Lysine specific histone demethylase 1B

Overview
NameLysine specific histone demethylase 1B
Smed IDSMED30001661
Length (bp)2516
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lysine specific histone demethylase 1B (SMED30001661) t-SNE clustered cells

Violin plots show distribution of expression levels for Lysine specific histone demethylase 1B (SMED30001661) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lysine specific histone demethylase 1B (SMED30001661) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lysine specific histone demethylase 1B (SMED30001661) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001661

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30001661SMESG000065059.1 SmedASXL_016567SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30001661SMESG000065059.1 SmedASXL_016567SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30001661SMESG000065059.1 dd_Smed_v4_4269_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001661SMESG000065059.1 dd_Smed_v4_4269_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001661SMESG000065059.1 dd_Smed_v4_4269_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001661SMESG000065059.1 dd_Smed_v4_4269_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001661SMESG000065059.1 dd_Smed_v4_4269_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001661SMESG000065059.1 dd_Smed_v4_4269_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Human
Match: KDM1B (lysine demethylase 1B [Source:HGNC Symbol;Acc:HGNC:21577])

HSP 1 Score: 75.8702 bits (185), Expect = 1.297e-35
Identity = 38/117 (32.48%), Postives = 61/117 (52.14%), Query Frame = 2
Query:   65 QKNVKYCPDPTCNNLIPICCLFLNTECSDNG--AKWYHLSAGEHVCSVCYNHLHSFFSYETENSEIITFKKTWLGQSQETPTIHDYITSTLLSNWYLCN--ECNKWRQVSRDIYLTP 403
            +K  + C    C    P+C    +  C+ NG  ++WYHLS GEH C+ C++H +   S++    +  T+KK W    +  P+   ++    L  W  C   EC KWRQ++++I LTP
Sbjct:   47 EKKYRKCEKAGCTATCPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYR--SHKDGYDKYTTWKKIWTSNGKTEPSPKAFMADQQLPYWVQCTKPECRKWRQLTKEIQLTP 161          

HSP 2 Score: 62.3882 bits (150), Expect = 1.297e-35
Identity = 82/288 (28.47%), Postives = 125/288 (43.40%), Query Frame = 1
Query:  457 CSFPEDQRIDFIRNHPASFFESIKYTVYLGTSPYLDVYDEYSLDTVGISPI------------AEPIDFDIGDCC-----EGFMKTFNPFSKESNTQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFG-FPTGLPINIF-EDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL---VENNKSVSLKLKSFDCLNEIYGSINNPFSFMSYQVYFLLIELVDFNE 1254
            CS PED R+  + NH   ++  +     L  S    +   Y  D VG+SP             A P   +           G  + F PF  + N       + P  M+  E   FP +S +   +++ LRNL+L LW  + K  +T       I +RG+V++   V  V  ++   +  G +N G    G    +  +D+  + VI+IGAG +GLAAAR L   G  VTVLE+ + +   V ++KS    +        + G INNP + M  Q   L I +  F E
Sbjct:  185 CSLPEDLRVLEVSNH--WWYSMLILPPLLKDSVAAPLLSAYYPDCVGMSPSCTSTNRAAATGNASPGKLEHSKAALSVHVPGMNRYFQPFY-QPNECGKALCVRPDVMELDELYEFPEYSRDP-TMYLALRNLILALWYTNCKEALTPQKCIPHIIVRGLVRIRC-VQEVERILYFMTRKGLINTGVLSVGADQYLLPKDYHNKSVIIIGAGPAGLAAARQLHNFGIKVTVLEAKDRIGGRVWDDKSFK-GVTVGRGAQIVNGCINNPVALMCEQ---LGISMHKFGE 463          

HSP 3 Score: 53.9138 bits (128), Expect = 1.297e-35
Identity = 82/392 (20.92%), Postives = 154/392 (39.29%), Query Frame = 2
Query: 1340 GIETREISTNISIFNEDGSIISDEVDEFYQNLVYNFVAYLMNGASIIKYSSQFA----GCSVADLYQNYRRDRINSEFAGNDG-VESIYLSEIEYRVFGGAAMETVPRNVEMSAVNRGISNFSCKQFSGSTMEPVNGWGELFTRLVDNLDIRYETKVESIGRHVDKCVVRDSNGQEYLADKVLLATAPWNAVRIKSDPDWLENREILNSKSVVDADEIRAGAGFIIVQMAFDRQNLFWRGKIPPSSSERTFAVATKSSEMRGFCHLFKESHVVDELTVLQSRIFGLAAKVCGELSEEQIIGKVLEKLSCLADRVNQSSPPRPSWYQIIR------IENASLACTDIGNAFNKLAISNRFQNEIFVTNKTMIAE-PINLSNSFCVGMDAASTI 2479
            GI   +      +  E G I    +D   + + ++F A L   +   K  +Q      G  + ++Y+ + ++    +F+  +G V   +LS +EY             N+   +      N    QF+G       G+  +  +L + LDI+ ++ V+ I    D+  V  ++G  Y A KVL+ T P   ++  +    ++    L+ K +   + + AG   II ++A      FW  K+        F     S+  RG   +F +     + +VL S I G A      L ++Q++ + +  L  L     +   P P+ Y + R      I+ A       G+      I+   Q  +F   +      P  ++ ++  G+  AS I
Sbjct:  455 GISMHKFGERCDLIQEGGRITDPTID---KRMDFHFNALLDVVSEWRKDKTQLQDVPLGEKIEEIYKAFIKES-GIQFSELEGQVLQFHLSNLEY---------ACGSNLHQVSARSWDHNEFFAQFAGDHTLLTPGYSVIIEKLAEGLDIQLKSPVQCIDYSGDEVQVTTTDGTGYSAQKVLV-TVPLALLQKGA----IQFNPPLSEKKMKAINSLGAG---IIEKIALQFPYRFWDSKV---QGADFFGHVPPSASKRGLFAVFYDMDPQKKHSVLMSVIAGEAVASVRTLDDKQVLQQCMATLREL---FKEQEVPDPTKYFVTRWSTDPWIQMAYSFVKTGGSGEAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKI 819          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Human
Match: KDM1B (lysine demethylase 1B [Source:HGNC Symbol;Acc:HGNC:21577])

HSP 1 Score: 75.8702 bits (185), Expect = 1.124e-25
Identity = 38/117 (32.48%), Postives = 61/117 (52.14%), Query Frame = 2
Query:   65 QKNVKYCPDPTCNNLIPICCLFLNTECSDNG--AKWYHLSAGEHVCSVCYNHLHSFFSYETENSEIITFKKTWLGQSQETPTIHDYITSTLLSNWYLCN--ECNKWRQVSRDIYLTP 403
            +K  + C    C    P+C    +  C+ NG  ++WYHLS GEH C+ C++H +   S++    +  T+KK W    +  P+   ++    L  W  C   EC KWRQ++++I LTP
Sbjct:   47 EKKYRKCEKAGCTATCPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYR--SHKDGYDKYTTWKKIWTSNGKTEPSPKAFMADQQLPYWVQCTKPECRKWRQLTKEIQLTP 161          

HSP 2 Score: 62.3882 bits (150), Expect = 1.124e-25
Identity = 82/288 (28.47%), Postives = 125/288 (43.40%), Query Frame = 1
Query:  457 CSFPEDQRIDFIRNHPASFFESIKYTVYLGTSPYLDVYDEYSLDTVGISPI------------AEPIDFDIGDCC-----EGFMKTFNPFSKESNTQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFG-FPTGLPINIF-EDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL---VENNKSVSLKLKSFDCLNEIYGSINNPFSFMSYQVYFLLIELVDFNE 1254
            CS PED R+  + NH   ++  +     L  S    +   Y  D VG+SP             A P   +           G  + F PF  + N       + P  M+  E   FP +S +   +++ LRNL+L LW  + K  +T       I +RG+V++   V  V  ++   +  G +N G    G    +  +D+  + VI+IGAG +GLAAAR L   G  VTVLE+ + +   V ++KS    +        + G INNP + M  Q   L I +  F E
Sbjct:  185 CSLPEDLRVLEVSNH--WWYSMLILPPLLKDSVAAPLLSAYYPDCVGMSPSCTSTNRAAATGNASPGKLEHSKAALSVHVPGMNRYFQPFY-QPNECGKALCVRPDVMELDELYEFPEYSRDP-TMYLALRNLILALWYTNCKEALTPQKCIPHIIVRGLVRIRC-VQEVERILYFMTRKGLINTGVLSVGADQYLLPKDYHNKSVIIIGAGPAGLAAARQLHNFGIKVTVLEAKDRIGGRVWDDKSFK-GVTVGRGAQIVNGCINNPVALMCEQ---LGISMHKFGE 463          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Human
Match: KDM1B (lysine demethylase 1B [Source:HGNC Symbol;Acc:HGNC:21577])

HSP 1 Score: 75.8702 bits (185), Expect = 1.576e-13
Identity = 38/117 (32.48%), Postives = 61/117 (52.14%), Query Frame = 2
Query:   65 QKNVKYCPDPTCNNLIPICCLFLNTECSDNG--AKWYHLSAGEHVCSVCYNHLHSFFSYETENSEIITFKKTWLGQSQETPTIHDYITSTLLSNWYLCN--ECNKWRQVSRDIYLTP 403
            +K  + C    C    P+C    +  C+ NG  ++WYHLS GEH C+ C++H +   S++    +  T+KK W    +  P+   ++    L  W  C   EC KWRQ++++I LTP
Sbjct:   47 EKKYRKCEKAGCTATCPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYR--SHKDGYDKYTTWKKIWTSNGKTEPSPKAFMADQQLPYWVQCTKPECRKWRQLTKEIQLTP 161          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Celegans
Match: amx-1 (Amine oxidase family member 1 [Source:UniProtKB/Swiss-Prot;Acc:Q21988])

HSP 1 Score: 62.7734 bits (151), Expect = 8.713e-10
Identity = 45/182 (24.73%), Postives = 94/182 (51.65%), Query Frame = 1
Query:  691 TQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVF-IGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFG-FPTGL-PINIFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL---VENNKSVSLKLKSFDCLNEIYGSINNPFSFMSYQV 1218
            T      + P  M+  E   FP F+ +  +++ + +RN ++ +W   P   +T  ++   I +RG  ++  + + +  +++  +  G VN+G F   + P+N     PK  + +IGAG+SG++ ARHL  LG +  + E+ +     + +++S+ + +     +  I G+INNP + +  Q+
Sbjct:  247 TDVIANIVHPEFMETDEKFAFPKFADDPISIYYLQVRNTIIAMWLKHPFVELTVKMIEPQIIVRGHARIFFIEHLIHPILEFLTIKGVVNYGAFDFRIDPLNGM--RPK--IAIIGAGISGISTARHLKHLGIDAVLFEAKDRFGGRMMDDQSLGVSVGKGAQI--IVGNINNPITLLCEQI 422          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Fly
Match: Su(var)3-3 (gene:FBgn0260397 transcript:FBtr0074826)

HSP 1 Score: 50.0618 bits (118), Expect = 9.518e-6
Identity = 48/165 (29.09%), Postives = 80/165 (48.48%), Query Frame = 1
Query:  781 VFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIK-IYSGL---GYVNFG-FPTGLPINIFEDHPKRD---VIVIGAGLSGLAAARHLSMLGANVTVLESSNSLVENNKSVSLKLKSFDC------LNEIYGSINNPFSFMSYQVYFLLI 1233
            VF+ +RN +L +W  +PK  ++  +  K         +    +S P L++ ++S L   G++NFG F    PI      P +    VIVIGAG+SGLA A  L   G +V VLE+ + +    +  + +  S+        +  +YG   NP + +S Q+   L+
Sbjct:  195 VFLNIRNSLLHMWVDNPKIQLSFEIALK--------NLPPPFDSEPSLVRRVHSFLERHGFINFGIFKRLKPI------PAKKLGKVIVIGAGISGLAVAHQLQQFGMDVIVLEARDRV--GGRISTFRKNSYIADVGAMVVTGVYG---NPMTILSKQIGMDLV 340          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Fly
Match: Su(var)3-3 (gene:FBgn0260397 transcript:FBtr0074825)

HSP 1 Score: 50.0618 bits (118), Expect = 9.518e-6
Identity = 48/165 (29.09%), Postives = 80/165 (48.48%), Query Frame = 1
Query:  781 VFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIK-IYSGL---GYVNFG-FPTGLPINIFEDHPKRD---VIVIGAGLSGLAAARHLSMLGANVTVLESSNSLVENNKSVSLKLKSFDC------LNEIYGSINNPFSFMSYQVYFLLI 1233
            VF+ +RN +L +W  +PK  ++  +  K         +    +S P L++ ++S L   G++NFG F    PI      P +    VIVIGAG+SGLA A  L   G +V VLE+ + +    +  + +  S+        +  +YG   NP + +S Q+   L+
Sbjct:  195 VFLNIRNSLLHMWVDNPKIQLSFEIALK--------NLPPPFDSEPSLVRRVHSFLERHGFINFGIFKRLKPI------PAKKLGKVIVIGAGISGLAVAHQLQQFGMDVIVLEARDRV--GGRISTFRKNSYIADVGAMVVTGVYG---NPMTILSKQIGMDLV 340          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Zebrafish
Match: kdm1a (lysine (K)-specific demethylase 1a [Source:ZFIN;Acc:ZDB-GENE-030131-7828])

HSP 1 Score: 56.225 bits (134), Expect = 1.789e-7
Identity = 39/115 (33.91%), Postives = 60/115 (52.17%), Query Frame = 1
Query:  769 NMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPTGLPINIFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL 1113
            + + VF+ +RN  L LW  +PK  +T     + +        A+LV+ +   ++ +   G++NFG      +          VIVIGAG+SGLAAAR L   G +VTVLES + +
Sbjct:  179 HTQKVFLYIRNRTLQLWLDNPKVQLTFEATVQQLEA-PYNSDAVLVHRIHSYLERH---GFINFGIYKR--VKPLPTKKTGKVIVIGAGVSGLAAARQLQSFGMDVTVLESRDRV 287          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Zebrafish
Match: kdm1a (lysine (K)-specific demethylase 1a [Source:ZFIN;Acc:ZDB-GENE-030131-7828])

HSP 1 Score: 55.8398 bits (133), Expect = 1.887e-7
Identity = 39/115 (33.91%), Postives = 60/115 (52.17%), Query Frame = 1
Query:  769 NMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPTGLPINIFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL 1113
            + + VF+ +RN  L LW  +PK  +T     + +        A+LV+ +   ++ +   G++NFG      +          VIVIGAG+SGLAAAR L   G +VTVLES + +
Sbjct:  210 HTQKVFLYIRNRTLQLWLDNPKVQLTFEATVQQLEA-PYNSDAVLVHRIHSYLERH---GFINFGIYKR--VKPLPTKKTGKVIVIGAGVSGLAAARQLQSFGMDVTVLESRDRV 318          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Xenopus
Match: mfge8 (milk fat globule-EGF factor 8 protein [Source:Xenbase;Acc:XB-GENE-853465])

HSP 1 Score: 74.7146 bits (182), Expect = 3.801e-36
Identity = 81/287 (28.22%), Postives = 131/287 (45.64%), Query Frame = 1
Query:  451 NPCSFPEDQRIDFIRNHPASFFESIKYTVYLGTSPYLDVYDEYSLDTVGISPIAE------------PIDFDIGDCCEGFMKTFNPFSK---ESNTQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPTGLPINIF--EDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL---VENNKSVS--LKLKSFDCLNEIYGSINNPFSFMSYQVYFLLIELVD 1245
            + CS PED R+  +  H  S++  +     L  SP   +   Y  D VG+SP                +D   G C   +    NP+ +   + N       + P  M+  E   FP +S +   +++ LRNL+L LW  + K  +T  + +  I +RG+V++   V  +  ++   S  G VN G  +  P      +++  + VIVIGAG +GLAAAR L   G  VTV+E+ + +   V + KS    +  K    +N   G INNP + M  Q+   + +L +
Sbjct:  170 DQCSMPEDLRVSEVSTH--SWYSMLILPPLLKDSPSATLLAAYYPDCVGMSPSCTSTNRLHREGHSGKLDQSRGYCVPSYSSGINPYFQPFYQPNECGKALCVRPDVMELDELYEFPEYSRDP-TMYLALRNLILALWHINCKEVLTPQICSHHIMVRGLVRIRC-VQEMERILYFMSRKGLVNTGVLSVSPGQYLLPKEYHNKSVIVIGAGPAGLAAARQLHNFGIKVTVVEARDRIGGRVWDEKSFKGVIVGKGAQIVN---GCINNPIAIMCEQIGIKMRKLRE 449          

HSP 2 Score: 70.0922 bits (170), Expect = 3.801e-36
Identity = 36/117 (30.77%), Postives = 59/117 (50.43%), Query Frame = 2
Query:   65 QKNVKYCPDPTCNNLIPICCLFLNTECSDNG--AKWYHLSAGEHVCSVCYNHLHSFFSYETENSEII-TFKKTWLGQSQETPTIHDYITSTLLSNWYLCN--ECNKWRQVSRDIYLT 400
            +K  + C    C    P+C       C+ NG  ++WYHLS GEH C+ C++H   ++    +  +I  ++K+ W    +  P+   Y+    L  W  C   EC KWRQ++++I LT
Sbjct:   34 EKKYRKCEKAGCTATCPVCFASAAERCAKNGYTSRWYHLSCGEHFCNECFDH---YYRSHKDGYDIYSSWKRIWTSNGKSEPSPKAYMADQQLPYWVQCTKLECGKWRQLTKEIQLT 147          

HSP 3 Score: 49.2914 bits (116), Expect = 3.801e-36
Identity = 81/389 (20.82%), Postives = 145/389 (37.28%), Query Frame = 2
Query: 1340 GIETREISTNISIFNEDGSIISDEVDEFYQNLVYNFVAYLMNGASIIKYSSQFAGCSVADLYQNYRRDRINSEFAGNDGVESIYLSEIEYRVFGGAAMETVPRNVEMSAVNRGISNFSCKQFSGSTMEPVNGWGELFTRLVDNLDIRYETKVESIGRHVDKCVVRDSNGQEYLADKVLLATAPWNAVRIKSDPDWLENREILNSKSVVDADEIRAGAGFIIVQMAFDRQNLFWRGKIPPSSSERTFAVATKSSEMRGFCHLFKESHVVDELTVLQSRIFGLAAKVCGELSEEQIIGKVLEKLSCLADRVNQSSPPRPSWYQI--------IRIENASLACTDIGNAFNKLAISNRFQNEIFVTNKTMIAE-PINLSNSFCVGMDAASTI 2479
            GI+ R++     +  E G +    +D   + + ++F A L   A   K  +Q     + D  Q      I   F    G++   + E   +   G        N+   +      N    QF+G       G+  +  +L + LDIR  T V    + V    +  ++GQ + A K L+ T P   ++  +    ++   +L  K V     + AG   +I ++A      FW  KI  +     F     +   RG   +F +     +  VL S I G A     EL ++Q++ +    +  L +   +   P P  Y +          +  + +     G A++ LA     Q +IF   +      P  +S ++  G+  AS I
Sbjct:  441 GIKMRKLREKCDLIEEGGRLTDPAID---KRMDFHFNAVLDVVAEWRKDKTQNQDAPLGDKIQE-----ICKAFTQESGIQFTDVEEKVLQFHLGNLEYACGSNLHKVSARSWDHNEFFAQFAGDHTMLGAGYSMVIDKLAEGLDIRLNTPVNYTSQEVR---ITAADGQTFTAQKALV-TVPLALLQKGA----IQFNPLLPEKKVKAIHSLGAG---VIEKIALQFPYRFWDNKIQGAD---FFGHIPPNCNKRGLFGVFYDMDPEGKHAVLMSVITGDAVTSIQELEDKQVVKQC---MVILREVFKEQEVPAPIKYFVTHWAKDPWAHMAYSFVKTGGSGEAYDILA--EDIQGKIFFAGEATNRHFPQTVSGAYLSGVREASKI 802          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Xenopus
Match: mfge8 (milk fat globule-EGF factor 8 protein [Source:Xenbase;Acc:XB-GENE-853465])

HSP 1 Score: 71.2478 bits (173), Expect = 1.920e-35
Identity = 80/287 (27.87%), Postives = 129/287 (44.95%), Query Frame = 1
Query:  451 NPCSFPEDQRIDFIRNHPASFFESIKYTVYLGTSPYLDVYDEYSLDTVGISPIAE------------PIDFDIGDCCEGFMKTFNPFSK---ESNTQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPTGLPINIF--EDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL---VENNKSVS--LKLKSFDCLNEIYGSINNPFSFMSYQVYFLLIELVD 1245
            + CS PED R+  +  H  S++  +     L  SP   +   Y  D VG+SP                +D   G          NP+ +   + N       + P  M+  E   FP +S +   +++ LRNL+L LW  + K  +T  + +  I +RG+V++   V  +  ++   S  G VN G  +  P      +++  + VIVIGAG +GLAAAR L   G  VTV+E+ + +   V + KS    +  K    +N   G INNP + M  Q+   + +L +
Sbjct:  183 DQCSMPEDLRVSEVSTH--SWYSMLILPPLLKDSPSATLLAAYYPDCVGMSPSCTSTNRLHREGHSGKLDQSRGASANAVASGINPYFQPFYQPNECGKALCVRPDVMELDELYEFPEYSRDP-TMYLALRNLILALWHINCKEVLTPQICSHHIMVRGLVRIRC-VQEMERILYFMSRKGLVNTGVLSVSPGQYLLPKEYHNKSVIVIGAGPAGLAAARQLHNFGIKVTVVEARDRIGGRVWDEKSFKGVIVGKGAQIVN---GCINNPIAIMCEQIGIKMRKLRE 462          

HSP 2 Score: 70.0922 bits (170), Expect = 1.920e-35
Identity = 36/117 (30.77%), Postives = 59/117 (50.43%), Query Frame = 2
Query:   65 QKNVKYCPDPTCNNLIPICCLFLNTECSDNG--AKWYHLSAGEHVCSVCYNHLHSFFSYETENSEII-TFKKTWLGQSQETPTIHDYITSTLLSNWYLCN--ECNKWRQVSRDIYLT 400
            +K  + C    C    P+C       C+ NG  ++WYHLS GEH C+ C++H   ++    +  +I  ++K+ W    +  P+   Y+    L  W  C   EC KWRQ++++I LT
Sbjct:   47 EKKYRKCEKAGCTATCPVCFASAAERCAKNGYTSRWYHLSCGEHFCNECFDH---YYRSHKDGYDIYSSWKRIWTSNGKSEPSPKAYMADQQLPYWVQCTKLECGKWRQLTKEIQLT 160          

HSP 3 Score: 50.0618 bits (118), Expect = 1.920e-35
Identity = 79/389 (20.31%), Postives = 146/389 (37.53%), Query Frame = 2
Query: 1340 GIETREISTNISIFNEDGSIISDEVDEFYQNLVYNFVAYLMNGASIIKYSSQFAGCSVADLYQNYRRDRINSEFAGNDGVESIYLSEIEYRVFGGAAMETVPRNVEMSAVNRGISNFSCKQFSGSTMEPVNGWGELFTRLVDNLDIRYETKVESIGRHVDKCVVRDSNGQEYLADKVLLATAPWNAVRIKSDPDWLENREILNSKSVVDADEIRAGAGFIIVQMAFDRQNLFWRGKIPPSSSERTFAVATKSSEMRGFCHLFKESHVVDELTVLQSRIFGLAAKVCGELSEEQIIGKVLEKLSCLADRVNQSSPPRPSWYQI--------IRIENASLACTDIGNAFNKLAISNRFQNEIFVTNKTMIAE-PINLSNSFCVGMDAASTI 2479
            GI+ R++     +  E G +    +D   + + ++F A L   A   K  +Q     + D  Q      I   F    G++   + E   +   G        N+   +      N    QF+G       G+  +  +L + LDIR  T + ++     +  +  ++GQ + A K L+ T P   ++  +    ++   +L  K V     + AG   +I ++A      FW  KI  +     F     +   RG   +F +     +  VL S I G A     EL ++Q++ +    +  L +   +   P P  Y +          +  + +     G A++ LA     Q +IF   +      P  +S ++  G+  AS I
Sbjct:  454 GIKMRKLREKCDLIEEGGRLTDPAID---KRMDFHFNAVLDVVAEWRKDKTQNQDAPLGDKIQE-----ICKAFTQESGIQFTDVEEKVLQFHLGNLEYACGSNLHKVSARSWDHNEFFAQFAGDHTMLGAGYSMVIDKLAEGLDIRLNTPIRNVDYTSQEVRITAADGQTFTAQKALV-TVPLALLQKGA----IQFNPLLPEKKVKAIHSLGAG---VIEKIALQFPYRFWDNKIQGAD---FFGHIPPNCNKRGLFGVFYDMDPEGKHAVLMSVITGDAVTSIQELEDKQVVKQC---MVILREVFKEQEVPAPIKYFVTHWAKDPWAHMAYSFVKTGGSGEAYDILA--EDIQGKIFFAGEATNRHFPQTVSGAYLSGVREASKI 818          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Xenopus
Match: mfge8 (milk fat globule-EGF factor 8 protein [Source:Xenbase;Acc:XB-GENE-853465])

HSP 1 Score: 70.4774 bits (171), Expect = 1.210e-34
Identity = 79/280 (28.21%), Postives = 129/280 (46.07%), Query Frame = 1
Query:  451 NPCSFPEDQRIDFIRNHPASFFESIKYTVYLGTSPYLDVYDEYSLDTVGISPIAEPI-----DFDIGDCCEGFMKTFNPFSK---ESNTQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPTGLPINIF--EDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL---VENNKSVS--LKLKSFDCLNEIYGSINNPFSFMSYQVYFLLIELVD 1245
            + CS PED R+  +  H  S++  +     L  SP   +   Y  D VG+SP          +   G   +      NP+ +   + N       + P  M+  E   FP +S +   +++ LRNL+L LW  + K  +T  + +  I +RG+V++   V  +  ++   S  G VN G  +  P      +++  + VIVIGAG +GLAAAR L   G  VTV+E+ + +   V + KS    +  K    +N   G INNP + M  Q+   + +L +
Sbjct:  164 DQCSMPEDLRVSEVSTH--SWYSMLILPPLLKDSPSATLLAAYYPDCVGMSPSCTSTNRLHREGHSGKLDQSRASGINPYFQPFYQPNECGKALCVRPDVMELDELYEFPEYSRDP-TMYLALRNLILALWHINCKEVLTPQICSHHIMVRGLVRIRC-VQEMERILYFMSRKGLVNTGVLSVSPGQYLLPKEYHNKSVIVIGAGPAGLAAARQLHNFGIKVTVVEARDRIGGRVWDEKSFKGVIVGKGAQIVN---GCINNPIAIMCEQIGIKMRKLRE 436          

HSP 2 Score: 69.707 bits (169), Expect = 1.210e-34
Identity = 36/117 (30.77%), Postives = 59/117 (50.43%), Query Frame = 2
Query:   65 QKNVKYCPDPTCNNLIPICCLFLNTECSDNG--AKWYHLSAGEHVCSVCYNHLHSFFSYETENSEII-TFKKTWLGQSQETPTIHDYITSTLLSNWYLCN--ECNKWRQVSRDIYLT 400
            +K  + C    C    P+C       C+ NG  ++WYHLS GEH C+ C++H   ++    +  +I  ++K+ W    +  P+   Y+    L  W  C   EC KWRQ++++I LT
Sbjct:   28 EKKYRKCEKAGCTATCPVCFASAAERCAKNGYTSRWYHLSCGEHFCNECFDH---YYRSHKDGYDIYSSWKRIWTSNGKSEPSPKAYMADQQLPYWVQCTKLECGKWRQLTKEIQLT 141          

HSP 3 Score: 48.521 bits (114), Expect = 1.210e-34
Identity = 81/389 (20.82%), Postives = 145/389 (37.28%), Query Frame = 2
Query: 1340 GIETREISTNISIFNEDGSIISDEVDEFYQNLVYNFVAYLMNGASIIKYSSQFAGCSVADLYQNYRRDRINSEFAGNDGVESIYLSEIEYRVFGGAAMETVPRNVEMSAVNRGISNFSCKQFSGSTMEPVNGWGELFTRLVDNLDIRYETKVESIGRHVDKCVVRDSNGQEYLADKVLLATAPWNAVRIKSDPDWLENREILNSKSVVDADEIRAGAGFIIVQMAFDRQNLFWRGKIPPSSSERTFAVATKSSEMRGFCHLFKESHVVDELTVLQSRIFGLAAKVCGELSEEQIIGKVLEKLSCLADRVNQSSPPRPSWYQI--------IRIENASLACTDIGNAFNKLAISNRFQNEIFVTNKTMIAE-PINLSNSFCVGMDAASTI 2479
            GI+ R++     +  E G +    +D   + + ++F A L   A   K  +Q     + D  Q      I   F    G++   + E   +   G        N+   +      N    QF+G       G+  +  +L + LDIR  T V    + V    +  ++GQ + A K L+ T P   ++  +    ++   +L  K V     + AG   +I ++A      FW  KI  +     F     +   RG   +F +     +  VL S I G A     EL ++Q++ +    +  L +   +   P P  Y +          +  + +     G A++ LA     Q +IF   +      P  +S ++  G+  AS I
Sbjct:  428 GIKMRKLREKCDLIEEGGRLTDPAID---KRMDFHFNAVLDVVAEWRKDKTQNQDAPLGDKIQE-----ICKAFTQESGIQFTDVEEKVLQFHLGNLEYACGSNLHKVSARSWDHNEFFAQFAGDHTMLGAGYSMVIDKLAEGLDIRLNTPVNYTSQEVR---ITAADGQTFTAQKALV-TVPLALLQKGA----IQFNPLLPEKKVKAIHSLGAG---VIEKIALQFPYRFWDNKIQGAD---FFGHIPPNCNKRGLFGVFYDMDPEGKHAVLMSVITGDAVTSIQELEDKQVVKQC---MVILREVFKEQEVPAPIKYFVTHWAKDPWAHMAYSFVKTGGSGEAYDILA--EDIQGKIFFAGEATNRHFPQTVSGAYLSGVREASKI 789          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Xenopus
Match: mfge8 (milk fat globule-EGF factor 8 protein [Source:Xenbase;Acc:XB-GENE-853465])

HSP 1 Score: 70.4774 bits (171), Expect = 1.240e-34
Identity = 79/280 (28.21%), Postives = 129/280 (46.07%), Query Frame = 1
Query:  451 NPCSFPEDQRIDFIRNHPASFFESIKYTVYLGTSPYLDVYDEYSLDTVGISPIAEPI-----DFDIGDCCEGFMKTFNPFSK---ESNTQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPTGLPINIF--EDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL---VENNKSVS--LKLKSFDCLNEIYGSINNPFSFMSYQVYFLLIELVD 1245
            + CS PED R+  +  H  S++  +     L  SP   +   Y  D VG+SP          +   G   +      NP+ +   + N       + P  M+  E   FP +S +   +++ LRNL+L LW  + K  +T  + +  I +RG+V++   V  +  ++   S  G VN G  +  P      +++  + VIVIGAG +GLAAAR L   G  VTV+E+ + +   V + KS    +  K    +N   G INNP + M  Q+   + +L +
Sbjct:  176 DQCSMPEDLRVSEVSTH--SWYSMLILPPLLKDSPSATLLAAYYPDCVGMSPSCTSTNRLHREGHSGKLDQSRASGINPYFQPFYQPNECGKALCVRPDVMELDELYEFPEYSRDP-TMYLALRNLILALWHINCKEVLTPQICSHHIMVRGLVRIRC-VQEMERILYFMSRKGLVNTGVLSVSPGQYLLPKEYHNKSVIVIGAGPAGLAAARQLHNFGIKVTVVEARDRIGGRVWDEKSFKGVIVGKGAQIVN---GCINNPIAIMCEQIGIKMRKLRE 448          

HSP 2 Score: 69.707 bits (169), Expect = 1.240e-34
Identity = 36/117 (30.77%), Postives = 59/117 (50.43%), Query Frame = 2
Query:   65 QKNVKYCPDPTCNNLIPICCLFLNTECSDNG--AKWYHLSAGEHVCSVCYNHLHSFFSYETENSEII-TFKKTWLGQSQETPTIHDYITSTLLSNWYLCN--ECNKWRQVSRDIYLT 400
            +K  + C    C    P+C       C+ NG  ++WYHLS GEH C+ C++H   ++    +  +I  ++K+ W    +  P+   Y+    L  W  C   EC KWRQ++++I LT
Sbjct:   40 EKKYRKCEKAGCTATCPVCFASAAERCAKNGYTSRWYHLSCGEHFCNECFDH---YYRSHKDGYDIYSSWKRIWTSNGKSEPSPKAYMADQQLPYWVQCTKLECGKWRQLTKEIQLT 153          

HSP 3 Score: 48.521 bits (114), Expect = 1.240e-34
Identity = 81/389 (20.82%), Postives = 145/389 (37.28%), Query Frame = 2
Query: 1340 GIETREISTNISIFNEDGSIISDEVDEFYQNLVYNFVAYLMNGASIIKYSSQFAGCSVADLYQNYRRDRINSEFAGNDGVESIYLSEIEYRVFGGAAMETVPRNVEMSAVNRGISNFSCKQFSGSTMEPVNGWGELFTRLVDNLDIRYETKVESIGRHVDKCVVRDSNGQEYLADKVLLATAPWNAVRIKSDPDWLENREILNSKSVVDADEIRAGAGFIIVQMAFDRQNLFWRGKIPPSSSERTFAVATKSSEMRGFCHLFKESHVVDELTVLQSRIFGLAAKVCGELSEEQIIGKVLEKLSCLADRVNQSSPPRPSWYQI--------IRIENASLACTDIGNAFNKLAISNRFQNEIFVTNKTMIAE-PINLSNSFCVGMDAASTI 2479
            GI+ R++     +  E G +    +D   + + ++F A L   A   K  +Q     + D  Q      I   F    G++   + E   +   G        N+   +      N    QF+G       G+  +  +L + LDIR  T V    + V    +  ++GQ + A K L+ T P   ++  +    ++   +L  K V     + AG   +I ++A      FW  KI  +     F     +   RG   +F +     +  VL S I G A     EL ++Q++ +    +  L +   +   P P  Y +          +  + +     G A++ LA     Q +IF   +      P  +S ++  G+  AS I
Sbjct:  440 GIKMRKLREKCDLIEEGGRLTDPAID---KRMDFHFNAVLDVVAEWRKDKTQNQDAPLGDKIQE-----ICKAFTQESGIQFTDVEEKVLQFHLGNLEYACGSNLHKVSARSWDHNEFFAQFAGDHTMLGAGYSMVIDKLAEGLDIRLNTPVNYTSQEVR---ITAADGQTFTAQKALV-TVPLALLQKGA----IQFNPLLPEKKVKAIHSLGAG---VIEKIALQFPYRFWDNKIQGAD---FFGHIPPNCNKRGLFGVFYDMDPEGKHAVLMSVITGDAVTSIQELEDKQVVKQC---MVILREVFKEQEVPAPIKYFVTHWAKDPWAHMAYSFVKTGGSGEAYDILA--EDIQGKIFFAGEATNRHFPQTVSGAYLSGVREASKI 801          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Xenopus
Match: mfge8 (milk fat globule-EGF factor 8 protein [Source:Xenbase;Acc:XB-GENE-853465])

HSP 1 Score: 70.0922 bits (170), Expect = 6.280e-31
Identity = 36/117 (30.77%), Postives = 59/117 (50.43%), Query Frame = 2
Query:   65 QKNVKYCPDPTCNNLIPICCLFLNTECSDNG--AKWYHLSAGEHVCSVCYNHLHSFFSYETENSEII-TFKKTWLGQSQETPTIHDYITSTLLSNWYLCN--ECNKWRQVSRDIYLT 400
            +K  + C    C    P+C       C+ NG  ++WYHLS GEH C+ C++H   ++    +  +I  ++K+ W    +  P+   Y+    L  W  C   EC KWRQ++++I LT
Sbjct:   28 EKKYRKCEKAGCTATCPVCFASAAERCAKNGYTSRWYHLSCGEHFCNECFDH---YYRSHKDGYDIYSSWKRIWTSNGKSEPSPKAYMADQQLPYWVQCTKLECGKWRQLTKEIQLT 141          

HSP 2 Score: 57.3806 bits (137), Expect = 6.280e-31
Identity = 68/278 (24.46%), Postives = 114/278 (41.01%), Query Frame = 1
Query:  451 NPCSFPEDQRIDFIRNHPASFFESIKYTVYLGTSPYLDVYDEYSLDTVGISPIAEPI-----DFDIGDCCEGFMKTFNPFSK---ESNTQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPTGLPINIFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL---VENNKSVS--LKLKSFDCLNEIYGSINNPFSFMSYQVYFLLIELVD 1245
            + CS PED R+  +  H  S++  +     L  SP   +   Y  D VG+SP          +   G   +      NP+ +   + N       + P  M+  E   FP +S +   +++ LRNL+L LW  + K  +T  + +  I +RG+V++   V  +  ++   S  G VN G                 V+ +  G   L    H      NVTV+E+ + +   V + KS    +  K    +N   G INNP + M  Q+   + +L +
Sbjct:  164 DQCSMPEDLRVSEVSTH--SWYSMLILPPLLKDSPSATLLAAYYPDCVGMSPSCTSTNRLHREGHSGKLDQSRASGINPYFQPFYQPNECGKALCVRPDVMELDELYEFPEYSRDP-TMYLALRNLILALWHINCKEVLTPQICSHHIMVRGLVRIR-CVQEMERILYFMSRKGLVNTG-----------------VLSVSPGQYLLPKEYH------NVTVVEARDRIGGRVWDEKSFKGVIVGKGAQIVN---GCINNPIAIMCEQIGIKMRKLRE 411          

HSP 3 Score: 48.9062 bits (115), Expect = 6.280e-31
Identity = 81/389 (20.82%), Postives = 145/389 (37.28%), Query Frame = 2
Query: 1340 GIETREISTNISIFNEDGSIISDEVDEFYQNLVYNFVAYLMNGASIIKYSSQFAGCSVADLYQNYRRDRINSEFAGNDGVESIYLSEIEYRVFGGAAMETVPRNVEMSAVNRGISNFSCKQFSGSTMEPVNGWGELFTRLVDNLDIRYETKVESIGRHVDKCVVRDSNGQEYLADKVLLATAPWNAVRIKSDPDWLENREILNSKSVVDADEIRAGAGFIIVQMAFDRQNLFWRGKIPPSSSERTFAVATKSSEMRGFCHLFKESHVVDELTVLQSRIFGLAAKVCGELSEEQIIGKVLEKLSCLADRVNQSSPPRPSWYQI--------IRIENASLACTDIGNAFNKLAISNRFQNEIFVTNKTMIAE-PINLSNSFCVGMDAASTI 2479
            GI+ R++     +  E G +    +D   + + ++F A L   A   K  +Q     + D  Q      I   F    G++   + E   +   G        N+   +      N    QF+G       G+  +  +L + LDIR  T V    + V    +  ++GQ + A K L+ T P   ++  +    ++   +L  K V     + AG   +I ++A      FW  KI  +     F     +   RG   +F +     +  VL S I G A     EL ++Q++ +    +  L +   +   P P  Y +          +  + +     G A++ LA     Q +IF   +      P  +S ++  G+  AS I
Sbjct:  403 GIKMRKLREKCDLIEEGGRLTDPAID---KRMDFHFNAVLDVVAEWRKDKTQNQDAPLGDKIQE-----ICKAFTQESGIQFTDVEEKVLQFHLGNLEYACGSNLHKVSARSWDHNEFFAQFAGDHTMLGAGYSMVIDKLAEGLDIRLNTPVNYTSQEVR---ITAADGQTFTAQKALV-TVPLALLQKGA----IQFNPLLPEKKVKAIHSLGAG---VIEKIALQFPYRFWDNKIQGAD---FFGHIPPNCNKRGLFGVFYDMDPEGKHAVLMSVITGDAVTSIQELEDKQVVKQC---MVILREVFKEQEVPAPIKYFVTHWAKDPWAHMAYSFVKTGGSGEAYDILA--EDIQGKIFFAGEATNRHFPQTVSGAYLSGVREASKI 764          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Mouse
Match: Kdm1b (lysine (K)-specific demethylase 1B [Source:MGI Symbol;Acc:MGI:2145261])

HSP 1 Score: 74.3294 bits (181), Expect = 7.077e-37
Identity = 39/132 (29.55%), Postives = 65/132 (49.24%), Query Frame = 2
Query:   59 TKQKNVKYCPDPTCNNLIPICCLFLNTECSDNG--AKWYHLSAGEHVCSVCYNHLHSFFSYETENSEIITFKKTWLGQSQETPTIHDYITSTLLSNWYLCN--ECNKWRQVSRDIYLTPSEISNSHVKLCYR 442
            + +K  + C    C    P+C    +  C+ NG  ++WYHLS GEH C+ C++H +   S++    +   +K+ W    +  P+   ++    L  W  C   EC KWRQ++++I LTP      H+   YR
Sbjct:   45 SSEKKYRKCEKAGCTAAYPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYR--SHKDGYDKYSAWKRVWTSNGKTEPSPKAFMADQQLPYWVQCTKPECGKWRQLTKEIQLTP------HMARTYR 168          

HSP 2 Score: 60.8474 bits (146), Expect = 7.077e-37
Identity = 84/391 (21.48%), Postives = 165/391 (42.20%), Query Frame = 2
Query: 1340 GIETREISTNISIFNEDGSIISDEVD---EFYQNLVYNFVAYLMNGASIIKYSSQFAGCSVADLYQNYRRDRINSEFAGNDG-VESIYLSEIEYRVFGGAAMETVPRNVEMSAVNRGISNFSCKQFSGSTMEPVNGWGELFTRLVDNLDIRYETKVESIGRHVDKCVVRDSNGQEYLADKVLLATAPWNAVRIKSDPDWLENREILNSKSVVDADEIRAGAGFIIVQMAFDRQNLFWRGKIPPSSSERTFAVATKSSEMRGFCHLFKESHVVDELTVLQSRIFGLAAKVCGELSEEQIIGKVLEKLSCLADRVNQSSPPRPSWYQIIR------IENASLACTDIGNAFNKLAISNRFQNEIFVTNKTMIAE-PINLSNSFCVGMDAASTI 2479
            GI  R++     +  E G I    VD   +F+ N + + V+      ++++      G  + ++Y+ + ++    +F+  +G V   +LS +EY    G+++  V      SA +   + F   QF+G       G+  +  +L + LDIR ++ V+SI    D+  V  ++G  + A KVL+ T P   ++  +    ++    L+ K +   + + AG   II ++A      FW  K+        F     S+  RG   +F +  +  + +VL S I G A      + ++Q++ +    +  L +   +   P P+ Y + R      I+ A       G+      I+   Q  +F   +      P  ++ ++  G+  AS I
Sbjct:  461 GISMRKLGERCDLIQEGGRITDPTVDKRMDFHFNALLDVVSEWRKDKTLLQDVP--LGEKIEEIYRAFVKES-GIQFSELEGQVLQFHLSNLEYAC--GSSLHQV------SARSWDHNEFFA-QFAGDHTLLTPGYSTIIEKLAEGLDIRLKSPVQSIDYTGDEVQVTTTDGMGHSAQKVLV-TVPLAILQRGA----IQFNPPLSEKKMKAINSLGAG---IIEKIALQFPYRFWDSKV---QGADFFGHVPPSASQRGLFAVFYD--MDSQQSVLMSVITGEAVASLRTMDDKQVLQQC---MGILRELFKEQEIPEPTKYFVTRWSTEPWIQMAYSFVKTFGSGEAYDIIAEEIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKI 823          

HSP 3 Score: 60.4622 bits (145), Expect = 7.077e-37
Identity = 79/284 (27.82%), Postives = 122/284 (42.96%), Query Frame = 1
Query:  457 CSFPEDQRIDFIRNHPASFFESIKYTVYLGTSPYLDVYDEYSLDTVGISPIA-----------------------EPIDFDIGDCCEGFMKTFNPFSKESNTQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPT-GLPINIFEDH-PKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL---VENNKSVS--LKLKSFDCLNEIYGSINNPFSFMSYQV 1218
            CSFPED R+  + NH   ++  +     L  S    +   Y  D VG+SP                         EP          G  + F PF  + N       + P  M+  E   FP +S +   +++ LRNL+L LW  + K  +T       I +RG+V++   V  V  ++   +  G +N G  T     ++   H   + V+V+GAG +GLAAAR L   G  VTVLE+ + +   V ++KS    +  +    +N   G INNP + M  Q+
Sbjct:  185 CSFPEDLRVLEVSNH--WWYPMLIQPPLLKDSVAAPLLSAYYPDCVGMSPSCTSTHRATVTAATTTTGSASPGEMEPSKAAPSSLVLGMNRYFQPFY-QPNECGKALCVRPDVMELDELYEFPEYSRDP-TMYLALRNLILALWYTNCKEALTPQKCIPHIIVRGLVRIRC-VQEVERILYFMTRKGLINTGVLTVAAGQHLLPKHYHNKSVLVVGAGPAGLAAARQLHNFGMKVTVLEAKDRIGGRVWDDKSFKGVVVGRGPQIVN---GCINNPVALMCEQL 460          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Mouse
Match: Kdm1b (lysine (K)-specific demethylase 1B [Source:MGI Symbol;Acc:MGI:2145261])

HSP 1 Score: 75.485 bits (184), Expect = 2.876e-15
Identity = 39/132 (29.55%), Postives = 65/132 (49.24%), Query Frame = 2
Query:   59 TKQKNVKYCPDPTCNNLIPICCLFLNTECSDNG--AKWYHLSAGEHVCSVCYNHLHSFFSYETENSEIITFKKTWLGQSQETPTIHDYITSTLLSNWYLCN--ECNKWRQVSRDIYLTPSEISNSHVKLCYR 442
            + +K  + C    C    P+C    +  C+ NG  ++WYHLS GEH C+ C++H   + S++    +   +K+ W    +  P+   ++    L  W  C   EC KWRQ++++I LTP      H+   YR
Sbjct:   45 SSEKKYRKCEKAGCTAAYPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHY--YRSHKDGYDKYSAWKRVWTSNGKTEPSPKAFMADQQLPYWVQCTKPECGKWRQLTKEIQLTP------HMARTYR 168          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Mouse
Match: Kdm1b (lysine (K)-specific demethylase 1B [Source:MGI Symbol;Acc:MGI:2145261])

HSP 1 Score: 51.9878 bits (123), Expect = 2.426e-6
Identity = 60/189 (31.75%), Postives = 93/189 (49.21%), Query Frame = 1
Query:  712 IDPTGMDKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPT-GLPINIFEDH-PKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL---VENNKSVS--LKLKSFDCLNEIYGSINNPFSFMSYQVYFLLIELVDFNEF 1257
            + P  M+  E   FP +S +   +++ LRNL+L LW  + K  +T       I +RG+V++   V  V  ++   +  G +N G  T     ++   H   + V+V+GAG +GLAAAR L   G  VTVLE+ + +   V ++KS    +  +    +N   G INNP + M  QV        D NEF
Sbjct:    7 VRPDVMELDELYEFPEYSRD-PTMYLALRNLILALWYTNCKEALTPQKCIPHIIVRGLVRIRC-VQEVERILYFMTRKGLINTGVLTVAAGQHLLPKHYHNKSVLVVGAGPAGLAAARQLHNFGMKVTVLEAKDRIGGRVWDDKSFKGVVVGRGPQIVN---GCINNPVALMCEQVS---ARSWDHNEF 187          
BLAST of Lysine specific histone demethylase 1B vs. UniProt/SwissProt
Match: sp|Q8CIG3|KDM1B_MOUSE (Lysine-specific histone demethylase 1B OS=Mus musculus OX=10090 GN=Kdm1b PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 4.308e-36
Identity = 39/132 (29.55%), Postives = 65/132 (49.24%), Query Frame = 2
Query:   59 TKQKNVKYCPDPTCNNLIPICCLFLNTECSDNG--AKWYHLSAGEHVCSVCYNHLHSFFSYETENSEIITFKKTWLGQSQETPTIHDYITSTLLSNWYLCN--ECNKWRQVSRDIYLTPSEISNSHVKLCYR 442
            + +K  + C    C    P+C    +  C+ NG  ++WYHLS GEH C+ C++H +   S++    +   +K+ W    +  P+   ++    L  W  C   EC KWRQ++++I LTP      H+   YR
Sbjct:   45 SSEKKYRKCEKAGCTAAYPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYR--SHKDGYDKYSAWKRVWTSNGKTEPSPKAFMADQQLPYWVQCTKPECGKWRQLTKEIQLTP------HMARTYR 168          

HSP 2 Score: 60.8474 bits (146), Expect = 4.308e-36
Identity = 84/391 (21.48%), Postives = 165/391 (42.20%), Query Frame = 2
Query: 1340 GIETREISTNISIFNEDGSIISDEVD---EFYQNLVYNFVAYLMNGASIIKYSSQFAGCSVADLYQNYRRDRINSEFAGNDG-VESIYLSEIEYRVFGGAAMETVPRNVEMSAVNRGISNFSCKQFSGSTMEPVNGWGELFTRLVDNLDIRYETKVESIGRHVDKCVVRDSNGQEYLADKVLLATAPWNAVRIKSDPDWLENREILNSKSVVDADEIRAGAGFIIVQMAFDRQNLFWRGKIPPSSSERTFAVATKSSEMRGFCHLFKESHVVDELTVLQSRIFGLAAKVCGELSEEQIIGKVLEKLSCLADRVNQSSPPRPSWYQIIR------IENASLACTDIGNAFNKLAISNRFQNEIFVTNKTMIAE-PINLSNSFCVGMDAASTI 2479
            GI  R++     +  E G I    VD   +F+ N + + V+      ++++      G  + ++Y+ + ++    +F+  +G V   +LS +EY    G+++  V      SA +   + F   QF+G       G+  +  +L + LDIR ++ V+SI    D+  V  ++G  + A KVL+ T P   ++  +    ++    L+ K +   + + AG   II ++A      FW  K+        F     S+  RG   +F +  +  + +VL S I G A      + ++Q++ +    +  L +   +   P P+ Y + R      I+ A       G+      I+   Q  +F   +      P  ++ ++  G+  AS I
Sbjct:  461 GISMRKLGERCDLIQEGGRITDPTVDKRMDFHFNALLDVVSEWRKDKTLLQDVP--LGEKIEEIYRAFVKES-GIQFSELEGQVLQFHLSNLEYAC--GSSLHQV------SARSWDHNEFFA-QFAGDHTLLTPGYSTIIEKLAEGLDIRLKSPVQSIDYTGDEVQVTTTDGMGHSAQKVLV-TVPLAILQRGA----IQFNPPLSEKKMKAINSLGAG---IIEKIALQFPYRFWDSKV---QGADFFGHVPPSASQRGLFAVFYD--MDSQQSVLMSVITGEAVASLRTMDDKQVLQQC---MGILRELFKEQEIPEPTKYFVTRWSTEPWIQMAYSFVKTFGSGEAYDIIAEEIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKI 823          

HSP 3 Score: 60.4622 bits (145), Expect = 4.308e-36
Identity = 79/284 (27.82%), Postives = 122/284 (42.96%), Query Frame = 1
Query:  457 CSFPEDQRIDFIRNHPASFFESIKYTVYLGTSPYLDVYDEYSLDTVGISPIA-----------------------EPIDFDIGDCCEGFMKTFNPFSKESNTQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPT-GLPINIFEDH-PKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL---VENNKSVS--LKLKSFDCLNEIYGSINNPFSFMSYQV 1218
            CSFPED R+  + NH   ++  +     L  S    +   Y  D VG+SP                         EP          G  + F PF  + N       + P  M+  E   FP +S +   +++ LRNL+L LW  + K  +T       I +RG+V++   V  V  ++   +  G +N G  T     ++   H   + V+V+GAG +GLAAAR L   G  VTVLE+ + +   V ++KS    +  +    +N   G INNP + M  Q+
Sbjct:  185 CSFPEDLRVLEVSNH--WWYPMLIQPPLLKDSVAAPLLSAYYPDCVGMSPSCTSTHRATVTAATTTTGSASPGEMEPSKAAPSSLVLGMNRYFQPFY-QPNECGKALCVRPDVMELDELYEFPEYSRDP-TMYLALRNLILALWYTNCKEALTPQKCIPHIIVRGLVRIRC-VQEVERILYFMTRKGLINTGVLTVAAGQHLLPKHYHNKSVLVVGAGPAGLAAARQLHNFGMKVTVLEAKDRIGGRVWDDKSFKGVVVGRGPQIVN---GCINNPVALMCEQL 460          
BLAST of Lysine specific histone demethylase 1B vs. UniProt/SwissProt
Match: sp|Q8NB78|KDM1B_HUMAN (Lysine-specific histone demethylase 1B OS=Homo sapiens OX=9606 GN=KDM1B PE=1 SV=3)

HSP 1 Score: 75.8702 bits (185), Expect = 5.719e-35
Identity = 38/117 (32.48%), Postives = 61/117 (52.14%), Query Frame = 2
Query:   65 QKNVKYCPDPTCNNLIPICCLFLNTECSDNG--AKWYHLSAGEHVCSVCYNHLHSFFSYETENSEIITFKKTWLGQSQETPTIHDYITSTLLSNWYLCN--ECNKWRQVSRDIYLTP 403
            +K  + C    C    P+C    +  C+ NG  ++WYHLS GEH C+ C++H +   S++    +  T+KK W    +  P+   ++    L  W  C   EC KWRQ++++I LTP
Sbjct:   47 EKKYRKCEKAGCTATCPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYR--SHKDGYDKYTTWKKIWTSNGKTEPSPKAFMADQQLPYWVQCTKPECRKWRQLTKEIQLTP 161          

HSP 2 Score: 62.3882 bits (150), Expect = 5.719e-35
Identity = 82/288 (28.47%), Postives = 125/288 (43.40%), Query Frame = 1
Query:  457 CSFPEDQRIDFIRNHPASFFESIKYTVYLGTSPYLDVYDEYSLDTVGISPI------------AEPIDFDIGDCC-----EGFMKTFNPFSKESNTQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFG-FPTGLPINIF-EDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL---VENNKSVSLKLKSFDCLNEIYGSINNPFSFMSYQVYFLLIELVDFNE 1254
            CS PED R+  + NH   ++  +     L  S    +   Y  D VG+SP             A P   +           G  + F PF  + N       + P  M+  E   FP +S +   +++ LRNL+L LW  + K  +T       I +RG+V++   V  V  ++   +  G +N G    G    +  +D+  + VI+IGAG +GLAAAR L   G  VTVLE+ + +   V ++KS    +        + G INNP + M  Q   L I +  F E
Sbjct:  185 CSLPEDLRVLEVSNH--WWYSMLILPPLLKDSVAAPLLSAYYPDCVGMSPSCTSTNRAAATGNASPGKLEHSKAALSVHVPGMNRYFQPFY-QPNECGKALCVRPDVMELDELYEFPEYSRDP-TMYLALRNLILALWYTNCKEALTPQKCIPHIIVRGLVRIRC-VQEVERILYFMTRKGLINTGVLSVGADQYLLPKDYHNKSVIIIGAGPAGLAAARQLHNFGIKVTVLEAKDRIGGRVWDDKSFK-GVTVGRGAQIVNGCINNPVALMCEQ---LGISMHKFGE 463          

HSP 3 Score: 53.9138 bits (128), Expect = 5.719e-35
Identity = 82/392 (20.92%), Postives = 154/392 (39.29%), Query Frame = 2
Query: 1340 GIETREISTNISIFNEDGSIISDEVDEFYQNLVYNFVAYLMNGASIIKYSSQFA----GCSVADLYQNYRRDRINSEFAGNDG-VESIYLSEIEYRVFGGAAMETVPRNVEMSAVNRGISNFSCKQFSGSTMEPVNGWGELFTRLVDNLDIRYETKVESIGRHVDKCVVRDSNGQEYLADKVLLATAPWNAVRIKSDPDWLENREILNSKSVVDADEIRAGAGFIIVQMAFDRQNLFWRGKIPPSSSERTFAVATKSSEMRGFCHLFKESHVVDELTVLQSRIFGLAAKVCGELSEEQIIGKVLEKLSCLADRVNQSSPPRPSWYQIIR------IENASLACTDIGNAFNKLAISNRFQNEIFVTNKTMIAE-PINLSNSFCVGMDAASTI 2479
            GI   +      +  E G I    +D   + + ++F A L   +   K  +Q      G  + ++Y+ + ++    +F+  +G V   +LS +EY             N+   +      N    QF+G       G+  +  +L + LDI+ ++ V+ I    D+  V  ++G  Y A KVL+ T P   ++  +    ++    L+ K +   + + AG   II ++A      FW  K+        F     S+  RG   +F +     + +VL S I G A      L ++Q++ + +  L  L     +   P P+ Y + R      I+ A       G+      I+   Q  +F   +      P  ++ ++  G+  AS I
Sbjct:  455 GISMHKFGERCDLIQEGGRITDPTID---KRMDFHFNALLDVVSEWRKDKTQLQDVPLGEKIEEIYKAFIKES-GIQFSELEGQVLQFHLSNLEY---------ACGSNLHQVSARSWDHNEFFAQFAGDHTLLTPGYSVIIEKLAEGLDIQLKSPVQCIDYSGDEVQVTTTDGTGYSAQKVLV-TVPLALLQKGA----IQFNPPLSEKKMKAINSLGAG---IIEKIALQFPYRFWDSKV---QGADFFGHVPPSASKRGLFAVFYDMDPQKKHSVLMSVIAGEAVASVRTLDDKQVLQQCMATLREL---FKEQEVPDPTKYFVTRWSTDPWIQMAYSFVKTGGSGEAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKI 819          
BLAST of Lysine specific histone demethylase 1B vs. UniProt/SwissProt
Match: sp|Q21988|AMX1_CAEEL (Amine oxidase family member 1 OS=Caenorhabditis elegans OX=6239 GN=amx-1 PE=3 SV=3)

HSP 1 Score: 62.7734 bits (151), Expect = 1.108e-8
Identity = 45/182 (24.73%), Postives = 94/182 (51.65%), Query Frame = 1
Query:  691 TQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVF-IGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFG-FPTGL-PINIFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL---VENNKSVSLKLKSFDCLNEIYGSINNPFSFMSYQV 1218
            T      + P  M+  E   FP F+ +  +++ + +RN ++ +W   P   +T  ++   I +RG  ++  + + +  +++  +  G VN+G F   + P+N     PK  + +IGAG+SG++ ARHL  LG +  + E+ +     + +++S+ + +     +  I G+INNP + +  Q+
Sbjct:  247 TDVIANIVHPEFMETDEKFAFPKFADDPISIYYLQVRNTIIAMWLKHPFVELTVKMIEPQIIVRGHARIFFIEHLIHPILEFLTIKGVVNYGAFDFRIDPLNGM--RPK--IAIIGAGISGISTARHLKHLGIDAVLFEAKDRFGGRMMDDQSLGVSVGKGAQI--IVGNINNPITLLCEQI 422          
BLAST of Lysine specific histone demethylase 1B vs. UniProt/SwissProt
Match: sp|Q9CAE3|FLD_ARATH (Protein FLOWERING LOCUS D OS=Arabidopsis thaliana OX=3702 GN=FLD PE=1 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 9.169e-7
Identity = 49/178 (27.53%), Postives = 81/178 (45.51%), Query Frame = 1
Query:  730 DKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVK-VALLVNSVPDLIKIYSGLGYVNFGFPTGLPINIFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSLVENNKSVSLKLKSFDCLNEIYGSI-----NNPFSFMSYQVYFLLIELVD 1245
            ++ E+   P   G  +  +I +RN ++  W     R   SS +TK + +  I K  + L++S  + +  +   GY+NFG    +         K  VI++GAGLSGLAAAR L   G  VTVLE          +  ++        ++ GS+      NP   ++ Q+   L ++ D
Sbjct:   99 EEIEFGVVPIVGGIEQVNYILIRNHIISKW-----RENISSWVTKEMFLNSIPKHCSSLLDSAYNYLVTH---GYINFGIAQAIKDKFPAQSSKSSVIIVGAGLSGLAAARQLMRFGFKVTVLEGRKRPGGRVYTKKMEANRVGAAADLGGSVLTGTLGNPLGIIARQLGSSLYKVRD 268          
BLAST of Lysine specific histone demethylase 1B vs. TrEMBL
Match: A0A0B7ACG4 (Amine oxidase OS=Arion vulgaris OX=1028688 GN=ORF105873 PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.161e-40
Identity = 71/255 (27.84%), Postives = 121/255 (47.45%), Query Frame = 1
Query:  457 CSFPEDQRIDFIRNHPASFFESIKYTVYLGTSPYLDVYDEYSLDTVGISPIAEPIDFDIGDCCEGFMKTFNPFSKESNTQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPTGLPINIFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSLVENNKSVSLKLKSFDCLNEIY-GSINNPFSFMSYQV 1218
            CS PED+R+ ++R+ P    ++ K T +L  SP       Y  D VG+SP  +P++    D  +       PF K  +      ++ P  M   E + FP  +     +++ +RNL+L LW  +PK  +T     + I  RG+ +V+  ++ +P ++   +   ++N G  T  P      H +  VIV+GAG SG+ AA  L   G  VTVLE+ + L      + +         ++  G  NNP + +++Q 
Sbjct:  162 CSIPEDERVHYVRS-PLWLVQN-KCTPFLKKSPAAPFLTSYYADGVGLSPTEDPVELSKEDK-KKLCPYVVPFLK-GDYPLHAFTVMPDMMLDMEIDSFPLIAQECPYLYLAMRNLILALWALNPKEWVTQEKCMRHIICRGLPRVS-CIDILPQILSALTYHNFINQGLVT--PPASLRCHTQESVIVVGAGASGVGAAHLLHSHGVQVTVLEAKSMLGGRVNDIEINGAVISTSGQLLNGCANNPIAIIAFQA 409          

HSP 2 Score: 71.2478 bits (173), Expect = 1.161e-40
Identity = 36/116 (31.03%), Postives = 61/116 (52.59%), Query Frame = 2
Query:   77 KYCPDPTCNNLIPICCLFLNTECSDNG--AKWYHLSAGEHVCSVCYNHLHSFFSYETENSEIITFKKTWLGQSQETPTIHDYITSTLLSNWYLCNE--CNKWRQVSRDIYLTPSEI 412
            + C    C   +PIC   ++  C+ +G  ++WYHL+ GEH C+ C+ + +   S++    E   +K+ W  +++    I  ++   +L  W  C    C KWRQ+SRD+ LTP  I
Sbjct:   27 RKCERSGCTATVPICFARVSDRCTGSGWTSRWYHLTLGEHYCNECFEYYYR--SHKDGYKEYDQWKREWSAKARTEAGISPFMVEQILPYWVQCKAVGCGKWRQLSRDLNLTPEFI 140          

HSP 3 Score: 68.9366 bits (167), Expect = 1.161e-40
Identity = 91/403 (22.58%), Postives = 167/403 (41.44%), Query Frame = 2
Query: 1337 CGIETREISTNISIFNEDGSIISDEVD---EFYQNLVYNFVAY------LMNGASIIKYSSQFAGCSVADLYQNYRRDRINSEFAGNDGVESIYLSEIEYRVFGGAAMETVPRNVEMSAVNRGISNFSCKQFSGSTMEPVNGWGELFTRLVDNLDIRYETKVESIGRHVDKCVVRDSNGQEYLADKVLLATAPWNAVR---IKSDPDWLENR-EILNSKSVVDADEIRAGAGFIIVQMAFDRQNLFWRGKIPPSSSERTFAVATKSSEMRGFCHLFKESHVVDELT-VLQSRIFGLAAKVCGELSEEQIIGKVLEKLSCLADRVNQSSPPRPSWYQII---RIENASLACTDI---GNAFNKLAISNRFQNEI-FVTNKTMIAEPINLSNSFCVGMDAASTII 2482
             GI+  E      + N+ G ++ D++D   EF+ N + + V+       +     +I+   +F    V +    + +   + E    + V   YLS +EY    G ++       ++S+++    N    QF GSTM    G+G + ++L + LD+RY  +V  I  +    +V  + G  + ADKV++ T P + ++   +   P   + + + +NS  V   ++       +I+Q  FD    FW  KI   + +R F     S   RG  + F  S         L + I G   K     SEEQI+   ++ L  +    N    P P W  +    + +   +A + I       N   I++  + ++ F    T    P  ++ ++  G+  A  II
Sbjct:  409 AGIDIEEQKNTCQLVNQHGQLVDDKIDRRMEFHYNAILDIVSEWRKNKTIQQDVPLIQKVKEFHEEFVTETQGYFSQGLFSQE---EEQVMDFYLSNLEYSC--GCSLS------QLSSLHWD-QNEEMPQFGGSTMTIPQGYGSILSKLAEGLDVRYSCQVTDINYNGSSVIVNTTTG-SFTADKVIV-TLPLSVLKSHSVTFHPHLPQAKLKAINSLGVGHVEK-------VILQ--FDEN--FWSEKI---TGQRLFGQVPASESQRGLFNTFYPSSCTKSGKHTLSTYIVGHGLKQMAGQSEEQIVQACMQVLKTIFPEKNI---PAPVWSHVTNWSKDKYVGIAYSYIPVGAEGVNYDLIADNIEEKVYFAGEATNRQFPQTVTGAYLSGVREARKII 780          
BLAST of Lysine specific histone demethylase 1B vs. TrEMBL
Match: H3AB83 (Lysine demethylase 1B OS=Latimeria chalumnae OX=7897 GN=KDM1B PE=4 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 8.054e-40
Identity = 80/274 (29.20%), Postives = 125/274 (45.62%), Query Frame = 1
Query:  451 NPCSFPEDQRIDFIRNHPASFFESIKYTVYLGTSPYLDVYDEYSLDTVGISP--------IAEPIDFDIGDC-----CEGFMKTFNPFSKESNTQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPTGLPIN--IFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL---VENNKSVSLKLKSFDCLNEIYGSINNPFSFMSYQV 1218
            + CSFPED R+  + +    ++  +     L  SP   +   Y  D VG+SP        + EP +     C          K F PF  + N       + P  M+  E   FP +S +   +++ LRNL+L LW  D K  +T       I +RG++++   V  +  ++   +  G VN G     P    +  D+  + VIVIGAG SGLAAAR L   G  V VLE+ + +   V ++KS+ + +     +  + G INNP + M  Q+
Sbjct:  192 DQCSFPEDMRVAEVSD--PWWYTMLILPPLLKGSPAAPLLSAYYPDCVGMSPSCTSTNRLLCEPTNVKSEHCKGISPSNSICKYFQPFY-QPNECGKALCVRPDVMELDELYEFPEYSRDP-TMYLALRNLILALWHTDCKEMLTPQKCAHHILVRGLLRIRC-VQEMERILYFMTRKGLVNTGILRVSPDQSILPRDYHNKSVIVIGAGPSGLAAARQLQNFGIKVMVLEARDRIGGRVWDDKSLGVPVGRGAQI--VNGCINNPIALMCEQL 458          

HSP 2 Score: 67.3958 bits (163), Expect = 8.054e-40
Identity = 34/116 (29.31%), Postives = 58/116 (50.00%), Query Frame = 2
Query:   65 QKNVKYCPDPTCNNLIPICCLFLNTECSDNG--AKWYHLSAGEHVCSVCYNHLHSFFSYETENSEIITFKKTWLGQSQETPTIHDYITSTLLSNWYLC--NECNKWRQVSRDIYLT 400
            +K  + C    C    P+C       C+ NG  ++WYHLS GEH C+ C++  +   S++    +   +K+ W    +  P++  ++    L  W  C   EC KWRQ++++I LT
Sbjct:   56 EKKYRKCEKAGCTATYPVCFASAAERCAKNGYTSRWYHLSCGEHFCNECFDLYYR--SHKDGYEKYANWKRIWTSNGKSEPSLKAFMADQQLPYWVQCIKPECRKWRQLTKEIQLT 169          

HSP 3 Score: 55.0694 bits (131), Expect = 8.054e-40
Identity = 76/301 (25.25%), Postives = 124/301 (41.20%), Query Frame = 2
Query: 1340 GIETREISTNISIFNEDGSIISDEVDEFYQNLVYNFVAYLMNGASIIKYSSQFAGCSVADLYQNYRRDRINSEFAGNDGVESIYLSEIEYRV--FGGAAMETV-PRNVEMSAVNRGISNFSCKQFSGSTMEPVNGWGELFTRLVDNLDIRYETKVESIGRHVDKCVVRDSNGQEYLADKVLLATAPWNAVR---IKSDPDWLENR-EILNSKSVVDADEIRAGAGFIIVQMAFDRQNLFWRGKIPPSSSERTFAVATKSSEMRGFCHLFKESHVVDELTVLQSRIFGLAAKVCGELSEEQI 2221
            GI+  ++     +  E G I    +D   + + ++F A L   A   K  +Q     + +  Q      I   F    G++    SE+E  V  F  + +E     N++  +      N    QF+G       G+  +  +L + LDIR    V++I    D   V  S+   + A KVL+ T P   ++   +K +P   E + + +NS           GAG +I ++A      FW  KI    S   F     SSE RG   +F +     + +VL S I G +A +  EL E+Q+
Sbjct:  459 GIKMHKLGERCDLIQEGGRITDPTID---KRMDFHFNAILDVVAEWRKDKTQSQDVPLGEKIQE-----ICKAFTQESGIQ---FSELEESVLQFHLSNLEYACGTNLQQVSARSWDHNEFFAQFAGDHTLLTEGYSAITNKLSEGLDIRLNAAVQTIDFSGDDVQVTTSSRTVWTAQKVLV-TVPLALLQKGVVKFNPPLPERKLKAINS----------LGAG-VIEKIALQFPYRFWDNKI---QSADFFGHIPPSSEKRGLFGVFYDMDPQRKQSVLMSVITGDSAALVRELDEKQV 733          
BLAST of Lysine specific histone demethylase 1B vs. TrEMBL
Match: A0A3Q2CQ87 (Lysine demethylase 1B OS=Cyprinodon variegatus OX=28743 GN=KDM1B PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.860e-38
Identity = 35/114 (30.70%), Postives = 61/114 (53.51%), Query Frame = 2
Query:   77 KYCPDPTCNNLIPICCLFLNTECSDNG--AKWYHLSAGEHVCSVCYNHLHSFFSYETENSEIITFKKTWLGQSQETPTIHDYITSTLLSNWYLCN--ECNKWRQVSRDIYLTPS 406
            + C    C+ + P+C    +  C+ NG  ++WYHLS GEH C+ C++H +   S++       ++KK W    +  P++  ++    L  W  C   +C KWRQ++++I LT S
Sbjct:   73 RKCEKAGCSAMYPVCFASASDRCAKNGYTSRWYHLSCGEHFCNECFDHYYR--SHKDGYETFASWKKVWTSNGKSEPSLKAFMADQQLPFWVQCTKPDCGKWRQLTKEIQLTAS 184          

HSP 2 Score: 69.707 bits (169), Expect = 1.860e-38
Identity = 78/270 (28.89%), Postives = 125/270 (46.30%), Query Frame = 1
Query:  457 CSFPEDQRIDFIRNHPASFFESIK-YTVYLGTSPYLDVYDEYSLDTVGISPIAEPIDF-DIGDCCE----GFMKTFNPFSKESNTQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPTGLPINIFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL---VENNKSVSLKLKSFDCLNEIYGSINNPFSFMSYQVYFLLIEL 1239
            CS PED R+  ++    S++ S+      L  SP       Y  D VG+SP   P +  D     +    G    F PF  + N       + P  M+  E   FP FS +   +++ LRNL+L  W  + K  +T+    + I +RG+V+V   V  +  ++   +  G +N G        + E H  + VI+IGAG SGLAAAR L   G  V VLE+ + +   V ++ S+ + +     +  + G +NNP + M  Q+   + +L
Sbjct:  206 CSQPEDLRVAEVKE---SWWHSMLILPPLLKESPAGAFLSAYYPDCVGMSPSGSPCNVSDPSRAAQPQIPGLCPYFQPFY-QPNECGKALCVRPDMMELDELYEFPEFSRDP-TMYLALRNLILASWHKNCKEVLTAEKCAQNIIVRGLVRVCC-VQELDRVLHFMTRKGLINTGVLAVKQPLLPEKHRPKKVIIIGAGASGLAAARQLQNFGTQVVVLEARDRIGGRVWDDTSLGVTVGRGAQI--VNGCVNNPVALMCEQMGIKMHKL 467          

HSP 3 Score: 67.3958 bits (163), Expect = 1.860e-38
Identity = 93/404 (23.02%), Postives = 162/404 (40.10%), Query Frame = 2
Query: 1340 GIETREISTNISIFNEDGSIISDEVD---EFYQNLVYNFVAYLMNGASIIKYSSQFAGCSVADLYQNYRRDRINSEFAGNDGVESIYLSEIEYRVFGGAAMETVPRNVEMSAVNRGISNFSCK---------QFSGSTMEPVNGWGELFTRLVDNLDIRYETKVESIGRHVDKCVVRDSNGQEYLADKVLLATAPWNAV---RIKSDPDWLENREILNSKSVVDADEIRAGAGFIIVQMAFDRQNLFWRGKIPPSSSERTFAVATKSSEMRGFCHLFKESHVVDELTVLQSRIFGLAAKVCGELSEEQIIGKVLEKLSCLADRVNQSSPPRPSWYQIIR--------IENASLACTDIGNAFNKLAISNRFQNEIFVTNKTMIAE-PINLSNSFCVGMDAASTI 2479
            GI+  ++     +F E G +    +D   +F+ N + + V+   N        SQ     + +  Q  ++D +            ++ SE+E +V     ++    N+E  A    +   S +         QFSG       G+  L  +L + LDIR    V +I    +   V  SNG ++ A KVL+ T P   +   RI+ +P  L +R++    S+        GAG II ++A    N FW  KI        F     SSE RG   +F +     +  VL S I G A    G++ E+ ++ + ++ L  L     +   P P  Y + R        +  + +     G A++ LA     Q ++F   +      P  ++ ++  G+  AS +
Sbjct:  461 GIKMHKLGERCDLFQEGGRVTDPAIDKRMDFHFNAILDVVSDWRND------KSQNQDAPLGEKVQEIKKDFLQES--------GMHFSELEEKV-----LQFHLSNLEF-ACGSTLDQVSARFWDHNEFFAQFSGDHTLLTKGYSVLLHKLAEGLDIRTNCPVNAIDYSGEAVKVTSSNGSQWTAQKVLV-TVPLTLLQKNRIRFNPP-LPDRKLKAIHSL--------GAG-IIEKIALQFPNRFWDSKI---QGADYFGHIPPSSEKRGMFSVFYDLDPQGKQAVLMSIISGDAVSAVGDMEEKDVVDECVKVLREL---FKEQDVPDPLSYFVTRWSKDEWSQMSYSFVKTGGSGEAYDVLA--EDLQGKVFFAGEATNRHFPQTVTGAYLSGVREASKM 825          
BLAST of Lysine specific histone demethylase 1B vs. TrEMBL
Match: M4AP24 (Lysine demethylase 1B OS=Xiphophorus maculatus OX=8083 GN=KDM1B PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 2.402e-36
Identity = 37/117 (31.62%), Postives = 63/117 (53.85%), Query Frame = 2
Query:   68 KNVKYCPDPTCNNLIPICCLFLNTECSDNG--AKWYHLSAGEHVCSVCYNHLHSFFSYETENSEIITFKKTWLGQSQETPTIHDYITSTLLSNWYLCN--ECNKWRQVSRDIYLTPS 406
            K  + C    C+ + P+C    +  C+ NG  ++WYHLS GEH C+ C++  HS+ S++       ++KK W    +  P++  ++    L  W  C   +C KWRQ++++I LT S
Sbjct:   70 KKYRKCEKAGCSAIYPVCFASASDRCAKNGYTSRWYHLSCGEHFCNECFD--HSYRSHKDGYETFASWKKVWTSNGKSEPSLKAFMADQQLPFWVQCTKPDCRKWRQLTKEIQLTAS 184          

HSP 2 Score: 65.855 bits (159), Expect = 2.402e-36
Identity = 77/282 (27.30%), Postives = 125/282 (44.33%), Query Frame = 1
Query:  451 NPCSFPEDQRIDFIRNHPASFFESIKYTVY-----LGTSPYLDVYDEYSLDTVGISPIAEPIDFDIGDC----CE-------GFMKTFNPFSKESNTQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPTGLPINIFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL---VENNKSVSLKLKSFDCLNEIYGSINNPFSFMSYQVYFLLIEL 1239
            + CS PED R+       A   ES  +++      L  SP       Y  D VG+SP   P +    +     C        G    F PF  + N       + P  M+  E   FP FS +   +++ LRNL+L  W  + K  +T+    + I +RG+V+V   V  +  ++   +  G +N G        + E +  + VIVIGAG +GLAAAR L   G  V +LE+ + +   V ++ S+ + +     +  + G +NNP + M  Q+   + +L
Sbjct:  204 DQCSQPEDLRV-------AEVSESWWHSMLILPPLLKESPAGAFLSAYYPDCVGMSPSGSPCNVSAAELRAEPCRAVQPQIPGLCPYFQPFY-QPNECGKALCVRPDMMELDELYEFPEFSRDP-TMYLALRNLILASWHKNCKEVLTAEKCAQHIIVRGLVRVCC-VQELDRVLHFMTRKGLINTGVLAVKQPLLPERYRSKKVIVIGAGAAGLAAARQLQNFGTQVVLLEARDRIGGRVWDDGSLGVTVGRGAQI--VNGCVNNPIALMCEQMGIRMHKL 473          

HSP 3 Score: 61.6178 bits (148), Expect = 2.402e-36
Identity = 96/399 (24.06%), Postives = 160/399 (40.10%), Query Frame = 2
Query: 1340 GIETREISTNISIFNEDGSIISDEVD---EFYQNLVYNFVAYLMNGASIIKYSSQFA--GCSVADLYQNYRRDRINSEFAGNDGVESIYLSEIEYRVFGGAAMETVPRNVEMSAVNRGISNFSCKQFSGSTMEPVNGWGELFTRLVDNLDIRYETKVESIGRHVDKCVVRDSNGQEYLADKVLLATAPW-----NAVRIKSDPDWLENREILNSKSVVDADEIRAGAGFIIVQMAFDRQNLFWRGKIPPSSSERTFAVATKSSEMRGFCHLFKESHVVDELTVLQSRIFGLAAKVCGELSEEQIIGKVLEKLSCLADRVNQSSPPRPSWYQIIR--------IENASLACTDIGNAFNKLAISNRFQNEIFVTNKTMIAE-PINLSNSFCVGMDAASTI 2479
            GI   ++     +F E G      +D   +F+ N + + V+   N     K  SQ A  G  V ++ +N+ ++         + V   +LS +E+    G+ ++ V      SA     + F   QFSG       G+  L  +L + LDIR    V++I    D   V  SNG ++ A KVL+ T P      NA+R       L  R++    S+        GAG II ++A    N FW  KI        F       E RG   +F +     +  VL S + G A    G+L + +++ + L+ L  L     +   P P  Y + R        +  + +     G A++ LA     Q ++F   +      P  ++ ++  G+  AS +
Sbjct:  467 GIRMHKLGERCDLFQEGGRATDPAIDKRMDFHFNAILDVVSDWRND----KSQSQDAPLGEKVQEIKKNFLQESGMQFSDLEEKVLQFHLSNLEFAC--GSTLDQV------SARFWDHNEFFA-QFSGDHTLLTKGYSVLLHKLAEGLDIRTNCPVQAIDYSADAVKVTSSNGSQWTAQKVLV-TVPLTLLQKNAIRFNPP---LPERKLKAIHSL--------GAG-IIEKIALQFPNRFWDSKI---QGADYFGHIPPCPEKRGMFSVFYDLDPQGKQAVLMSIMSGDAVSAVGDLEDSEVVDECLKVLREL---FTEQEVPDPLNYFVTRWSKDVWSQMSYSFVKTGGSGEAYDILA--EDVQGKVFFAGEATNRHFPQTVTGAYLSGVREASKM 831          
BLAST of Lysine specific histone demethylase 1B vs. TrEMBL
Match: A0A384C9D3 (Lysine demethylase 1B OS=Ursus maritimus OX=29073 GN=KDM1B PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 8.842e-36
Identity = 38/117 (32.48%), Postives = 62/117 (52.99%), Query Frame = 2
Query:   65 QKNVKYCPDPTCNNLIPICCLFLNTECSDNG--AKWYHLSAGEHVCSVCYNHLHSFFSYETENSEIITFKKTWLGQSQETPTIHDYITSTLLSNWYLCN--ECNKWRQVSRDIYLTP 403
            +K  + C    C    P+C    +  C+ NG  ++WYHLS GEH C+ C++H +   S++    +  T+KK W    +  P+   ++    L  W  C   EC KWRQ++++I+LTP
Sbjct:   47 EKKYRRCEKSGCTVACPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYR--SHKDGYDKYTTWKKIWTSNGKTEPSPKAFMADQQLPYWVQCTIPECRKWRQLTKEIHLTP 161          

HSP 2 Score: 68.9366 bits (167), Expect = 8.842e-36
Identity = 83/286 (29.02%), Postives = 128/286 (44.76%), Query Frame = 1
Query:  451 NPCSFPEDQRIDFIRNHPASFFESIKYTVYLGTSPYLDVYDEYSLDTVGISPI----------AEPIDFDIGDCCE---GFMKTFNPFSKESNTQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFG-FPTGLPINIF-EDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL---VENNKSVSLKLKSFDCLNEIYGSINNPFSFMSYQVYFLLIELVDFNE 1254
            +PCS PED R+  + NH   ++  +     L  S    +   Y  D VG+SP           + P   +         G  + F PF  + N       + P  M+  E   FP +S +   +++ LRNL+L LW  + K  +T       I +RG+V+V   V  V  ++   +  G +N G    G   ++  +D+  + VI+IGAG +GLAAAR L   G  VTVLE+ + +   V ++KS    +        + G INNP + M  Q   L I +  F E
Sbjct:  183 DPCSLPEDLRVSEVSNH--WWYSMLIQPPLLKDSVAAPLLSAYYPDCVGMSPSCASTHRVASSSSPGKLEHSKAVPSALGMNRYFQPFY-QPNECGKALCVRPDVMELDELYEFPEYSRDP-TMYLALRNLILALWHTNCKEALTPQKCIPHIIVRGLVRVRC-VQEVERILYFMTRKGLINTGVLSVGTDQHLLPKDYHNKSVIIIGAGPAGLAAARQLHNFGIKVTVLEAKDRIGGRVWDDKSFK-GVTVGRGAQIVNGCINNPVALMCEQ---LGISMHKFGE 459          

HSP 3 Score: 57.3806 bits (137), Expect = 8.842e-36
Identity = 83/395 (21.01%), Postives = 157/395 (39.75%), Query Frame = 2
Query: 1340 GIETREISTNISIFNEDGSIISDEVDEFYQNLVYNFVAYLMNGASIIKYSSQFA----GCSVADLYQNYRRDRINSEFAGNDGVESIYLSEIEYRVFGGAAMETVPRNVEMSAVNRGISNFSCKQFSGSTMEPVNGWGELFTRLVDNLDIRYETKVESIGRHVDKCVVRDSNGQEYLADKVLLATAPWNAVRIKSDPDWLENREILNSKSVVDADEIRA----GAGFIIVQMAFDRQNLFWRGKIPPSSSERTFAVATKSSEMRGFCHLFKESHVVDELTVLQSRIFGLAAKVCGELSEEQIIGKVLEKLSCLADRVNQSSPPRPSWYQIIR------IENASLACTDIGNAFNKLAISNRFQNEIFVTNKTMIAE-PINLSNSFCVGMDAASTI 2479
            GI   +      +  E G +    +D   + + ++F A L   +   K  +Q      G  + ++Y+ + ++         + V   +LS +EY    G++++ V      SA +   + F   QF+G       G+  +  +L + LDIR ++ V+SI    D+  V  ++G    A KVL+             P  L  R  ++    +   +++A    GAG II ++A      FW GK+        F     S+  RG   +F +     + +VL S + G A      L ++Q++ +    ++ L +   +   P P+ Y + R      I+ A       G+      I+   Q  +F   +      P  ++ ++  G+  AS I
Sbjct:  451 GISMHKFGERCDLIQEGGRVTDPTID---KRMDFHFNALLDVVSEWRKDKTQLQDVPLGEKIEEIYKAFIKESGIQFSELEEQVRHFHLSNLEYAC--GSSLQQV------SARSWDHNEFFA-QFAGDHTLLTPGYSVIIEKLAEGLDIRLKSPVQSIDYSGDEVQVTITDGTACTAQKVLVTV-----------PLALLQRGAIHFNPPLSDKKMKAINSLGAG-IIEKIALQFPYRFWDGKV---QGADFFGHVPPSASKRGLFAVFYDMDPQKQHSVLMSVVAGEAVASVRTLDDKQVLQQC---MAVLRELFKEQEVPDPTKYFVTRWSTDPWIQMAYSFVKTGGSGEAYDIIAEEIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKI 815          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Cavefish
Match: KDM1B (lysine demethylase 1B [Source:NCBI gene;Acc:103045768])

HSP 1 Score: 88.5817 bits (218), Expect = 1.630e-34
Identity = 79/279 (28.32%), Postives = 126/279 (45.16%), Query Frame = 1
Query:  451 NPCSFPEDQRIDFIRNHPASFFESIKYTVYL-----GTSPYLDVYDEYSLDTVGISPIAEPIDF------DIGDCCEGFMKTFNPFSKESNTQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPTGLPINIFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL---VENNKSVSLKLKSFDCLNEIYGSINNPFSFMSYQVYFLLIELVD 1245
            + CS PED R+       AS  +S  Y++ +       SP       Y  D VG+SP +   D       +I     G    F PF  + N       + P  M+  E   FP FS +   +++ LRNL+L  W  D K  +T       + +RG+V++   V  +  ++   +  G +N G        + E +  + V+V+GAG SGLAAAR L   G  V VLES + +   V ++KS+ + +     +  + G +NNP + M  Q+   + +L D
Sbjct:  212 DQCSQPEDMRV-------ASIGDSWWYSMLILPPLFKESPASPFLTAYYPDCVGMSPSSSHGDLRPEQRRNIQPQIPGLCPYFQPFY-QPNECGKALCVRPDMMELDELYEFPEFSRDP-TMYLALRNLILAAWHRDCKEALTPQKCAPHVIVRGLVRIRC-VQELDRVLHFMTRKGLINTGALLAKQPLLPEPYRNKKVLVVGAGPSGLAAARQLQNFGMQVVVLESRDRIGGRVWDDKSLGVTVGRGAQI--VNGCVNNPIALMCEQLGVKMHKLRD 478          

HSP 2 Score: 78.5666 bits (192), Expect = 1.630e-34
Identity = 37/118 (31.36%), Postives = 63/118 (53.39%), Query Frame = 2
Query:   65 QKNVKYCPDPTCNNLIPICCLFLNTECSDNG--AKWYHLSAGEHVCSVCYNHLHSFFSYETENSEIITFKKTWLGQSQETPTIHDYITSTLLSNWYLCN--ECNKWRQVSRDIYLTPS 406
            +K  + C    C    P+C    +  C+ NG  ++WYHLS GEH C+ C++H +   S++    +  ++K+ W G  +  P++  ++    L  W  C   +C KWRQ+++DI LT S
Sbjct:   77 EKKFRKCEKAGCPATYPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYR--SHKDGYEKFTSWKRLWTGNGKSEPSLKAFMADQQLPYWVQCTKPDCGKWRQLTKDIQLTAS 192          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Cavefish
Match: KDM1B (lysine demethylase 1B [Source:NCBI gene;Acc:103045768])

HSP 1 Score: 87.0409 bits (214), Expect = 3.164e-23
Identity = 81/283 (28.62%), Postives = 128/283 (45.23%), Query Frame = 1
Query:  451 NPCSFPEDQRIDFIRNHPASFFESIKYTVYL-----GTSPYLDVYDEYSLDTVGISPIAEPIDF--DI------GDCC--EGFMKTFNPFSKESNTQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPTGLPINIFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL---VENNKSVSLKLKSFDCLNEIYGSINNPFSFMSYQVYFLLIELVD 1245
            + CS PED R+       AS  +S  Y++ +       SP       Y  D VG+SP +   D   D+      G  C   G    F PF  + N       + P  M+  E   FP FS +   +++ LRNL+L  W  D K  +T       + +RG+V++   V  +  ++   +  G +N G        + E +  + V+V+GAG SGLAAAR L   G  V VLES + +   V ++KS+ + +     +  + G +NNP + M  Q+   + +L D
Sbjct:  117 DQCSQPEDMRV-------ASIGDSWWYSMLILPPLFKESPASPFLTAYYPDCVGMSPSSSHGDLRPDLDHSAYPGCVCLVPGLCPYFQPFY-QPNECGKALCVRPDMMELDELYEFPEFSRD-PTMYLALRNLILAAWHRDCKEALTPQKCAPHVIVRGLVRIRC-VQELDRVLHFMTRKGLINTGALLAKQPLLPEPYRNKKVLVVGAGPSGLAAARQLQNFGMQVVVLESRDRIGGRVWDDKSLGVTVGRGAQI--VNGCVNNPIALMCEQLGVKMHKLRD 387          

HSP 2 Score: 42.3578 bits (98), Expect = 3.164e-23
Identity = 17/54 (31.48%), Postives = 30/54 (55.56%), Query Frame = 2
Query:  251 EIITFKKTWLGQSQETPTIHDYITSTLLSNWYLCN--ECNKWRQVSRDIYLTPS 406
            +  ++K+ W G  +  P++  ++    L  W  C   +C KWRQ+++DI LT S
Sbjct:   44 KFTSWKRLWTGNGKSEPSLKAFMADQQLPYWVQCTKPDCGKWRQLTKDIQLTAS 97          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Cavefish
Match: kdm1a (lysine demethylase 1A [Source:NCBI gene;Acc:103023119])

HSP 1 Score: 51.9878 bits (123), Expect = 3.045e-6
Identity = 37/113 (32.74%), Postives = 57/113 (50.44%), Query Frame = 1
Query:  775 RNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPTGLPINIFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL 1113
            + VF+ +RN  L LW  +PK  +T     + +        A+LV+ +   ++ +   G +NFG      +          VIVIG G+SGLAAAR L   G +VTVLE+ + +
Sbjct:  198 QKVFLYIRNRTLQLWLDNPKVQLTFESTVQQLEA-PYNSDAVLVHRIHSYLERH---GLINFGIYKR--VKPLPSKKTGKVIVIGGGVSGLAAARQLQSFGMDVTVLEARDRV 304          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Cavefish
Match: kdm1a (lysine demethylase 1A [Source:NCBI gene;Acc:103023119])

HSP 1 Score: 51.6026 bits (122), Expect = 3.557e-6
Identity = 37/113 (32.74%), Postives = 57/113 (50.44%), Query Frame = 1
Query:  775 RNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPTGLPINIFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL 1113
            + VF+ +RN  L LW  +PK  +T     + +        A+LV+ +   ++ +   G +NFG      +          VIVIG G+SGLAAAR L   G +VTVLE+ + +
Sbjct:  180 QKVFLYIRNRTLQLWLDNPKVQLTFESTVQQLEA-PYNSDAVLVHRIHSYLERH---GLINFGIYKR--VKPLPSKKTGKVIVIGGGVSGLAAARQLQSFGMDVTVLEARDRV 286          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Cavefish
Match: kdm1a (lysine demethylase 1A [Source:NCBI gene;Acc:103023119])

HSP 1 Score: 51.6026 bits (122), Expect = 3.653e-6
Identity = 37/113 (32.74%), Postives = 57/113 (50.44%), Query Frame = 1
Query:  775 RNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPTGLPINIFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL 1113
            + VF+ +RN  L LW  +PK  +T     + +        A+LV+ +   ++ +   G +NFG      +          VIVIG G+SGLAAAR L   G +VTVLE+ + +
Sbjct:  189 QKVFLYIRNRTLQLWLDNPKVQLTFESTVQQLEA-PYNSDAVLVHRIHSYLERH---GLINFGIYKR--VKPLPSKKTGKVIVIGGGVSGLAAARQLQSFGMDVTVLEARDRV 295          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Sea Lamprey
Match: KDM1B (lysine demethylase 1B [Source:HGNC Symbol;Acc:HGNC:21577])

HSP 1 Score: 74.7146 bits (182), Expect = 2.018e-37
Identity = 37/128 (28.91%), Postives = 69/128 (53.91%), Query Frame = 2
Query:   53 ELTKQKNVKYCPDPTCNNLIPICCLFLNTECSDNG--AKWYHLSAGEHVCSVCYNHLHSFFSYETENSEIITFKKTWLGQSQETPTIHDYITSTLLSNWYLCNE--CNKWRQVSRDIYLTPSEISNSH 424
            E   +K  + C    C   +P+C +  +  C+ NG  ++WYHLS GEH C+ C++  H + S++       ++K+ W    +  P+I  ++    L  W  C +  C KWRQ++R++ LT +E++ ++
Sbjct:   42 EEDDEKRYRKCEKVGCMVTVPVCFVSASERCAKNGYTSRWYHLSCGEHFCNECFD--HHYRSHKDGYERYASWKRVWTMNGKSEPSIKAFMADQQLPYWVQCTKPGCGKWRQLTREVMLT-TELAQTY 166          

HSP 2 Score: 65.855 bits (159), Expect = 2.018e-37
Identity = 77/284 (27.11%), Postives = 121/284 (42.61%), Query Frame = 1
Query:  430 ALLQNAFNPCSFPEDQRIDFIRNHPASFFESIKYTVYLGTSPYLDVYDEYSLDTVGISPIAEPIDFDIGD-------------CC---EGFMKTFNPFSKESNTQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPTGLPIN--IFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL---VENNKSVSLKLKSFDCLNEIYGSINNPFSFMSYQV 1218
            A+    F+PC+ PED R+  +      +F  +     L  SP       Y LD VG+SP     +   G              C     G    F PF  + N       + P  M+  E   FP FS +   +++ LRNL+L LW  + K  +T     + + +RG+++V  +   +  ++      G +N G  +  P    +   + K  V+VIGAG +GLAAAR L   G  V VLE+   +   V +++S+            + G +NNP S M  Q+
Sbjct:  175 AVKNEGFDPCAPPEDSRV--VEVSEPRWFAMLLLPPLLKDSPAAPFLSAYYLDCVGMSPACAGTERCSGTNHSLPKILVHYMFCVLPVPGLNPYFQPFY-QPNESGKALCVRPDVMELDELYEFPEFSRDP-TMYLALRNLILALWNMNCKEFLTVQKCMQHLLVRGLIRVRCM-QELEGILHFAMRKGLINTGLLSAHPGRPLLPLHYRKNSVVVIGAGPAGLAAARQLHNFGLKVIVLEARERIGGRVWDDRSLGGTTVGRGA-QIVNGCVNNPISLMCEQL 452          

HSP 3 Score: 54.6842 bits (130), Expect = 2.018e-37
Identity = 69/323 (21.36%), Postives = 129/323 (39.94%), Query Frame = 2
Query: 1340 GIETREISTNISIFNEDGSIISDEVD---EFYQNLVYNFVAYLMNGASIIKYSSQFAGCSVADLYQNYRRDRINSEFAGNDGVESIYLSEIEYRVFGGAAMETVPRNVEMSAVNRGISNFSCKQFSGSTMEPVNGWGELFTRLVDNLDIRYETKVESIGRHVDKCVVRDSNGQEYLADKVLLATAPWNAVRIKSDPDWLENREILNSKSVVDADEIRAGAGFIIVQMAFDRQNLFWRGKIPPSSSERTFAVATKSSEMRGFCHLFKESHVVDELTVLQSRIFGLAAKVCGELSEEQIIGKVLEKLSCLADRVNQSSPPRPSWY 2299
            GI    +     + +E G +    +D   +F+ N + + +A      +   +        + +L   +R++   S     + +   +L+ +EY    GA +  V      SA +   + F   QF+G       G+  +  RL + LD+R  T V+ +    +   V  + G  Y+ADKVL+ T P   +++      LE    L  + +     + AG   +I ++       FW  KI        F     S + RG   +F +     E  VL S + G +  +  +LS+ Q++ + ++ L  +    N   P R  W+
Sbjct:  453 GIRMHVLGEACELLDESGRVTDPALDKRMDFHFNALLDIIAQWRT-TTEPAHDVSLGAEKMEELTHAFRKESGLSFGELEEKLLQFHLANLEYAC--GANLRQV------SARSWDHNEFF-AQFAGDHTLLTAGYSTILHRLAEGLDVRLHTPVKRVDYSGECVKVHTATGMTYIADKVLV-TIPLALMQLGV----LEFCPPLPERKIKALQSLGAG---LIEKIGLQFPFRFWEHKI---RGADYFGHLPPSHDRRGLFGVFYDMDPKGEQCVLMSVVSGDSVALIRDLSDSQVVSQSMQALRAIFPEQNVPDPLR--WF 752          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Sea Lamprey
Match: KDM1B (lysine demethylase 1B [Source:HGNC Symbol;Acc:HGNC:21577])

HSP 1 Score: 74.7146 bits (182), Expect = 4.557e-36
Identity = 37/128 (28.91%), Postives = 69/128 (53.91%), Query Frame = 2
Query:   53 ELTKQKNVKYCPDPTCNNLIPICCLFLNTECSDNG--AKWYHLSAGEHVCSVCYNHLHSFFSYETENSEIITFKKTWLGQSQETPTIHDYITSTLLSNWYLCNE--CNKWRQVSRDIYLTPSEISNSH 424
            E   +K  + C    C   +P+C +  +  C+ NG  ++WYHLS GEH C+ C++  H + S++       ++K+ W    +  P+I  ++    L  W  C +  C KWRQ++R++ LT +E++ ++
Sbjct:   42 EEDDEKRYRKCEKVGCMVTVPVCFVSASERCAKNGYTSRWYHLSCGEHFCNECFD--HHYRSHKDGYERYASWKRVWTMNGKSEPSIKAFMADQQLPYWVQCTKPGCGKWRQLTREVMLT-TELAQTY 166          

HSP 2 Score: 61.2326 bits (147), Expect = 4.557e-36
Identity = 76/292 (26.03%), Postives = 123/292 (42.12%), Query Frame = 1
Query:  430 ALLQNAFNPCSFPEDQRIDFIRNHPASFFESIKYTVYLGTSPYLDVYDEYSLDTVGISP---------------------IAEPIDFDIGDCCEGFMKTFNPFSK---ESNTQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPTGLPIN--IFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL---VENNKSVSLKLKSFDCLNEIYGSINNPFSFMSYQV 1218
            A+    F+PC+ PED R+  +      +F  +     L  SP       Y LD VG+SP                     I     + +    E  M   NP+ +   + N       + P  M+  E   FP FS +   +++ LRNL+L LW  + K  +T     + + +RG+++V  +   +  ++      G +N G  +  P    +   + K  V+VIGAG +GLAAAR L   G  V VLE+   +   V +++S+            + G +NNP S M  Q+
Sbjct:  175 AVKNEGFDPCAPPEDSRV--VEVSEPRWFAMLLLPPLLKDSPAAPFLSAYYLDCVGMSPACAGTHRCSCSHHTSAAGYASIHTVAHYRVATS-ELQMPGLNPYFQPFYQPNESGKALCVRPDVMELDELYEFPEFSRDP-TMYLALRNLILALWNMNCKEFLTVQKCMQHLLVRGLIRVRCM-QELEGILHFAMRKGLINTGLLSAHPGRPLLPLHYRKNSVVVIGAGPAGLAAARQLHNFGLKVIVLEARERIGGRVWDDRSLGGTTVGRGA-QIVNGCVNNPISLMCEQL 460          

HSP 3 Score: 54.299 bits (129), Expect = 4.557e-36
Identity = 69/323 (21.36%), Postives = 129/323 (39.94%), Query Frame = 2
Query: 1340 GIETREISTNISIFNEDGSIISDEVD---EFYQNLVYNFVAYLMNGASIIKYSSQFAGCSVADLYQNYRRDRINSEFAGNDGVESIYLSEIEYRVFGGAAMETVPRNVEMSAVNRGISNFSCKQFSGSTMEPVNGWGELFTRLVDNLDIRYETKVESIGRHVDKCVVRDSNGQEYLADKVLLATAPWNAVRIKSDPDWLENREILNSKSVVDADEIRAGAGFIIVQMAFDRQNLFWRGKIPPSSSERTFAVATKSSEMRGFCHLFKESHVVDELTVLQSRIFGLAAKVCGELSEEQIIGKVLEKLSCLADRVNQSSPPRPSWY 2299
            GI    +     + +E G +    +D   +F+ N + + +A      +   +        + +L   +R++   S     + +   +L+ +EY    GA +  V      SA +   + F   QF+G       G+  +  RL + LD+R  T V+ +    +   V  + G  Y+ADKVL+ T P   +++      LE    L  + +     + AG   +I ++       FW  KI        F     S + RG   +F +     E  VL S + G +  +  +LS+ Q++ + ++ L  +    N   P R  W+
Sbjct:  461 GIRMHVLGEACELLDESGRVTDPALDKRMDFHFNALLDIIAQWRT-TTEPAHDVSLGAEKMEELTHAFRKESGLSFGELEEKLLQFHLANLEYAC--GANLRQV------SARSWDHNEFF-AQFAGDHTLLTAGYSTILHRLAEGLDVRLHTPVKRVDYSGECVKVHTATGMTYIADKVLV-TIPLALMQLGV----LEFCPPLPERKIKALQSLGAG---LIEKIGLQFPFRFWEHKI---RGADYFGHLPPSHDRRGLFGVFYDMDPKGEQCVLMSVVSGDSVALIRDLSDSQVVSQSMQALRAIFPEQNVPDPLR--WF 760          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Sea Lamprey
Match: KDM1B (lysine demethylase 1B [Source:HGNC Symbol;Acc:HGNC:21577])

HSP 1 Score: 68.9366 bits (167), Expect = 2.818e-33
Identity = 74/271 (27.31%), Postives = 120/271 (44.28%), Query Frame = 1
Query:  430 ALLQNAFNPCSFPEDQRIDFIRNHPASFFESIKYTVYLGTSPYLDVYDEYSLDTVGISPIAEPIDFDIGDCCEGFMKTFNPFSK---ESNTQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPTGLPIN--IFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL---VENNKSVSLKLKSFDCLNEIYGSINNPFSFMSYQV 1218
            A+    F+PC+ PED R+  +      +F  +     L  SP       Y LD VG+SP            C G  ++   F+    + N       + P  M+  E   FP FS +   +++ LRNL+L LW  + K  +T     + + +RG+++V  +   +  ++      G +N G  +  P    +   + K  V+VIGAG +GLAAAR L   G  V VLE+   +   V +++S+            + G +NNP S M  Q+
Sbjct:  101 AVKNEGFDPCAPPEDSRV--VEVSEPRWFAMLLLPPLLKDSPAAPFLSAYYLDCVGMSP-----------ACAGTERSVPRFTSPFYQPNESGKALCVRPDVMELDELYEFPEFSRDP-TMYLALRNLILALWNMNCKEFLTVQKCMQHLLVRGLIRVRCM-QELEGILHFAMRKGLINTGLLSAHPGRPLLPLHYRKNSVVVIGAGPAGLAAARQLHNFGLKVIVLEARERIGGRVWDDRSLGGTTVGRGA-QIVNGCVNNPISLMCEQL 355          

HSP 2 Score: 61.2326 bits (147), Expect = 2.818e-33
Identity = 28/91 (30.77%), Postives = 53/91 (58.24%), Query Frame = 2
Query:  158 AKWYHLSAGEHVCSVCYNHLHSFFSYETENSEIITFKKTWLGQSQETPTIHDYITSTLLSNWYLCNE--CNKWRQVSRDIYLTPSEISNSH 424
            ++WYHLS GEH C+ C++  H + S++       ++K+ W    +  P+I  ++    L  W  C +  C KWRQ++R++ LT +E++ ++
Sbjct:    5 SRWYHLSCGEHFCNECFD--HHYRSHKDGYERYASWKRVWTMNGKSEPSIKAFMADQQLPYWVQCTKPGCGKWRQLTREVMLT-TELAQTY 92          

HSP 3 Score: 50.8322 bits (120), Expect = 2.818e-33
Identity = 71/326 (21.78%), Postives = 129/326 (39.57%), Query Frame = 2
Query: 1340 GIETREISTNISIFNEDGSIISDEVD---EFYQNLVYNFVAYLMNGASIIKYSSQFAGCSVADLYQNYRRDRINSEFAGNDGVESIYLSEIEYRVFGGAAMETVPRNVEMSAVNRGISNFSCKQFSGSTMEPVNGWGELFTRLVDNLDIRYETKVESIGRHVDKCVVRDSNGQEYLADKVLLATAPWNAVRIKSDPDWLENREILNSKSVVDADEIRAGAGFIIVQMAFDRQNLFWRGKIPPSSSERTFAVATKSSEMRGFCHLFKE---SHVVDELTVLQSRIFGLAAKVCGELSEEQIIGKVLEKLSCLADRVNQSSPPRPSWY 2299
            GI    +     + +E G +    +D   +F+ N + + +A            S   G  + +L   +R++   S     + +   +L+ +EY    GA +  V      SA +   + F   QF+G       G+  +  RL + LD+R  T V+ +    +   V  + G  Y+ADKVL+ T P   +++      LE    L  + +     + AG   +I ++       FW  KI        F     S + RG   +F +        E  VL S + G +  +  +LS+ Q++ + ++ L  +    N   P R  W+
Sbjct:  356 GIRMHVLGEACELLDESGRVTDPALDKRMDFHFNALLDIIAQWRTTTEPAHDVS--LGEKMEELTHAFRKESGLSFGELEEKLLQFHLANLEYAC--GANLRQV------SARSWDHNEFF-AQFAGDHTLLTAGYSTILHRLAEGLDVRLHTPVKRVDYSGECVKVHTATGMTYIADKVLV-TIPLALMQLGV----LEFCPPLPERKIKALQSLGAG---LIEKIGLQFPFRFWEHKI---RGADYFGHLPPSHDRRGLFGVFYDMDPKSSTGEQCVLMSVVSGDSVALIRDLSDSQVVSQSMQALRAIFPEQNVPDPLR--WF 657          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Sea Lamprey
Match: kdm1a (lysine (K)-specific demethylase 1a [Source:ZFIN;Acc:ZDB-GENE-030131-7828])

HSP 1 Score: 51.9878 bits (123), Expect = 5.728e-7
Identity = 46/134 (34.33%), Postives = 69/134 (51.49%), Query Frame = 1
Query:  727 MDKWEYEFFPTF-SGN--MRNVFIGLRNLMLLLWTADPKRPIT-SSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFG-FPTGLPINIFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL 1113
            M   E   FP   +GN   +  F+ +RN  L LW   PK  +T   +L +  S       A LV+ V + ++ +   G +NFG F    P+ + +      V+VIGAG+SGLAAAR L   G +VT+LE+ + +
Sbjct:   79 MTSQEAACFPDIVNGNPQTQKAFLYIRNRTLQLWLDQPKTQLTFEQMLQQLESPYN--SDAQLVHRVFNYLERH---GLINFGIFKRVKPLPVKK---VGKVMVIGAGVSGLAAARQLQSFGMDVTILEARDRV 204          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Medaka
Match: KDM1B (lysine demethylase 1B [Source:NCBI gene;Acc:101172091])

HSP 1 Score: 75.485 bits (184), Expect = 1.269e-13
Identity = 35/118 (29.66%), Postives = 62/118 (52.54%), Query Frame = 2
Query:   65 QKNVKYCPDPTCNNLIPICCLFLNTECSDNG--AKWYHLSAGEHVCSVCYNHLHSFFSYETENSEIITFKKTWLGQSQETPTIHDYITSTLLSNWYLCN--ECNKWRQVSRDIYLTPS 406
            +K  + C    C+ + P+C    +  C+ NG  ++WYHLS GEH C+ C++H +   S++        +KK W    +  P++  ++    L  W  C   +C KWRQ++++  LTP+
Sbjct:   38 EKKYRKCEKAGCSAVYPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYR--SHKDGYETFAEWKKVWTSNGKSEPSLKAFMADQQLPFWVQCTKPDCRKWRQLTKEAQLTPA 153          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Medaka
Match: KDM1B (lysine demethylase 1B [Source:NCBI gene;Acc:101172091])

HSP 1 Score: 75.0998 bits (183), Expect = 1.981e-13
Identity = 35/118 (29.66%), Postives = 62/118 (52.54%), Query Frame = 2
Query:   65 QKNVKYCPDPTCNNLIPICCLFLNTECSDNG--AKWYHLSAGEHVCSVCYNHLHSFFSYETENSEIITFKKTWLGQSQETPTIHDYITSTLLSNWYLCN--ECNKWRQVSRDIYLTPS 406
            +K  + C    C+ + P+C    +  C+ NG  ++WYHLS GEH C+ C++H +   S++        +KK W    +  P++  ++    L  W  C   +C KWRQ++++  LTP+
Sbjct:   64 EKKYRKCEKAGCSAVYPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYR--SHKDGYETFAEWKKVWTSNGKSEPSLKAFMADQQLPFWVQCTKPDCRKWRQLTKEAQLTPA 179          

HSP 2 Score: 53.1434 bits (126), Expect = 1.098e-6
Identity = 59/206 (28.64%), Postives = 103/206 (50.00%), Query Frame = 1
Query:  649 GFMKTFNPFSKESNTQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPTGLPINIFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL---VENNKSVSLKLKSFDCLNEIYGSINNPFSFMSYQVYFLLIELVDFNEF 1257
            G  + F PF  + N       + P  M+  E   FP FS +   +++ LRNL+L  W  + K+ +TS   ++ I +RG+V+V   V  +  ++   +  G +N G        + E +  ++VI+IGAG +GLAAAR L   G  V VLE+ + +   V ++ S+ + +     +  + G +NNP + M  Q+   + +L +  E 
Sbjct:  274 GLSQYFQPFY-QPNECGKALCVRPDMMELDELYEFPEFSRDP-TMYLALRNLILASWHRNCKKVLTSEKCSQHIIVRGLVRVRC-VQELDRVLHFMTRKGLINTGVLRVERPLLPEGYRSKNVIIIGAGAAGLAAARQLQNFGTAVVVLEARDRIGGRVWDDTSLGVMVGRGAQI--VNGCVNNPIALMCEQMDIKMHKLGERCEL 474          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Medaka
Match: kdm1a (lysine demethylase 1A [Source:NCBI gene;Acc:101172293])

HSP 1 Score: 53.1434 bits (126), Expect = 1.292e-6
Identity = 42/132 (31.82%), Postives = 62/132 (46.97%), Query Frame = 1
Query:  727 MDKWEYEFFPTFSG---NMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPTGLPINIFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL 1113
            M   E   FP   G     + VF+ +RN  L LW  +PK  +T     + +        A+LV+ +   ++ +   G +NFG      +          VIVIG G+SGLAAAR L   G +VTVLE+ + +
Sbjct:  161 MTSQEAACFPDIIGGPQQTQKVFLYIRNRTLQLWLDNPKIQLTFEATVQQLDA-PYNSDAVLVHRIHSYLERH---GLINFGIYKR--VKPLPAKKTGKVIVIGGGVSGLAAARQLQSFGMDVTVLEARDRV 286          
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Medaka
Match: kdm1a (lysine demethylase 1A [Source:NCBI gene;Acc:101172293])

HSP 1 Score: 53.1434 bits (126), Expect = 1.318e-6
Identity = 42/132 (31.82%), Postives = 62/132 (46.97%), Query Frame = 1
Query:  727 MDKWEYEFFPTFSG---NMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPTGLPINIFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSL 1113
            M   E   FP   G     + VF+ +RN  L LW  +PK  +T     + +        A+LV+ +   ++ +   G +NFG      +          VIVIG G+SGLAAAR L   G +VTVLE+ + +
Sbjct:  185 MTSQEAACFPDIIGGPQQTQKVFLYIRNRTLQLWLDNPKIQLTFEATVQQLDA-PYNSDAVLVHRIHSYLERH---GLINFGIYKR--VKPLPAKKTGKVIVIGGGVSGLAAARQLQSFGMDVTVLEARDRV 310          
BLAST of Lysine specific histone demethylase 1B vs. Planmine SMEST
Match: SMESG000065059.1 (SMESG000065059.1)

HSP 1 Score: 791.956 bits (2044), Expect = 0.000e+0
Identity = 386/386 (100.00%), Postives = 386/386 (100.00%), Query Frame = 2
Query: 1337 CGIETREISTNISIFNEDGSIISDEVDEFYQNLVYNFVAYLMNGASIIKYSSQFAGCSVADLYQNYRRDRINSEFAGNDGVESIYLSEIEYRVFGGAAMETVPRNVEMSAVNRGISNFSCKQFSGSTMEPVNGWGELFTRLVDNLDIRYETKVESIGRHVDKCVVRDSNGQEYLADKVLLATAPWNAVRIKSDPDWLENREILNSKSVVDADEIRAGAGFIIVQMAFDRQNLFWRGKIPPSSSERTFAVATKSSEMRGFCHLFKESHVVDELTVLQSRIFGLAAKVCGELSEEQIIGKVLEKLSCLADRVNQSSPPRPSWYQIIRIENASLACTDIGNAFNKLAISNRFQNEIFVTNKTMIAEPINLSNSFCVGMDAASTIIKTIL 2494
            CGIETREISTNISIFNEDGSIISDEVDEFYQNLVYNFVAYLMNGASIIKYSSQFAGCSVADLYQNYRRDRINSEFAGNDGVESIYLSEIEYRVFGGAAMETVPRNVEMSAVNRGISNFSCKQFSGSTMEPVNGWGELFTRLVDNLDIRYETKVESIGRHVDKCVVRDSNGQEYLADKVLLATAPWNAVRIKSDPDWLENREILNSKSVVDADEIRAGAGFIIVQMAFDRQNLFWRGKIPPSSSERTFAVATKSSEMRGFCHLFKESHVVDELTVLQSRIFGLAAKVCGELSEEQIIGKVLEKLSCLADRVNQSSPPRPSWYQIIRIENASLACTDIGNAFNKLAISNRFQNEIFVTNKTMIAEPINLSNSFCVGMDAASTIIKTIL
Sbjct:  395 CGIETREISTNISIFNEDGSIISDEVDEFYQNLVYNFVAYLMNGASIIKYSSQFAGCSVADLYQNYRRDRINSEFAGNDGVESIYLSEIEYRVFGGAAMETVPRNVEMSAVNRGISNFSCKQFSGSTMEPVNGWGELFTRLVDNLDIRYETKVESIGRHVDKCVVRDSNGQEYLADKVLLATAPWNAVRIKSDPDWLENREILNSKSVVDADEIRAGAGFIIVQMAFDRQNLFWRGKIPPSSSERTFAVATKSSEMRGFCHLFKESHVVDELTVLQSRIFGLAAKVCGELSEEQIIGKVLEKLSCLADRVNQSSPPRPSWYQIIRIENASLACTDIGNAFNKLAISNRFQNEIFVTNKTMIAEPINLSNSFCVGMDAASTIIKTIL 780          

HSP 2 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 266/267 (99.63%), Postives = 267/267 (100.00%), Query Frame = 1
Query:  415 QFSCKALLQNAFNPCSFPEDQRIDFIRNHPASFFESIKYTVYLGTSPYLDVYDEYSLDTVGISPIAEPIDFDIGDCCEGFMKTFNPFSKESNTQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPTGLPINIFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSLVENNKSVSLKLKSFDCLNEIYGSINNPFSFMSYQ 1215
            +FSCKALLQNAFNPCSFPEDQRIDFIRNHPASFFESIKYTVYLGTSPYLDVYDEYSLDTVGISPIAEPIDFDIGDCCEGFMKTFNPFSKESNTQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPTGLPINIFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSLVENNKSVSLKLKSFDCLNEIYGSINNPFSFMSYQ
Sbjct:  128 KFSCKALLQNAFNPCSFPEDQRIDFIRNHPASFFESIKYTVYLGTSPYLDVYDEYSLDTVGISPIAEPIDFDIGDCCEGFMKTFNPFSKESNTQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVFIGLRNLMLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYVNFGFPTGLPINIFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESSNSLVENNKSVSLKLKSFDCLNEIYGSINNPFSFMSYQ 394          

HSP 3 Score: 288.5 bits (737), Expect = 4.832e-85
Identity = 128/132 (96.97%), Postives = 128/132 (96.97%), Query Frame = 2
Query:   35 MHLLGLELTKQKNVKYCPDPTCNNLIPICCLFLNTECSDNGAKWYHLSAGEHVCSVCYNHLHSFFSYETENSEIITFKKTWLGQSQETPTIHDYITSTLLSNWYLCNECNKWRQVSRDIYLTPSEISNSHVK 430
            MHLLGLELTKQKNVKYCPDPTCNNLIPICCLFLNTECSDNGAKWYHLSAGEHVCSVCYNHLHSFFSYETENSEIITFKKTWLGQSQETPTIHDYITSTLLSNWYLCNECNKWRQVSRDIYLTPSEIS    K
Sbjct:    1 MHLLGLELTKQKNVKYCPDPTCNNLIPICCLFLNTECSDNGAKWYHLSAGEHVCSVCYNHLHSFFSYETENSEIITFKKTWLGQSQETPTIHDYITSTLLSNWYLCNECNKWRQVSRDIYLTPSEISKFSCK 132          
The following BLAST results are available for this feature:
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
KDM1B1.297e-3532.48lysine demethylase 1B [Source:HGNC Symbol;Acc:HGNC... [more]
KDM1B1.124e-2532.48lysine demethylase 1B [Source:HGNC Symbol;Acc:HGNC... [more]
KDM1B1.576e-1332.48lysine demethylase 1B [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
amx-18.713e-1024.73Amine oxidase family member 1 [Source:UniProtKB/S... [more]
back to top
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Su(var)3-39.518e-629.09gene:FBgn0260397 transcript:FBtr0074826[more]
Su(var)3-39.518e-629.09gene:FBgn0260397 transcript:FBtr0074825[more]
back to top
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
kdm1a1.789e-733.91lysine (K)-specific demethylase 1a [Source:ZFIN;Ac... [more]
kdm1a1.887e-733.91lysine (K)-specific demethylase 1a [Source:ZFIN;Ac... [more]
back to top
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfge83.801e-3628.22milk fat globule-EGF factor 8 protein [Source:Xenb... [more]
mfge81.920e-3527.87milk fat globule-EGF factor 8 protein [Source:Xenb... [more]
mfge81.210e-3428.21milk fat globule-EGF factor 8 protein [Source:Xenb... [more]
mfge81.240e-3428.21milk fat globule-EGF factor 8 protein [Source:Xenb... [more]
mfge86.280e-3130.77milk fat globule-EGF factor 8 protein [Source:Xenb... [more]
back to top
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Kdm1b7.077e-3729.55lysine (K)-specific demethylase 1B [Source:MGI Sym... [more]
Kdm1b2.876e-1529.55lysine (K)-specific demethylase 1B [Source:MGI Sym... [more]
Kdm1b2.426e-631.75lysine (K)-specific demethylase 1B [Source:MGI Sym... [more]
back to top
BLAST of Lysine specific histone demethylase 1B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q8CIG3|KDM1B_MOUSE4.308e-3629.55Lysine-specific histone demethylase 1B OS=Mus musc... [more]
sp|Q8NB78|KDM1B_HUMAN5.719e-3532.48Lysine-specific histone demethylase 1B OS=Homo sap... [more]
sp|Q21988|AMX1_CAEEL1.108e-824.73Amine oxidase family member 1 OS=Caenorhabditis el... [more]
sp|Q9CAE3|FLD_ARATH9.169e-727.53Protein FLOWERING LOCUS D OS=Arabidopsis thaliana ... [more]
back to top
BLAST of Lysine specific histone demethylase 1B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B7ACG41.161e-4027.84Amine oxidase OS=Arion vulgaris OX=1028688 GN=ORF1... [more]
H3AB838.054e-4029.20Lysine demethylase 1B OS=Latimeria chalumnae OX=78... [more]
A0A3Q2CQ871.860e-3830.70Lysine demethylase 1B OS=Cyprinodon variegatus OX=... [more]
M4AP242.402e-3631.62Lysine demethylase 1B OS=Xiphophorus maculatus OX=... [more]
A0A384C9D38.842e-3632.48Lysine demethylase 1B OS=Ursus maritimus OX=29073 ... [more]
back to top
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KDM1B1.630e-3428.32lysine demethylase 1B [Source:NCBI gene;Acc:103045... [more]
KDM1B3.164e-2328.62lysine demethylase 1B [Source:NCBI gene;Acc:103045... [more]
kdm1a3.045e-632.74lysine demethylase 1A [Source:NCBI gene;Acc:103023... [more]
kdm1a3.557e-632.74lysine demethylase 1A [Source:NCBI gene;Acc:103023... [more]
kdm1a3.653e-632.74lysine demethylase 1A [Source:NCBI gene;Acc:103023... [more]
back to top
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
KDM1B2.018e-3728.91lysine demethylase 1B [Source:HGNC Symbol;Acc:HGNC... [more]
KDM1B4.557e-3628.91lysine demethylase 1B [Source:HGNC Symbol;Acc:HGNC... [more]
KDM1B2.818e-3327.31lysine demethylase 1B [Source:HGNC Symbol;Acc:HGNC... [more]
kdm1a5.728e-734.33lysine (K)-specific demethylase 1a [Source:ZFIN;Ac... [more]
back to top
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lysine specific histone demethylase 1B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
KDM1B1.269e-1329.66lysine demethylase 1B [Source:NCBI gene;Acc:101172... [more]
KDM1B1.981e-1329.66lysine demethylase 1B [Source:NCBI gene;Acc:101172... [more]
kdm1a1.292e-631.82lysine demethylase 1A [Source:NCBI gene;Acc:101172... [more]
kdm1a1.318e-631.82lysine demethylase 1A [Source:NCBI gene;Acc:101172... [more]
back to top
BLAST of Lysine specific histone demethylase 1B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000065059.14.832e-85100.00SMESG000065059.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001661 ID=SMED30001661|Name=Lysine specific histone demethylase 1B|organism=Schmidtea mediterranea sexual|type=transcript|length=2516bp
ACATGACTTTTATGAAACCTAATTTTTTAGTGATATGCATCTTCTAGGTC
TCGAGTTGACGAAGCAAAAAAATGTAAAGTATTGTCCAGATCCTACTTGT
AATAATCTTATACCAATTTGCTGCTTGTTTCTTAATACAGAATGTTCAGA
CAATGGTGCAAAATGGTATCACCTATCAGCCGGTGAACACGTATGCTCTG
TGTGCTATAATCACTTGCATTCATTTTTTTCTTATGAAACAGAGAATTCA
GAAATTATCACATTTAAAAAAACTTGGTTAGGGCAATCTCAAGAAACTCC
TACAATACACGATTACATTACAAGCACATTATTATCAAATTGGTATTTAT
GTAATGAATGTAATAAATGGCGGCAAGTTAGTCGAGACATATATCTGACA
CCATCGGAAATTAGCAATTCTCATGTAAAGCTCTGCTACAGAATGCATTT
AATCCTTGCTCATTTCCTGAAGATCAAAGAATCGATTTCATCAGAAATCA
TCCGGCTTCATTTTTTGAATCAATAAAATACACGGTCTATCTGGGAACGT
CACCGTATTTGGATGTTTACGACGAATACTCGCTTGATACAGTTGGAATC
TCACCGATTGCAGAACCGATTGATTTTGATATTGGTGATTGCTGTGAAGG
ATTTATGAAAACCTTCAACCCATTTTCCAAAGAATCTAATACCCAAACTA
CGACAGGATCGATCGATCCAACCGGAATGGATAAATGGGAATACGAATTT
TTCCCGACTTTTTCTGGGAATATGAGAAATGTTTTTATTGGATTGCGCAA
TTTAATGTTGTTACTATGGACAGCGGATCCAAAGCGTCCAATCACCAGCA
GTTTGCTGACGAAATGCATTTCAATTCGAGGCATTGTTAAAGTTGCGCTA
TTGGTAAATTCCGTTCCGGATCTGATAAAGATTTACAGCGGACTTGGATA
TGTAAATTTCGGATTTCCGACCGGATTACCGATCAATATTTTCGAGGATC
ATCCGAAACGAGATGTGATTGTCATCGGAGCTGGTTTGTCTGGATTGGCT
GCTGCTAGACATTTGTCGATGCTCGGGGCCAATGTTACAGTTCTCGAATC
CAGCAATTCGTTGGTAGAAAACAATAAAAGTGTTTCATTGAAATTGAAAT
CTTTCGATTGCTTGAATGAGATTTACGGTTCGATAAATAATCCGTTTTCC
TTCATGTCTTATCAAGTCTATTTTTTATTGATTGAATTGGTTGATTTTAA
TGAATTTTGATATTATTGGCTTTGATTGGTTAAATCTGCCATTGGACAGA
TTTGATTGGATTTTTTTAAAATGATTGTATATTTAGTGTGGAATCGAAAC
TCGGGAAATTTCGACAAATATTTCTATATTCAATGAAGATGGGAGCATTA
TTTCGGATGAGGTGGATGAATTTTATCAAAACCTGGTTTACAATTTCGTC
GCATATTTGATGAATGGCGCATCGATAATAAAGTATTCCAGTCAGTTTGC
TGGCTGTTCCGTGGCGGATCTGTATCAGAATTATCGACGGGATCGGATAA
ATTCGGAGTTTGCTGGAAATGATGGCGTCGAAAGCATTTACTTGTCGGAA
ATCGAATATCGAGTGTTTGGTGGGGCTGCAATGGAGACAGTACCGAGGAA
TGTCGAGATGTCTGCCGTAAATCGCGGTATATCGAATTTTAGTTGCAAAC
AATTCTCGGGCAGCACAATGGAGCCGGTCAATGGATGGGGTGAATTGTTC
ACTAGGCTGGTCGATAATCTCGACATCCGTTACGAAACCAAAGTCGAATC
GATAGGCAGACACGTGGATAAGTGTGTAGTTCGTGATAGCAATGGCCAGG
AATATCTGGCAGATAAAGTGCTGCTTGCAACTGCCCCATGGAACGCTGTC
AGGATCAAGTCGGATCCTGATTGGCTGGAAAACCGGGAAATCCTCAATAG
CAAATCGGTGGTTGATGCGGATGAGATCCGCGCTGGGGCTGGATTTATTA
TCGTTCAGATGGCCTTTGATAGGCAGAACTTGTTCTGGCGTGGCAAAATC
CCCCCGAGCTCATCGGAGAGAACATTTGCAGTTGCAACGAAATCGTCAGA
GATGCGAGGATTCTGTCATTTATTCAAGGAGTCTCACGTTGTCGATGAGT
TAACCGTTCTGCAGTCGAGGATTTTCGGATTGGCCGCAAAAGTTTGTGGG
GAACTGTCGGAGGAACAGATAATAGGAAAAGTATTGGAGAAATTGTCTTG
CCTTGCAGATCGCGTGAATCAATCCAGTCCTCCTCGTCCCAGTTGGTATC
AGATTATCAGAATTGAGAACGCTTCATTGGCTTGCACGGATATTGGAAAT
GCTTTTAATAAGCTGGCAATTTCAAATCGATTTCAGAATGAAATCTTCGT
TACAAACAAAACAATGATAGCCGAACCGATCAATTTATCGAATTCCTTCT
GTGTCGGAATGGATGCCGCCTCCACTATTATAAAGACTATTCTTTAAAAT
AAAGTATTTGTAAATG
back to top

protein sequence of SMED30001661-orf-1

>SMED30001661-orf-1 ID=SMED30001661-orf-1|Name=SMED30001661-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=164bp
MHLLGLELTKQKNVKYCPDPTCNNLIPICCLFLNTECSDNGAKWYHLSAG
EHVCSVCYNHLHSFFSYETENSEIITFKKTWLGQSQETPTIHDYITSTLL
SNWYLCNECNKWRQVSRDIYLTPSEISNSHVKLCYRMHLILAHFLKIKES
ISSEIIRLHFLNQ*
back to top

protein sequence of SMED30001661-orf-2

>SMED30001661-orf-2 ID=SMED30001661-orf-2|Name=SMED30001661-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=346bp
MNGASIIKYSSQFAGCSVADLYQNYRRDRINSEFAGNDGVESIYLSEIEY
RVFGGAAMETVPRNVEMSAVNRGISNFSCKQFSGSTMEPVNGWGELFTRL
VDNLDIRYETKVESIGRHVDKCVVRDSNGQEYLADKVLLATAPWNAVRIK
SDPDWLENREILNSKSVVDADEIRAGAGFIIVQMAFDRQNLFWRGKIPPS
SSERTFAVATKSSEMRGFCHLFKESHVVDELTVLQSRIFGLAAKVCGELS
EEQIIGKVLEKLSCLADRVNQSSPPRPSWYQIIRIENASLACTDIGNAFN
KLAISNRFQNEIFVTNKTMIAEPINLSNSFCVGMDAASTIIKTIL*
back to top

protein sequence of SMED30001661-orf-3

>SMED30001661-orf-3 ID=SMED30001661-orf-3|Name=SMED30001661-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=202bp
MKTFNPFSKESNTQTTTGSIDPTGMDKWEYEFFPTFSGNMRNVFIGLRNL
MLLLWTADPKRPITSSLLTKCISIRGIVKVALLVNSVPDLIKIYSGLGYV
NFGFPTGLPINIFEDHPKRDVIVIGAGLSGLAAARHLSMLGANVTVLESS
NSLVENNKSVSLKLKSFDCLNEIYGSINNPFSFMSYQVYFLLIELVDFNE
F*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR011124Znf_CW
IPR002938FAD-bd
IPR011991WHTH_DNA-bd_dom
IPR023753FAD/NAD-binding_dom
IPR009057Homeobox-like_sf
IPR002937Amino_oxidase
Vocabulary: molecular function
TermDefinition
GO:0071949FAD binding
GO:0016491oxidoreductase activity
GO:0003677DNA binding
GO:0008168methyltransferase activity
GO:0008270zinc ion binding
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0032259methylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.40.100coord: 82..159
e-value: 2.0E-9
score: 39.1
IPR011124Zinc finger, CW-typePFAMPF07496zf-CWcoord: 103..147
e-value: 1.5E-8
score: 34.5
IPR011124Zinc finger, CW-typePROSITEPS51050ZF_CWcoord: 97..150
score: 9.546