+D  T+L++N  KPTW CP+CD    +  L +DGL L ILN KRSQ + EI F+ +G W +
Sbjct:    1 MEFGVQVIMRFARLDPQACQDLVQIYELPGGRKSSSLSMNKPIKTPLAEDSLPVHLIIQVNGRPIQLPPLLPSNRPGMDGRRNPRPINITQSLHVSPTVPNYIKLTWTHD--YATFTYNVVGIYLMRRRSPQQLCGLLHSTSFHSANIMRMEIIKKLSPNATVGNSVSVHNQSHSSAFSEEDDDDLVMPNTLPVH---LLCPLSKCRIEVPVRGRNCRHVQCYDATTYLIINERKPTWNCPVCDGKAAYEDLIVDGLFLEILNSKRSQDLEEIIFHSDGSWSA 278          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Cavefish
Match: pias1b (protein inhibitor of activated STAT, 1b [Source:ZFIN;Acc:ZDB-GENE-050419-202])

HSP 1 Score: 133.265 bits (334), Expect = 1.311e-31
Identity = 88/295 (29.83%), Postives = 149/295 (50.51%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR-TKSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T L      +S     F+ +  F F L    ++ +S S      K D  V++ +RFC        E       D FP +L + ++GKP  L  YLP   +  + +R +R I++T  V  + ++ + I++ W   +    +S ++YLVR++S   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R++ P R   C+HLQCFD   ++ MN  KPTW+CP+CD+   +  L IDGL + ILN        EI+F E+G+W
Sbjct:  136 PFYDTLDELIKPTSL------ASDNNQRFQET-CFAFALTPQQVQQISSSMDISGTKCDFAVQVQLRFCLSETSCPQE-------DHFPPNLCVKVNGKPCNLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWT-SEIGRSYSMAVYLVRQQSSSVLLQRLRSKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLLCPLGKMRLMIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILNS--CVDCDEIQFKEDGNW 407          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Cavefish
Match: pias1b (protein inhibitor of activated STAT, 1b [Source:ZFIN;Acc:ZDB-GENE-050419-202])

HSP 1 Score: 132.88 bits (333), Expect = 1.345e-31
Identity = 88/295 (29.83%), Postives = 149/295 (50.51%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR-TKSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T L      +S     F+ +  F F L    ++ +S S      K D  V++ +RFC        E       D FP +L + ++GKP  L  YLP   +  + +R +R I++T  V  + ++ + I++ W   +    +S ++YLVR++S   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R++ P R   C+HLQCFD   ++ MN  KPTW+CP+CD+   +  L IDGL + ILN        EI+F E+G+W
Sbjct:  139 PFYDTLDELIKPTSL------ASDNNQRFQET-CFAFALTPQQVQQISSSMDISGTKCDFAVQVQLRFCLSETSCPQE-------DHFPPNLCVKVNGKPCNLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWT-SEIGRSYSMAVYLVRQQSSSVLLQRLRSKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLLCPLGKMRLMIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILNS--CVDCDEIQFKEDGNW 410          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Cavefish
Match: pias1a (protein inhibitor of activated STAT, 1a [Source:ZFIN;Acc:ZDB-GENE-120727-5])

HSP 1 Score: 130.954 bits (328), Expect = 6.554e-31
Identity = 86/295 (29.15%), Postives = 148/295 (50.17%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR-TKSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T L      +S     F+ +  F F L    ++ +S S      K D  V++ +RFC        E       D FP +L + ++GKP  L  YLP   +  + +R +R I++T  V  + ++ + I++ W   +    +S ++YLV++++   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R++ P R   C+HLQCFD   ++ MN  KPTW+CP+CD+   +  L IDGL + ILN        EI+F E+G W
Sbjct:  131 PFYDVLDELIKPTSL------ASDNSQRFQET-CFAFALTPQQVQQISGSMDISGTKCDFTVQVQLRFCLSETSCPQE-------DHFPPNLCVKVNGKPCNLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWT-SEIGRSYSMAVYLVKQQTSTALLQRLRAKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLLCPLGKMRLMIPCRAVTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILNS--CVDCDEIQFKEDGSW 402          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Cavefish
Match: pias1a (protein inhibitor of activated STAT, 1a [Source:ZFIN;Acc:ZDB-GENE-120727-5])

HSP 1 Score: 130.568 bits (327), Expect = 1.030e-30
Identity = 86/295 (29.15%), Postives = 148/295 (50.17%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR-TKSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T L      +S     F+ +  F F L    ++ +S S      K D  V++ +RFC        E       D FP +L + ++GKP  L  YLP   +  + +R +R I++T  V  + ++ + I++ W   +    +S ++YLV++++   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R++ P R   C+HLQCFD   ++ MN  KPTW+CP+CD+   +  L IDGL + ILN        EI+F E+G W
Sbjct:  145 PFYDVLDELIKPTSL------ASDNSQRFQET-CFAFALTPQQVQQISGSMDISGTKCDFTVQVQLRFCLSETSCPQE-------DHFPPNLCVKVNGKPCNLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWT-SEIGRSYSMAVYLVKQQTSTALLQRLRAKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLLCPLGKMRLMIPCRAVTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILNS--CVDCDEIQFKEDGSW 416          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Cavefish
Match: pias1b (protein inhibitor of activated STAT, 1b [Source:ZFIN;Acc:ZDB-GENE-050419-202])

HSP 1 Score: 128.257 bits (321), Expect = 1.114e-30
Identity = 74/238 (31.09%), Postives = 125/238 (52.52%), Query Frame = 2
Query:  392 DAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW---KSNDFIYEDDIDDGNYFGIPKSYSF 1096
            D FP +L + ++GKP  L  YLP   +  + +R +R I++T  V  + ++ + I++ W   +    +S ++YLVR++S   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R++ P R   C+HLQCFD   ++ MN  KPTW+CP+CD+   +  L IDGL + ILN        EI+F E+G+W   +S   + E         G   S+ F
Sbjct:  181 DHFPPNLCVKVNGKPCNLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWT-SEIGRSYSMAVYLVRQQSSSVLLQRLRSKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLLCPLGKMRLMIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILNS--CVDCDEIQFKEDGNWAPMRSKKVVQEVSASSNGLEGKHISFPF 409          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006097.1 (pep scaffold:Pmarinus_7.0:GL477570:42904:66158:-1 gene:ENSPMAG00000005462.1 transcript:ENSPMAT00000006097.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 126.331 bits (316), Expect = 1.134e-30
Identity = 89/299 (29.77%), Postives = 151/299 (50.50%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR----TKSIKLDVRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIK---RTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T    ++  SS +R  F+ ++ + F L    +  +S SR     +     V++ +RFC        E       D FP +L + ++GK   L  YLP   +  + +R +R I++T  V  + ++ + I + W  D     +S S+YLV++ +    S  L R +   I+    + +L +E++   +++ D E    ++ V   SL+CP+   R+  P R   CTHLQCFD   ++ MN  KPTW+CP+CD+   +  L IDGL + IL+      + EIKF E+G W
Sbjct:  162 PFYDILDELIKPT----SLVTSSNQR--FQETY-YVFALTPQQVAQISSSRDILPGQKYDFTVQVQLRFCLSETSCPQE-------DHFPANLCVKVNGKLCPLPGYLPPTKNGVEPKRPSRPINITAYVRLSPTVPNHITVSWTADFGRN-YSISVYLVKQLTS---SLLLNRMKAKGIRNSDHSRALIKEKL---TADPDSEIATTSLRV---SLLCPLGKMRLTIPCRALTCTHLQCFDAALYIQMNEKKPTWVCPVCDKKAPYDSLIIDGLFMEILSS--CTDVDEIKFREDGSW 434          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001340.1 (pep scaffold:Pmarinus_7.0:GL476352:326724:335624:-1 gene:ENSPMAG00000001204.1 transcript:ENSPMAT00000001340.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.005 bits (284), Expect = 1.132e-26
Identity = 88/299 (29.43%), Postives = 145/299 (48.49%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR----TKSIKLDVRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIK---RTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  I+  T     +  +S +R+       F F L    +  +S SR           V+L +RFC        E       D FP ++ + ++GKP  L   LP   +  + +R++R +++T  V    S+ + I + W   D    +S +++LV++ S   L   L R +   I+    + +L +E++   +++ D E    ++ V   SL+CP+   R+  P R   CTHLQCFD   +L MN  KPTW+CP+CD+   +  L IDGL + ILN        EI+F ++G W
Sbjct:  143 PFYDVLDEIMKPT----GLVATSTQRMQ---EAYFVFPLTPQQVSQISSSRELLPGSRYDYSVQLQLRFCLSETSCPQE-------DHFPLNVCVKVNGKPCPLPGCLPPQKNGVEPKRSSRAVNMTSLVRLTPSVPNHITVSW-STDFGRSYSLAVHLVKQLSSAVL---LNRLKAKGIRNSDHSRALIKEKL---TADPDSEIATTSLRV---SLLCPLGKMRLSLPCRALTCTHLQCFDAALYLQMNEKKPTWVCPVCDKKAPYDGLIIDGLFVEILNS--CTDADEIQFRQDGLW 415          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Yeast
Match: NFI1 (SUMO E3 ligase; catalyzes sumoylation of Yku70p/80p and Sir4p promoting telomere anchoring to the nuclear envelope and regulating telomerase activity; DNA-bound form catalyzes a DNA-damaged triggered sumoylation wave resulting in multisite modification of several DNA repair proteins, enhancing interactions between these proteins and accelerating repair; sumoylates Cse4p, a prerequisite for STUbL-mediated Ub-dependent degradation; role in telomere length maintenance [Source:SGD;Acc:S000005682])

HSP 1 Score: 67.0106 bits (162), Expect = 1.131e-11
Identity = 31/85 (36.47%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  770 SLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWK 1024
            SL CPIS  R+  PA+   C H+QCFD   FL      PTW CPIC   + F  L+I   + +I+ +  ++ + +++ + +G WK
Sbjct:  335 SLQCPISCTRMKYPAKTDQCKHIQCFDALWFLHSQSQVPTWQCPICQHPIKFDQLKISEFVDNII-QNCNEDVEQVEISVDGSWK 418          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Yeast
Match: SIZ1 (SUMO E3 ligase; promotes attachment of small ubiquitin-related modifier sumo (Smt3p) to primarily cytoplasmic proteins; regulates Rsp5p ubiquitin ligase activity and is in turn itself regulated by Rsp5p; required for sumoylation of septins and histone H3 variant Cse4p, a prerequisite for STUbL-mediated Ub-dependent degradation; localizes to the septin ring; acts as an adapter between E2, Ubc9p and substrates; tends to compensate for survival of DNA damage in absence of Nfi1p [Source:SGD;Acc:S000002817])

HSP 1 Score: 67.0106 bits (162), Expect = 1.214e-11
Identity = 33/108 (30.56%), Postives = 54/108 (50.00%), Query Frame = 2
Query:  704 IYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWKS 1027
            +Y   + ++ E M  T      SL CPIS+ R+  P++   C HLQCFD   FL      PTW CP+C  ++    L I   +  IL +   +++ +++   +G W +
Sbjct:  336 LYLKKTLREDEEMGLTTTSTIMSLQCPISYTRMKYPSKSINCKHLQCFDALWFLHSQLQIPTWQCPVCQIDIALENLAISEFVDDIL-QNCQKNVEQVELTSDGKWTA 442          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Nematostella
Match: EDO32140 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVX5])

HSP 1 Score: 98.9821 bits (245), Expect = 4.935e-22
Identity = 78/328 (23.78%), Postives = 151/328 (46.04%), Query Frame = 2
Query:   86 DNLKIKPNSKIMEIDNCTLAPFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESRTKSIK----LDVRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKR-----------TASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWK 1024
            +++ + P+ +++ +      PF+EH+  ++  T L + +  S       + +++  F L    + L++ SR           V++ +R C +    +         D FP  L I ++GK  +L  Y+P ++   D +R  R +++T+    + ++ + I + W                 +R +  +      + +C ++R           + +L +E++ +   + D E    ++ V   +L+CP+   ++  P R   C+HLQCFD   +L MN  K TWICP+CD+   F  L +DGL   IL+   S S +EI F E+G W+
Sbjct:   86 NSVPVHPDVRLVSL------PFFEHIDDLVRPTSL-VPVGMS-----QLQENYVV-FHLTPRQVGLITTSRDNRPHSRHDFTVQIQLRICLLETSCEQS-------DNFPSSLCIKVNGKICSLPGYVPPNASV-DHKRPGRPVNITNQCRLSSTVPNHIHVSWTPRH------------GQRHVVVIRLVRLVTSSCLMQRLKARGYRNPDHSRALIKEKLAH---DPDSEVATTSLRV---TLLCPLGKSKMTLPCRSVTCSHLQCFDAALYLQMNEKKTTWICPVCDQKAEFKSLVLDGLFREILDNT-SGSCTEISFYEDGSWR 373          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Nematostella
Match: EDO40709 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6F2])

HSP 1 Score: 68.1662 bits (165), Expect = 8.185e-13
Identity = 46/124 (37.10%), Postives = 66/124 (53.23%), Query Frame = 2
Query:  557 IQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTR-----SQTC--SIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPIC 907
            IQ     C     + L LV R S+ ++  SL R     ++ C   +KR  SL       P++N   + + QT I    SL CPI+F RI  PARG  C H+QCFDL+++L +N  + +W CP+C
Sbjct:   78 IQITVTACCCSHLFVLQLVHRPSVSSVLQSLLRKRLLPAEHCITKVKRNFSLCST---APTTNGSDDGVEQTAI--KVSLKCPITFRRISLPARGHDCKHIQCFDLESYLRLNCERGSWKCPVC 196          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Medaka
Match: pias1a (E3 SUMO-protein ligase PIAS1 [Source:NCBI gene;Acc:101169428])

HSP 1 Score: 133.265 bits (334), Expect = 7.277e-32
Identity = 88/295 (29.83%), Postives = 149/295 (50.51%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR-TKSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T L      +S     F+ +  F F L    ++ +S S      K D  V++ +RFC        E       D FP +L + ++GKP TL  YLP   +  + +R +R I++T  V  + ++ + I++ W  +     +S ++YLV+++S   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R++ P R   C+HLQCFD   ++ MN  KPTW+CP+CD+   +  L IDGL + ILN        EI+F E+G W
Sbjct:  155 PFYDMLDELIKPTSL------ASDNSQRFQET-CFAFALTPQQVQQISSSMDISGTKCDFSVQVQLRFCLSETSCPQE-------DHFPPNLCVKVNGKPCTLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWTSEIGRN-YSMAVYLVKQQSSTVLLQRLRAKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLLCPLGKMRLMIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFVEILNS--CMDCDEIQFKEDGSW 426          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Medaka
Match: pias1a (E3 SUMO-protein ligase PIAS1 [Source:NCBI gene;Acc:101169428])

HSP 1 Score: 133.265 bits (334), Expect = 2.310e-31
Identity = 88/295 (29.83%), Postives = 149/295 (50.51%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR-TKSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T L      +S     F+ +  F F L    ++ +S S      K D  V++ +RFC        E       D FP +L + ++GKP TL  YLP   +  + +R +R I++T  V  + ++ + I++ W  +     +S ++YLV+++S   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R++ P R   C+HLQCFD   ++ MN  KPTW+CP+CD+   +  L IDGL + ILN        EI+F E+G W
Sbjct:  159 PFYDMLDELIKPTSL------ASDNSQRFQET-CFAFALTPQQVQQISSSMDISGTKCDFSVQVQLRFCLSETSCPQE-------DHFPPNLCVKVNGKPCTLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWTSEIGRN-YSMAVYLVKQQSSTVLLQRLRAKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLLCPLGKMRLMIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFVEILNS--CMDCDEIQFKEDGSW 430          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Medaka
Match: pias1a (E3 SUMO-protein ligase PIAS1 [Source:NCBI gene;Acc:101169428])

HSP 1 Score: 132.88 bits (333), Expect = 2.877e-31
Identity = 88/295 (29.83%), Postives = 149/295 (50.51%), Query Frame = 2
Query:  146 PFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESR-TKSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHW 1021
            PFY+ +  ++  T L      +S     F+ +  F F L    ++ +S S      K D  V++ +RFC        E       D FP +L + ++GKP TL  YLP   +  + +R +R I++T  V  + ++ + I++ W  +     +S ++YLV+++S   L   L      +   + +L +E++   +++ D E    ++ V   SL+CP+   R++ P R   C+HLQCFD   ++ MN  KPTW+CP+CD+   +  L IDGL + ILN        EI+F E+G W
Sbjct:  152 PFYDMLDELIKPTSL------ASDNSQRFQET-CFAFALTPQQVQQISSSMDISGTKCDFSVQVQLRFCLSETSCPQE-------DHFPPNLCVKVNGKPCTLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWTSEIGRN-YSMAVYLVKQQSSTVLLQRLRAKGIRNPDHSRALIKEKL---TADPDSEIATTSLRV---SLLCPLGKMRLMIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFVEILNS--CMDCDEIQFKEDGSW 423          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Medaka
Match: pias1b (E3 SUMO-protein ligase PIAS1 [Source:NCBI gene;Acc:101160651])

HSP 1 Score: 131.339 bits (329), Expect = 6.013e-31
Identity = 86/293 (29.35%), Postives = 141/293 (48.12%), Query Frame = 2
Query:  248 FDFTLNFDTIKLLSESR-TKSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWKSNDFIYEDDIDDGNYFGIPKSYSFYKFNENE 1117
            + F L    ++ +S S      K D  V++ +RFC        E       D FP +L + ++GKP  L  YLP   +  + +R +R I++T  V  + ++ + I++ W   +    FS ++YLVR++S   L   L      +   + +L +E++       D E  + T  ++  SL+CP+   R+  P R   C+HLQCFD   ++ MN  KPTW+CP+CD+   +  L IDGL + IL+        EI+F E+G W       E      +Y G+    S  + NE +
Sbjct:  156 YAFALTPQQVQQISSSMDISGTKCDFAVQVQLRFCLSETSCPQE-------DHFPPNLCVKVNGKPCNLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWT-SEIGRSFSMAVYLVRQQSSAVLLQRLRAKGIRNPDHSRALIKEKL-----TADPESEIATTSLR-VSLLCPLGKMRLTIPCRSATCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILSS--CSDCDEIQFKEDGSWAPMRSKKEVQEVSASYNGVDSDVSRTEANEQK 432          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Medaka
Match: pias1b (E3 SUMO-protein ligase PIAS1 [Source:NCBI gene;Acc:101160651])

HSP 1 Score: 130.568 bits (327), Expect = 9.554e-31
Identity = 83/280 (29.64%), Postives = 136/280 (48.57%), Query Frame = 2
Query:  248 FDFTLNFDTIKLLSESR-TKSIKLD--VRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWKSNDFIYEDDIDDGNYFGI 1078
            + F L    ++ +S S      K D  V++ +RFC        E       D FP +L + ++GKP  L  YLP   +  + +R +R I++T  V  + ++ + I++ W   +    FS ++YLVR++S   L   L      +   + +L +E++       D E  + T  ++  SL+CP+   R+  P R   C+HLQCFD   ++ MN  KPTW+CP+CD+   +  L IDGL + IL+        EI+F E+G W       E      +Y G+
Sbjct:  165 YAFALTPQQVQQISSSMDISGTKCDFAVQVQLRFCLSETSCPQE-------DHFPPNLCVKVNGKPCNLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWT-SEIGRSFSMAVYLVRQQSSAVLLQRLRAKGIRNPDHSRALIKEKL-----TADPESEIATTSLR-VSLLCPLGKMRLTIPCRSATCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILSS--CSDCDEIQFKEDGSWAPMRSKKEVQEVSASYNGV 428          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Planmine SMEST
Match: SMESG000069251.1 (SMESG000069251.1)

HSP 1 Score: 2244.16 bits (5814), Expect = 0.000e+0
Identity = 1110/1118 (99.28%), Postives = 1112/1118 (99.46%), Query Frame = 2
Query:  119 MEIDNCTLAPFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESRTKSIKLDVRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWKSNDFIYEDDIDDGNYFGIPKSYSFYKFNENEINKDKIADEISSKLSRKQMNIDLLKLLPPTNWKEYNLPTTILNALSCNEIAIPQSNPNEDIIQTNTPTDVDAPSDNAIIHTTKRNHSDSLTDFPNNSNQNNIPIKKSKLSIKTMQKENITNVNNENAVIESRLDSNFPSDSFHNNNKEIPINKSKLAIRNIPKENITHVNNKKSVEDETKNDSEHLKTLPMKKKSEQSKKFYQYIKILAGKIDKNLKFQFYDSNEKVPNYLRSTDCKMLFWIIEVSNKNPVKLGNICSWGENGVMEIHVVSNGVELFNESNYRLLRKLDEFTTWEVNKTVLNYILKSPSQAGSIIGIEFRENNKDGYNPKVINNIDTLSTEAVLHPSNEDFLHRRSFIRQKLDCDEILKRILFIDATFTVSNADHGRSPLSISILDYNGCEILNTLVTPRSRVNCFGESVHGITELKSREQMDEYDCIRKVHQIVKDRILIGHNMYLKLHHLFIPKYSLMGIRDLATAKVFGKLKVARKLNEQIYALEILKKAFLPNDSNAFLTANSHNNACLIRNIYLAVENEWEDHLPLVPEISSFLADISNNNCSSNTDQSLSTTLKMVTPDFCDNLNGNQILHKPAPSSDVNDDVSDGQQQYCLNNTLATETGQTLELNDESNQLNSLKTNSTAPIGSRILPNPLDNIILSFPIDNSHCNIDIANCQNNXXXXXXXXXXXXKVSKPNQSPQDIEFGDYYLDESYIQQSSPDLTVNSDPIPDISEQQILTRNLPFMKSWRISIDLNCNNDDSEGAKITEGVNSDASLLGGNKNHCDNVITGF 3472
            MEIDNCTLAPFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESRTKSIKLDVR IIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHE FSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWKSNDFIYEDDIDDGNYFGIPKSYSFYKFNENEINKDKI DEISSKLSRKQMNID+LKLLPPTNWKEYNLPTTILNALSCNEI IPQSNPNEDIIQTNTPTDVDAPSDNAIIHTTKRNHSDSLTDFPNNSNQNNIPIKKSKLSIKTMQKENITNVNNENAVIESRLDSNFPSDSFHNNNKEIPINKSKLAIRNIPKENITHVNNKKSVEDETKNDSEHLKTLPMKKKSEQSKKFYQYIKILAGKIDKNLKFQFYDSNEKVPNYLRSTDCKMLFWIIEVSNKNPVKLGNICSWGENGVMEIHVVSNGVELFNESNYRLLRKLDEFTTWEVNKTVLNYILKSPSQAGSIIGIEFRENNKDGYNPKVINNIDTLSTEAVLHPSNEDFLHRRSFIRQKLDCDEILKRILFIDATFTVSNADHGRSPLSISILDYNGCEILNTLVTPRSRVNCFGESVHGITELKSREQMDEYDCIRKVHQIVKDRILIGHNMYLKLHHLFIPKYSLMGIRDLATAKVFGKLKVARKLNEQIYALEILKKAFLPNDSNAFLTANSHNNACLIRNIYLAVENEWEDHLPLVPEISSFLADISNNNCSSNT+QSLSTTLKMVTPDFCDNLNGNQILHKPAPSSDVNDDVSDGQQQYCLNNTLATETGQTLELNDESNQLNSLKTNSTAPIGSRILPNPLDNIILSFPIDNSHCNIDIANCQNNDDSDMLSLDELEKVSKPNQSPQD EFGDY LDESYIQQSSPDLTVNSDPIPDISEQQILTRNLPFMKSWRISIDLNCNNDDSEGAKITEGVNSDASLLGGNKNHCDNVITGF
Sbjct:    1 MEIDNCTLAPFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESRTKSIKLDVRFIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHESFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWKSNDFIYEDDIDDGNYFGIPKSYSFYKFNENEINKDKITDEISSKLSRKQMNIDILKLLPPTNWKEYNLPTTILNALSCNEIVIPQSNPNEDIIQTNTPTDVDAPSDNAIIHTTKRNHSDSLTDFPNNSNQNNIPIKKSKLSIKTMQKENITNVNNENAVIESRLDSNFPSDSFHNNNKEIPINKSKLAIRNIPKENITHVNNKKSVEDETKNDSEHLKTLPMKKKSEQSKKFYQYIKILAGKIDKNLKFQFYDSNEKVPNYLRSTDCKMLFWIIEVSNKNPVKLGNICSWGENGVMEIHVVSNGVELFNESNYRLLRKLDEFTTWEVNKTVLNYILKSPSQAGSIIGIEFRENNKDGYNPKVINNIDTLSTEAVLHPSNEDFLHRRSFIRQKLDCDEILKRILFIDATFTVSNADHGRSPLSISILDYNGCEILNTLVTPRSRVNCFGESVHGITELKSREQMDEYDCIRKVHQIVKDRILIGHNMYLKLHHLFIPKYSLMGIRDLATAKVFGKLKVARKLNEQIYALEILKKAFLPNDSNAFLTANSHNNACLIRNIYLAVENEWEDHLPLVPEISSFLADISNNNCSSNTNQSLSTTLKMVTPDFCDNLNGNQILHKPAPSSDVNDDVSDGQQQYCLNNTLATETGQTLELNDESNQLNSLKTNSTAPIGSRILPNPLDNIILSFPIDNSHCNIDIANCQNNDDSDMLSLDELEKVSKPNQSPQDFEFGDYNLDESYIQQSSPDLTVNSDPIPDISEQQILTRNLPFMKSWRISIDLNCNNDDSEGAKITEGVNSDASLLGGNKNHCDNVITGF 1118          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Planmine SMEST
Match: SMESG000069251.1 (SMESG000069251.1)

HSP 1 Score: 2210.65 bits (5727), Expect = 0.000e+0
Identity = 1096/1104 (99.28%), Postives = 1098/1104 (99.46%), Query Frame = 2
Query:  161 MQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESRTKSIKLDVRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWKSNDFIYEDDIDDGNYFGIPKSYSFYKFNENEINKDKIADEISSKLSRKQMNIDLLKLLPPTNWKEYNLPTTILNALSCNEIAIPQSNPNEDIIQTNTPTDVDAPSDNAIIHTTKRNHSDSLTDFPNNSNQNNIPIKKSKLSIKTMQKENITNVNNENAVIESRLDSNFPSDSFHNNNKEIPINKSKLAIRNIPKENITHVNNKKSVEDETKNDSEHLKTLPMKKKSEQSKKFYQYIKILAGKIDKNLKFQFYDSNEKVPNYLRSTDCKMLFWIIEVSNKNPVKLGNICSWGENGVMEIHVVSNGVELFNESNYRLLRKLDEFTTWEVNKTVLNYILKSPSQAGSIIGIEFRENNKDGYNPKVINNIDTLSTEAVLHPSNEDFLHRRSFIRQKLDCDEILKRILFIDATFTVSNADHGRSPLSISILDYNGCEILNTLVTPRSRVNCFGESVHGITELKSREQMDEYDCIRKVHQIVKDRILIGHNMYLKLHHLFIPKYSLMGIRDLATAKVFGKLKVARKLNEQIYALEILKKAFLPNDSNAFLTANSHNNACLIRNIYLAVENEWEDHLPLVPEISSFLADISNNNCSSNTDQSLSTTLKMVTPDFCDNLNGNQILHKPAPSSDVNDDVSDGQQQYCLNNTLATETGQTLELNDESNQLNSLKTNSTAPIGSRILPNPLDNIILSFPIDNSHCNIDIANCQNNXXXXXXXXXXXXKVSKPNQSPQDIEFGDYYLDESYIQQSSPDLTVNSDPIPDISEQQILTRNLPFMKSWRISIDLNCNNDDSEGAKITEGVNSDASLLGGNKNHCDNVITGF 3472
            MQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESRTKSIKLDVR IIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHE FSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWKSNDFIYEDDIDDGNYFGIPKSYSFYKFNENEINKDKI DEISSKLSRKQMNID+LKLLPPTNWKEYNLPTTILNALSCNEI IPQSNPNEDIIQTNTPTDVDAPSDNAIIHTTKRNHSDSLTDFPNNSNQNNIPIKKSKLSIKTMQKENITNVNNENAVIESRLDSNFPSDSFHNNNKEIPINKSKLAIRNIPKENITHVNNKKSVEDETKNDSEHLKTLPMKKKSEQSKKFYQYIKILAGKIDKNLKFQFYDSNEKVPNYLRSTDCKMLFWIIEVSNKNPVKLGNICSWGENGVMEIHVVSNGVELFNESNYRLLRKLDEFTTWEVNKTVLNYILKSPSQAGSIIGIEFRENNKDGYNPKVINNIDTLSTEAVLHPSNEDFLHRRSFIRQKLDCDEILKRILFIDATFTVSNADHGRSPLSISILDYNGCEILNTLVTPRSRVNCFGESVHGITELKSREQMDEYDCIRKVHQIVKDRILIGHNMYLKLHHLFIPKYSLMGIRDLATAKVFGKLKVARKLNEQIYALEILKKAFLPNDSNAFLTANSHNNACLIRNIYLAVENEWEDHLPLVPEISSFLADISNNNCSSNT+QSLSTTLKMVTPDFCDNLNGNQILHKPAPSSDVNDDVSDGQQQYCLNNTLATETGQTLELNDESNQLNSLKTNSTAPIGSRILPNPLDNIILSFPIDNSHCNIDIANCQNNDDSDMLSLDELEKVSKPNQSPQD EFGDY LDESYIQQSSPDLTVNSDPIPDISEQQILTRNLPFMKSWRISIDLNCNNDDSEGAKITEGVNSDASLLGGNKNHCDNVITGF
Sbjct:    1 MQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESRTKSIKLDVRFIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHESFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWKSNDFIYEDDIDDGNYFGIPKSYSFYKFNENEINKDKITDEISSKLSRKQMNIDILKLLPPTNWKEYNLPTTILNALSCNEIVIPQSNPNEDIIQTNTPTDVDAPSDNAIIHTTKRNHSDSLTDFPNNSNQNNIPIKKSKLSIKTMQKENITNVNNENAVIESRLDSNFPSDSFHNNNKEIPINKSKLAIRNIPKENITHVNNKKSVEDETKNDSEHLKTLPMKKKSEQSKKFYQYIKILAGKIDKNLKFQFYDSNEKVPNYLRSTDCKMLFWIIEVSNKNPVKLGNICSWGENGVMEIHVVSNGVELFNESNYRLLRKLDEFTTWEVNKTVLNYILKSPSQAGSIIGIEFRENNKDGYNPKVINNIDTLSTEAVLHPSNEDFLHRRSFIRQKLDCDEILKRILFIDATFTVSNADHGRSPLSISILDYNGCEILNTLVTPRSRVNCFGESVHGITELKSREQMDEYDCIRKVHQIVKDRILIGHNMYLKLHHLFIPKYSLMGIRDLATAKVFGKLKVARKLNEQIYALEILKKAFLPNDSNAFLTANSHNNACLIRNIYLAVENEWEDHLPLVPEISSFLADISNNNCSSNTNQSLSTTLKMVTPDFCDNLNGNQILHKPAPSSDVNDDVSDGQQQYCLNNTLATETGQTLELNDESNQLNSLKTNSTAPIGSRILPNPLDNIILSFPIDNSHCNIDIANCQNNDDSDMLSLDELEKVSKPNQSPQDFEFGDYNLDESYIQQSSPDLTVNSDPIPDISEQQILTRNLPFMKSWRISIDLNCNNDDSEGAKITEGVNSDASLLGGNKNHCDNVITGF 1104          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Planmine SMEST
Match: SMESG000069251.1 (SMESG000069251.1)

HSP 1 Score: 1190.64 bits (3079), Expect = 0.000e+0
Identity = 592/595 (99.50%), Postives = 593/595 (99.66%), Query Frame = 2
Query: 1688 MKKKSEQSKKFYQYIKILAGKIDKNLKFQFYDSNEKVPNYLRSTDCKMLFWIIEVSNKNPVKLGNICSWGENGVMEIHVVSNGVELFNESNYRLLRKLDEFTTWEVNKTVLNYILKSPSQAGSIIGIEFRENNKDGYNPKVINNIDTLSTEAVLHPSNEDFLHRRSFIRQKLDCDEILKRILFIDATFTVSNADHGRSPLSISILDYNGCEILNTLVTPRSRVNCFGESVHGITELKSREQMDEYDCIRKVHQIVKDRILIGHNMYLKLHHLFIPKYSLMGIRDLATAKVFGKLKVARKLNEQIYALEILKKAFLPNDSNAFLTANSHNNACLIRNIYLAVENEWEDHLPLVPEISSFLADISNNNCSSNTDQSLSTTLKMVTPDFCDNLNGNQILHKPAPSSDVNDDVSDGQQQYCLNNTLATETGQTLELNDESNQLNSLKTNSTAPIGSRILPNPLDNIILSFPIDNSHCNIDIANCQNNXXXXXXXXXXXXKVSKPNQSPQDIEFGDYYLDESYIQQSSPDLTVNSDPIPDISEQQILTRNLPFMKSWRISIDLNCNNDDSEGAKITEGVNSDASLLGGNKNHCDNVITGF 3472
            MKKKSEQSKKFYQYIKILAGKIDKNLKFQFYDSNEKVPNYLRSTDCKMLFWIIEVSNKNPVKLGNICSWGENGVMEIHVVSNGVELFNESNYRLLRKLDEFTTWEVNKTVLNYILKSPSQAGSIIGIEFRENNKDGYNPKVINNIDTLSTEAVLHPSNEDFLHRRSFIRQKLDCDEILKRILFIDATFTVSNADHGRSPLSISILDYNGCEILNTLVTPRSRVNCFGESVHGITELKSREQMDEYDCIRKVHQIVKDRILIGHNMYLKLHHLFIPKYSLMGIRDLATAKVFGKLKVARKLNEQIYALEILKKAFLPNDSNAFLTANSHNNACLIRNIYLAVENEWEDHLPLVPEISSFLADISNNNCSSNT+QSLSTTLKMVTPDFCDNLNGNQILHKPAPSSDVNDDVSDGQQQYCLNNTLATETGQTLELNDESNQLNSLKTNSTAPIGSRILPNPLDNIILSFPIDNSHCNIDIANCQNNDDSDMLSLDELEKVSKPNQSPQD EFGDY LDESYIQQSSPDLTVNSDPIPDISEQQILTRNLPFMKSWRISIDLNCNNDDSEGAKITEGVNSDASLLGGNKNHCDNVITGF
Sbjct:    1 MKKKSEQSKKFYQYIKILAGKIDKNLKFQFYDSNEKVPNYLRSTDCKMLFWIIEVSNKNPVKLGNICSWGENGVMEIHVVSNGVELFNESNYRLLRKLDEFTTWEVNKTVLNYILKSPSQAGSIIGIEFRENNKDGYNPKVINNIDTLSTEAVLHPSNEDFLHRRSFIRQKLDCDEILKRILFIDATFTVSNADHGRSPLSISILDYNGCEILNTLVTPRSRVNCFGESVHGITELKSREQMDEYDCIRKVHQIVKDRILIGHNMYLKLHHLFIPKYSLMGIRDLATAKVFGKLKVARKLNEQIYALEILKKAFLPNDSNAFLTANSHNNACLIRNIYLAVENEWEDHLPLVPEISSFLADISNNNCSSNTNQSLSTTLKMVTPDFCDNLNGNQILHKPAPSSDVNDDVSDGQQQYCLNNTLATETGQTLELNDESNQLNSLKTNSTAPIGSRILPNPLDNIILSFPIDNSHCNIDIANCQNNDDSDMLSLDELEKVSKPNQSPQDFEFGDYNLDESYIQQSSPDLTVNSDPIPDISEQQILTRNLPFMKSWRISIDLNCNNDDSEGAKITEGVNSDASLLGGNKNHCDNVITGF 595          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Planmine SMEST
Match: SMESG000069251.1 (SMESG000069251.1)

HSP 1 Score: 1050.43 bits (2715), Expect = 0.000e+0
Identity = 512/517 (99.03%), Postives = 513/517 (99.23%), Query Frame = 2
Query:  119 MEIDNCTLAPFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESRTKSIKLDVRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWKSNDFIYEDDIDDGNYFGIPKSYSFYKFNENEINKDKIADEISSKLSRKQMNIDLLKLLPPTNWKEYNLPTTILNALSCNEIAIPQSNPNEDIIQTNTPTDVDAPSDNAIIHTTKRNHSDSLTDFPNNSNQNNIPIKKSKLSIKTMQKENITNVNNENAVIESRLDSNFPSDSFHNNNKEIPINKSKLAIRNIPKENITHVNNKKSVEDETKNDSE 1669
            MEIDNCTLAPFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESRTKSIKLDVR IIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHE FSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWKSNDFIYEDDIDDGNYFGIPKSYSFYKFNENEINKDKI DEISSKLSRKQMNID+LKLLPPTNWKEYNLPTTILNALSCNEI IPQSNPNEDIIQTNTPTDVDAPSDNAIIHTTKRNHSDSLTDFPNNSNQNNIPIKKSKLSIKTMQKENITNVNNENAVIESRLDSNFPSDSFHNNNKEIPINKSKLAIRNIPKENITHVNNKKSVEDETKNDSE
Sbjct:    1 MEIDNCTLAPFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESRTKSIKLDVRFIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHESFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWKSNDFIYEDDIDDGNYFGIPKSYSFYKFNENEINKDKITDEISSKLSRKQMNIDILKLLPPTNWKEYNLPTTILNALSCNEIVIPQSNPNEDIIQTNTPTDVDAPSDNAIIHTTKRNHSDSLTDFPNNSNQNNIPIKKSKLSIKTMQKENITNVNNENAVIESRLDSNFPSDSFHNNNKEIPINKSKLAIRNIPKENITHVNNKKSVEDETKNDSE 517          
BLAST of E3 SUMO-protein ligase PIAS1 vs. Planmine SMEST
Match: SMESG000069251.1 (SMESG000069251.1)

HSP 1 Score: 1043.88 bits (2698), Expect = 0.000e+0
Identity = 514/528 (97.35%), Postives = 519/528 (98.30%), Query Frame = 2
Query:  119 MEIDNCTLAPFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESRTKSIKLDVRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWKSNDFIYEDDIDDGNYFGIPKSYSFYKFNENEINKDKIADEISSKLSRKQMNIDLLKLLPPTNWKEYNLPTTILNALSCNEIAIPQSNPNEDIIQTNTPTDVDAPSDNAIIHTTKRNHSDSLTDFPNNSNQNNIPIKKSKLSIKTMQKENITNVNNENAVIESRLDSNFPSDSFHNNNKEIPINKSKLAIRNIPKENITHVNNKKSVEDETKNDS--EHLKTLPMKK 1696
            MEIDNCTLAPFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESRTKSIKLDVR IIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHE FSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWKSNDFIYEDDIDDGNYFGIPKSYSFYKFNENEINKDKI DEISSKLSRKQMNID+LKLLPPTNWKEYNLPTTILNALSCNEI IPQSNPNEDIIQTNTPTDVDAPSDNAIIHTTKRNHSDSLTDFPNNSNQNNIPIKKSKLSIKTMQKENITNVNNENAVIESRLDSNFPSDSFHNNNKEIPINKSKLAIRNIPKENITHVNNKKSVEDETKNDS  ++LK +  K+
Sbjct:    1 MEIDNCTLAPFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNFDTIKLLSESRTKSIKLDVRFIIRFCKIINVVDSEGKNLSMRDAFPQHLTIYIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWVQDDCHESFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPSSNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLLMNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGHWKSNDFIYEDDIDDGNYFGIPKSYSFYKFNENEINKDKITDEISSKLSRKQMNIDILKLLPPTNWKEYNLPTTILNALSCNEIVIPQSNPNEDIIQTNTPTDVDAPSDNAIIHTTKRNHSDSLTDFPNNSNQNNIPIKKSKLSIKTMQKENITNVNNENAVIESRLDSNFPSDSFHNNNKEIPINKSKLAIRNIPKENITHVNNKKSVEDETKNDSGRDNLKKILAKR 528          
The following BLAST results are available for this feature:
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIAS22.989e-3029.73protein inhibitor of activated STAT 2 [Source:HGNC... [more]
PIAS25.200e-3029.73protein inhibitor of activated STAT 2 [Source:HGNC... [more]
PIAS25.364e-3029.73protein inhibitor of activated STAT 2 [Source:HGNC... [more]
PIAS11.168e-2828.34protein inhibitor of activated STAT 1 [Source:HGNC... [more]
PIAS31.510e-2829.05protein inhibitor of activated STAT 3 [Source:HGNC... [more]
back to top
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gei-178.793e-2126.25E3 SUMO-protein ligase gei-17 [Source:UniProtKB/S... [more]
gei-178.793e-2126.25E3 SUMO-protein ligase gei-17 [Source:UniProtKB/S... [more]
gei-171.146e-2026.25E3 SUMO-protein ligase gei-17 [Source:UniProtKB/S... [more]
gei-171.146e-2026.25E3 SUMO-protein ligase gei-17 [Source:UniProtKB/S... [more]
gei-171.146e-2026.25E3 SUMO-protein ligase gei-17 [Source:UniProtKB/S... [more]
back to top
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Su(var)2-105.715e-2627.24gene:FBgn0003612 transcript:FBtr0088572[more]
Su(var)2-106.188e-2627.24gene:FBgn0003612 transcript:FBtr0343996[more]
Su(var)2-106.422e-2627.24gene:FBgn0003612 transcript:FBtr0302507[more]
Su(var)2-106.877e-2627.24gene:FBgn0003612 transcript:FBtr0088571[more]
Su(var)2-106.925e-2627.24gene:FBgn0003612 transcript:FBtr0306705[more]
back to top
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pias1b7.267e-3129.49protein inhibitor of activated STAT, 1b [Source:ZF... [more]
pias1b8.953e-3129.49protein inhibitor of activated STAT, 1b [Source:ZF... [more]
BX890624.19.283e-3129.49protein inhibitor of activated STAT, 1b [Source:NC... [more]
CR450724.19.283e-3129.49protein inhibitor of activated STAT, 1b [Source:NC... [more]
pias1a1.597e-3028.66protein inhibitor of activated STAT, 1a [Source:ZF... [more]
back to top
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIAS11.071e-2929.83protein inhibitor of activated STAT 1 [Source:NCBI... [more]
PIAS11.110e-2929.83protein inhibitor of activated STAT 1 [Source:NCBI... [more]
PIAS11.127e-2929.83protein inhibitor of activated STAT 1 [Source:NCBI... [more]
rgs116.531e-2727.70regulator of G-protein signaling 11 [Source:Xenbas... [more]
pias31.438e-2630.22protein inhibitor of activated STAT 3 [Source:NCBI... [more]
back to top
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pias21.741e-3029.73protein inhibitor of activated STAT 2 [Source:MGI ... [more]
Pias23.875e-3029.73protein inhibitor of activated STAT 2 [Source:MGI ... [more]
Pias24.228e-3030.07protein inhibitor of activated STAT 2 [Source:MGI ... [more]
Pias37.109e-3029.39protein inhibitor of activated STAT 3 [Source:MGI ... [more]
Pias12.903e-2928.34protein inhibitor of activated STAT 1 [Source:MGI ... [more]
back to top
BLAST of E3 SUMO-protein ligase PIAS1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6AZ28|PIAS2_RAT1.719e-2929.73E3 SUMO-protein ligase PIAS2 OS=Rattus norvegicus ... [more]
sp|O75928|PIAS2_HUMAN2.497e-2929.73E3 SUMO-protein ligase PIAS2 OS=Homo sapiens OX=96... [more]
sp|Q8C5D8|PIAS2_MOUSE2.957e-2930.07E3 SUMO-protein ligase PIAS2 OS=Mus musculus OX=10... [more]
sp|O88907|PIAS1_MOUSE2.646e-2829.15E3 SUMO-protein ligase PIAS1 OS=Mus musculus OX=10... [more]
sp|O70260|PIAS3_RAT2.668e-2829.39E3 SUMO-protein ligase PIAS3 OS=Rattus norvegicus ... [more]
back to top
BLAST of E3 SUMO-protein ligase PIAS1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PN851.502e-3429.74Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A0X3PH503.531e-3429.74E3 SUMO-protein ligase PIAS1 (Fragment) OS=Schisto... [more]
A0A0V0J5916.648e-3429.74Uncharacterized protein (Fragment) OS=Schistocepha... [more]
A0A0X3PX669.221e-3429.74E3 SUMO-protein ligase PIAS1 (Fragment) OS=Schisto... [more]
A0A4Z2CS401.163e-3232.16E3 SUMO-protein ligase PIAS1 isoform 2 OS=Schistos... [more]
back to top
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pias1b1.311e-3129.83protein inhibitor of activated STAT, 1b [Source:ZF... [more]
pias1b1.345e-3129.83protein inhibitor of activated STAT, 1b [Source:ZF... [more]
pias1a6.554e-3129.15protein inhibitor of activated STAT, 1a [Source:ZF... [more]
pias1a1.030e-3029.15protein inhibitor of activated STAT, 1a [Source:ZF... [more]
pias1b1.114e-3031.09protein inhibitor of activated STAT, 1b [Source:ZF... [more]
back to top
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000006097.11.134e-3029.77pep scaffold:Pmarinus_7.0:GL477570:42904:66158:-1 ... [more]
ENSPMAT00000001340.11.132e-2629.43pep scaffold:Pmarinus_7.0:GL476352:326724:335624:-... [more]
back to top
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
NFI11.131e-1136.47SUMO E3 ligase; catalyzes sumoylation of Yku70p/80... [more]
SIZ11.214e-1130.56SUMO E3 ligase; promotes attachment of small ubiqu... [more]
back to top
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO321404.935e-2223.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407098.185e-1337.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of E3 SUMO-protein ligase PIAS1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pias1a7.277e-3229.83E3 SUMO-protein ligase PIAS1 [Source:NCBI gene;Acc... [more]
pias1a2.310e-3129.83E3 SUMO-protein ligase PIAS1 [Source:NCBI gene;Acc... [more]
pias1a2.877e-3129.83E3 SUMO-protein ligase PIAS1 [Source:NCBI gene;Acc... [more]
pias1b6.013e-3129.35E3 SUMO-protein ligase PIAS1 [Source:NCBI gene;Acc... [more]
pias1b9.554e-3129.64E3 SUMO-protein ligase PIAS1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of E3 SUMO-protein ligase PIAS1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069251.10.000e+099.28SMESG000069251.1[more]
SMESG000069251.10.000e+099.28SMESG000069251.1[more]
SMESG000069251.10.000e+099.50SMESG000069251.1[more]
SMESG000069251.10.000e+099.03SMESG000069251.1[more]
SMESG000069251.10.000e+097.35SMESG000069251.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001673 ID=SMED30001673|Name=E3 SUMO-protein ligase PIAS1|organism=Schmidtea mediterranea sexual|type=transcript|length=3502bp
TTTATATTTTATACCATTTAGCATAATCATCTTCCAATATTAGACAATAT
TCATACTTATCATCTTAATTATCTACCAGAAAGTTGATAATTTAAAAATT
AAACCAAATTCAAAAATAATGGAAATTGACAACTGCACTTTAGCTCCATT
TTATGAGCATATGCAGACAATTCTTAATTCAACGCCTTTGGATTTAAATA
TTAAAAAATCTTCCAAGAAGCGTCTTGATTTTAAAGGAAGCCATATATTT
GATTTTACGTTAAATTTTGATACGATTAAGTTATTATCCGAGTCCAGGAC
AAAATCTATTAAACTTGATGTTCGCTTAATAATACGGTTTTGTAAAATCA
TAAATGTGGTTGATTCTGAAGGAAAGAACTTGTCAATGAGAGATGCTTTC
CCTCAGCATTTAACAATATATATAGATGGTAAACCGATTACGTTGTCAAA
ATATTTACCATATGACAGCGATCGTCGGGATGGCAGGAGGAATGCTAGAC
TTATTGATGTTACTGACGCTGTTGTTGATGCAAAAAGTCTGCAACATCAA
ATCATAATTCAATGGGTGCAAGATGATTGTCATGAAATTTTCAGTTATTC
ACTTTACCTCGTGCGGCGCCGGAGTTTGCACAACTTATCTTATTCATTAA
CCCGATCTCAGACTTGTTCCATTAAAAGAACTGCTAGTTTATTTCGTGAG
CGCATTTATTATCCTTCGAGCAATAAAGATATTGAATATATGGTCCAAAC
GATAATTGTCAAAAATGCTTCTCTCATTTGTCCTATTTCCTTTTGCCGAA
TTATAACTCCTGCTCGAGGCACATTGTGTACCCACTTACAGTGCTTTGAT
TTGGACACATTTTTACTCATGAATTTTATGAAACCAACTTGGATATGTCC
CATATGCGACGAAAATTTATATTTCACTTGCTTGGAAATCGACGGTTTGA
TATTGAGTATTCTCAATGAAAAACGTTCACAATCAATATCTGAAATTAAA
TTTAATGAAGAAGGACATTGGAAATCGAATGACTTTATTTATGAAGATGA
TATTGACGATGGCAATTATTTCGGCATTCCAAAATCTTATTCCTTTTATA
AATTTAATGAAAATGAAATCAATAAAGATAAAATCGCTGACGAAATTTCG
AGTAAATTATCGAGAAAACAAATGAACATTGATTTATTAAAACTTCTGCC
ACCGACCAATTGGAAGGAATATAACTTACCAACTACCATTTTAAATGCTC
TAAGCTGCAATGAAATTGCGATTCCTCAGTCAAACCCTAATGAGGATATA
ATACAGACCAATACACCAACTGATGTTGATGCTCCTTCAGACAATGCAAT
TATCCATACTACTAAACGAAATCATTCCGATTCTCTCACAGATTTTCCTA
ATAATTCCAATCAAAATAATATTCCTATCAAAAAATCTAAATTATCAATC
AAAACTATGCAAAAAGAAAATATAACAAATGTGAATAATGAAAATGCAGT
TATCGAATCTAGATTGGATTCAAATTTTCCAAGCGATTCTTTTCATAATA
ACAATAAGGAGATCCCAATTAATAAATCAAAATTAGCTATAAGAAATATT
CCCAAAGAAAATATAACACATGTGAATAATAAAAAATCCGTTGAAGATGA
AACAAAAAATGATTCAGAACATTTGAAAACATTGCCAATGAAAAAAAAAT
CTGAACAATCAAAAAAATTCTATCAATATATTAAAATTCTTGCTGGGAAA
ATTGATAAAAATCTAAAATTTCAATTTTATGATTCCAATGAAAAAGTGCC
TAATTACTTACGGTCAACAGATTGTAAAATGCTATTTTGGATTATTGAAG
TCTCAAATAAAAACCCGGTGAAATTGGGCAACATATGTTCATGGGGTGAA
AATGGAGTTATGGAAATTCATGTTGTCTCTAATGGTGTGGAATTATTCAA
TGAGTCGAATTATCGATTGTTGAGAAAATTAGATGAGTTCACCACATGGG
AAGTGAATAAGACGGTTTTGAATTACATTTTAAAATCTCCATCCCAAGCC
GGTTCCATAATCGGAATAGAATTCCGAGAAAATAATAAAGACGGATATAA
CCCAAAAGTTATTAATAATATCGATACGTTGTCAACAGAAGCAGTTTTAC
ATCCATCAAATGAAGACTTTTTGCACCGGCGTTCATTTATTAGACAAAAA
TTAGATTGCGATGAAATTCTAAAAAGGATTCTTTTTATTGATGCAACTTT
TACAGTAAGTAATGCAGATCACGGTCGTTCACCCTTGTCTATCTCAATAT
TGGATTATAACGGCTGTGAAATATTGAACACTCTGGTAACTCCAAGGAGT
CGAGTTAACTGTTTCGGTGAAAGTGTCCATGGAATAACGGAATTGAAATC
ACGAGAACAAATGGATGAGTACGATTGTATTCGTAAGGTTCACCAAATAG
TAAAAGATAGGATTTTAATCGGACACAACATGTACTTGAAGCTCCATCAT
TTATTTATCCCAAAATATTCGCTAATGGGAATTCGAGATTTAGCTACGGC
TAAAGTGTTTGGAAAATTGAAGGTGGCGAGAAAATTGAATGAACAAATCT
ATGCGCTTGAGATATTGAAGAAAGCTTTTCTACCGAATGATTCCAATGCA
TTTTTAACTGCCAATTCACACAATAACGCATGTTTGATACGGAATATTTA
TTTAGCCGTGGAAAACGAATGGGAAGACCATCTTCCTTTGGTTCCGGAAA
TTTCATCATTTTTAGCTGATATCTCCAATAATAACTGTTCATCAAATACT
GACCAATCGCTATCAACGACTTTAAAAATGGTCACGCCAGATTTTTGTGA
CAATTTAAATGGAAACCAAATTCTTCATAAACCTGCTCCAAGTAGCGATG
TGAATGATGATGTTTCAGATGGACAACAACAATATTGCTTGAACAACACG
CTAGCAACTGAAACAGGGCAAACATTGGAACTAAATGATGAATCTAACCA
ATTAAATTCACTTAAAACGAATTCAACTGCTCCCATTGGCAGTAGAATAT
TACCGAATCCTTTAGACAACATTATACTTTCGTTTCCGATAGACAATTCT
CACTGCAATATTGACATAGCCAATTGCCAAAACAATGACGATTCTGACAT
GTTGTCATTGGACGAGTTAGAAAAGGTATCAAAGCCCAATCAGAGTCCAC
AGGACATTGAGTTTGGAGATTACTATTTAGACGAATCGTATATTCAACAG
AGCTCTCCAGACTTAACCGTAAATAGTGATCCTATCCCAGATATTTCCGA
ACAACAGATTCTAACTCGAAATCTCCCATTCATGAAGTCGTGGAGGATTT
CGATTGATTTGAATTGCAATAATGATGATAGTGAAGGTGCCAAAATTACC
GAGGGTGTCAATAGCGATGCCTCATTATTGGGGGGTAACAAGAATCACTG
TGACAATGTCATCACTGGATTCTAATATCTCCAGCCGCGCTCAAAATTAG
CC
back to top

protein sequence of SMED30001673-orf-1

>SMED30001673-orf-1 ID=SMED30001673-orf-1|Name=SMED30001673-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1119bp
MEIDNCTLAPFYEHMQTILNSTPLDLNIKKSSKKRLDFKGSHIFDFTLNF
DTIKLLSESRTKSIKLDVRLIIRFCKIINVVDSEGKNLSMRDAFPQHLTI
YIDGKPITLSKYLPYDSDRRDGRRNARLIDVTDAVVDAKSLQHQIIIQWV
QDDCHEIFSYSLYLVRRRSLHNLSYSLTRSQTCSIKRTASLFRERIYYPS
SNKDIEYMVQTIIVKNASLICPISFCRIITPARGTLCTHLQCFDLDTFLL
MNFMKPTWICPICDENLYFTCLEIDGLILSILNEKRSQSISEIKFNEEGH
WKSNDFIYEDDIDDGNYFGIPKSYSFYKFNENEINKDKIADEISSKLSRK
QMNIDLLKLLPPTNWKEYNLPTTILNALSCNEIAIPQSNPNEDIIQTNTP
TDVDAPSDNAIIHTTKRNHSDSLTDFPNNSNQNNIPIKKSKLSIKTMQKE
NITNVNNENAVIESRLDSNFPSDSFHNNNKEIPINKSKLAIRNIPKENIT
HVNNKKSVEDETKNDSEHLKTLPMKKKSEQSKKFYQYIKILAGKIDKNLK
FQFYDSNEKVPNYLRSTDCKMLFWIIEVSNKNPVKLGNICSWGENGVMEI
HVVSNGVELFNESNYRLLRKLDEFTTWEVNKTVLNYILKSPSQAGSIIGI
EFRENNKDGYNPKVINNIDTLSTEAVLHPSNEDFLHRRSFIRQKLDCDEI
LKRILFIDATFTVSNADHGRSPLSISILDYNGCEILNTLVTPRSRVNCFG
ESVHGITELKSREQMDEYDCIRKVHQIVKDRILIGHNMYLKLHHLFIPKY
SLMGIRDLATAKVFGKLKVARKLNEQIYALEILKKAFLPNDSNAFLTANS
HNNACLIRNIYLAVENEWEDHLPLVPEISSFLADISNNNCSSNTDQSLST
TLKMVTPDFCDNLNGNQILHKPAPSSDVNDDVSDGQQQYCLNNTLATETG
QTLELNDESNQLNSLKTNSTAPIGSRILPNPLDNIILSFPIDNSHCNIDI
ANCQNNDDSDMLSLDELEKVSKPNQSPQDIEFGDYYLDESYIQQSSPDLT
VNSDPIPDISEQQILTRNLPFMKSWRISIDLNCNNDDSEGAKITEGVNSD
ASLLGGNKNHCDNVITGF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013083Znf_RING/FYVE/PHD
IPR038654PINIT_sf
IPR036397RNaseH_sf
IPR013520Exonuclease_RNaseT/DNA_pol3
IPR004181Znf_MIZ
IPR012337RNaseH-like_sf
IPR023321PINIT
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0003676nucleic acid binding
GO:0016874ligase activity
GO:0019789SUMO transferase activity
Vocabulary: biological process
TermDefinition
GO:0016925protein sumoylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013520Exonuclease, RNase T/DNA polymerase IIISMARTSM00479exoiiienduscoord: 703..870
e-value: 0.0096
score: 1.1
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 171..303
e-value: 5.2E-28
score: 99.4
IPR038654PINIT domain superfamilyGENE3DG3DSA:2.60.120.780coord: 6..167
e-value: 1.6E-18
score: 69.2
IPR004181Zinc finger, MIZ-typePFAMPF02891zf-MIZcoord: 218..265
e-value: 2.1E-18
score: 65.8
IPR004181Zinc finger, MIZ-typePROSITEPS51044ZF_SP_RINGcoord: 206..283
score: 31.03
IPR036397Ribonuclease H superfamilyGENE3DG3DSA:3.30.420.10coord: 701..874
e-value: 1.4E-12
score: 49.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 502..525
NoneNo IPR availablePANTHERPTHR10782ZINC FINGER MIZ DOMAIN-CONTAINING PROTEINcoord: 9..531
NoneNo IPR availablePANTHERPTHR10782:SF72SUPPRESSOR OF VARIEGATION 2-10, ISOFORM Icoord: 9..531
NoneNo IPR availableCDDcd16650SP-RING_PIAS_likecoord: 218..264
e-value: 1.34982E-24
score: 95.4037
IPR023321PINIT domainPROSITEPS51466PINITcoord: 1..168
score: 16.619
IPR012337Ribonuclease H-like superfamilySUPERFAMILYSSF53098Ribonuclease H-likecoord: 704..795