SMED30001607

Overview
NameSMED30001607
Smed IDSMED30001607
Length (bp)4069
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30001607 (SMED30001607) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30001607 (SMED30001607) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30001607 (SMED30001607) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30001607 (SMED30001607) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001607

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30001607SMESG000070289.1 SMESG000066561.1 SMESG000037674.1 dd_Smed_v4_6949_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001607 dd_Smed_v4_15845_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30001607 vs. Ensembl Human
Match: RTL1 (retrotransposon Gag like 1 [Source:HGNC Symbol;Acc:HGNC:14665])

HSP 1 Score: 60.077 bits (144), Expect = 9.731e-12
Identity = 46/212 (21.70%), Postives = 97/212 (45.75%), Query Frame = -2
Query:  859 LKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKED-GTETVIAYGSRPMKNDTV--TRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKA 1485
            ++ VL R ++  +  + +K +F+R+   FLG  ++ +G+  N   +  I           LR+F+     ++ F++ ++ IA PL   +     +  W  E  +AF+  K+   + P+L +P+    F L+T      + + L Q+ +  G     A+ SR +    V  ++ E+ ++    +    ++   R++  T+   +I LNT   A
Sbjct:  749 VRQVLVRFRHHNVYCSLDKSQFHRQTVEFLGFVVTPKGVKLNKNVMTIITGYPTPGSKLSLRNFIEFVFPYRHFVERFSIIAEPLVRQLLSS-YQFYWGVEEQEAFECLKRAFRKAPLLHHPKPQNPFYLETGVTGTALHASLIQIDDQTGKRACCAFYSRNISPIEVEYSQAEMKILPIRAA----FMVWCRYLENTEEPIMILLNTEDLA 955          

HSP 2 Score: 31.9574 bits (71), Expect = 9.731e-12
Identity = 14/44 (31.82%), Postives = 27/44 (61.36%), Query Frame = -1
Query: 1496 PFGLATAPATFQRLMHTLLEGIIFKGVIVYLEDILIYGKTIKEH 1627
            PF L+  P   Q ++H +L+ ++   V+ Y +++LIY  + +EH
Sbjct:  702 PFALSPDPIIPQNVIHFILKDMLGFFVLSYGQEVLIYSMSQEEH 745          
BLAST of SMED30001607 vs. Ensembl Human
Match: RTL1 (retrotransposon Gag like 1 [Source:HGNC Symbol;Acc:HGNC:14665])

HSP 1 Score: 60.077 bits (144), Expect = 9.731e-12
Identity = 46/212 (21.70%), Postives = 97/212 (45.75%), Query Frame = -2
Query:  859 LKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKED-GTETVIAYGSRPMKNDTV--TRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKA 1485
            ++ VL R ++  +  + +K +F+R+   FLG  ++ +G+  N   +  I           LR+F+     ++ F++ ++ IA PL   +     +  W  E  +AF+  K+   + P+L +P+    F L+T      + + L Q+ +  G     A+ SR +    V  ++ E+ ++    +    ++   R++  T+   +I LNT   A
Sbjct:  749 VRQVLVRFRHHNVYCSLDKSQFHRQTVEFLGFVVTPKGVKLNKNVMTIITGYPTPGSKLSLRNFIEFVFPYRHFVERFSIIAEPLVRQLLSS-YQFYWGVEEQEAFECLKRAFRKAPLLHHPKPQNPFYLETGVTGTALHASLIQIDDQTGKRACCAFYSRNISPIEVEYSQAEMKILPIRAA----FMVWCRYLENTEEPIMILLNTEDLA 955          

HSP 2 Score: 31.9574 bits (71), Expect = 9.731e-12
Identity = 14/44 (31.82%), Postives = 27/44 (61.36%), Query Frame = -1
Query: 1496 PFGLATAPATFQRLMHTLLEGIIFKGVIVYLEDILIYGKTIKEH 1627
            PF L+  P   Q ++H +L+ ++   V+ Y +++LIY  + +EH
Sbjct:  702 PFALSPDPIIPQNVIHFILKDMLGFFVLSYGQEVLIYSMSQEEH 745          
BLAST of SMED30001607 vs. Ensembl Zebrafish
Match: BX571665.1 (pep chromosome:GRCz11:17:35431724:35437222:1 gene:ENSDARG00000111789.1 transcript:ENSDART00000190293.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX571665.1)

HSP 1 Score: 177.563 bits (449), Expect = 2.438e-44
Identity = 139/475 (29.26%), Postives = 232/475 (48.84%), Query Frame = -2
Query:  604 PRRQPMHLEGKIEVLVKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFST-KDNFVLTGYHLGXXXXXXLFKD*CILSWKALFLKEL*YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTET-VIAYGSRPM----KNDTVTRKELLVINEYVSYFKQYLYG--KRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGEKTRHENA----KEAKARVKHICMFQKTEVMHRV-----FEAQESNKQFEKMKKCVNNGNFDKKDVLFKL 1977
            P  QP H +   E + ++L K G IR   S  +A    V KKDGS+R C+DYRGL  IT    +P+      L+ L  ++Y++ +DL  AY  V I    +  TAFST + ++  T    G      +F+     S+     +++   W + +++    K  +  ++ VL R+    L    EKCEF++ +  FLG+ IS EGI  +D K++ ++     +  K+L+ FLG  N+++RFI+ ++ IA PL A       K++WS E   AF   K      PIL +P  +  FI++ DA    +G+VLSQ +   ++    A+ SR +    +N  V  +ELL +   +  ++ +L G  ++F + TDHK L +L + K+  NP+   W    + +DF +  R G K    +A     E K  +    +     ++  V      E QE+N++      C N+  F   ++  +L
Sbjct:  523 PLSQPEH-KAMSEYIDEELAK-GFIRPSTSPASAGFFFVKKKDGSLRPCIDYRGLNEITVKFRYPLPLVPPALEQLRKARYYTKLDLRSAYNLVRIRAGDEWKTAFSTTRGHYEYTVMPFGLSNCPSVFQ-----SFMNDVFRDMLDRW-VIIYSNTM-KEHVEHVRMVLQRMIQHRLYAKLEKCEFHQTQIAFLGYVISAEGITMDDTKVQAVQRWPLPQNLKELQRFLGFANFYRRFIRGFSSIAAPLTAMTKRNSHKLSWSSEARQAFSDLKTQFTTAPILRHPNPDLPFIVEVDASNTGVGAVLSQRQGQPSKMYPCAFFSRKLTSAERNYDVGNRELLAMKLALEEWRHWLEGASQQFTILTDHKNLEYLRSAKRL-NPRQARWALFFTRFDFIVTYRPGSKNSKADALSRLSEDKTPISDETIIPTNLLVAPVQWDILTEIQEANRENNPPVDCPNHLIFVPNNIRTRL 987          
BLAST of SMED30001607 vs. Ensembl Zebrafish
Match: CR354395.2 (pep chromosome:GRCz11:12:13553730:13556536:-1 gene:ENSDARG00000101547.2 transcript:ENSDART00000166396.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR354395.2)

HSP 1 Score: 174.866 bits (442), Expect = 5.041e-44
Identity = 138/475 (29.05%), Postives = 228/475 (48.00%), Query Frame = -2
Query:  604 PRRQPMHLEGKIEVLVKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFST-KDNFVLTGYHLGXXXXXXLFKD*CILSWKALFLKEL*YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTET-VIAYGSRPM----KNDTVTRKELLVINEYVSYFKQYLYG--KRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGEKTRHENA----KEAKARVKHICMFQKTEVMHRV-----FEAQESNKQFEKMKKCVNNGNFDKKDVLFKL 1977
            P  QP H +   E + ++L K G IR   S  +A    V KKDGS+R C+DYRGL  IT    +P+      L+ L  ++Y++ +DL  AY  V I    +  TAFST + ++  T    G      +F+      ++ +  + +       L      K  +  ++ VL R+    L    EKCEF++ +  FLG+ IS EGI  +D K++ ++     +  K+L+ FLG  N+++RFI+ ++ IA PL A       K++WS E   AF   K      PIL +P  +  FI++ DA    +G+VLSQ +   ++    A+ SR +    +N  V  +ELL +   +  ++ +L G  ++F + TDHK L +L + K+  NP+   W    + +DF +  R G K    +A     E K  +    +     ++  V      E QE+N++      C N+  F   ++  +L
Sbjct:  181 PLSQPEH-KAMSEYIDEELAK-GFIRPSTSPASAGFFFVKKKDGSLRPCIDYRGLNEITVKFRYPLPLVPPALEQLRKARYYTKLDLRSAYNLVRIRAGDEWKTAFSTTRGHYEYTVMPFGLSNCPSVFQSFMNDVFRDMLDRWVIIYIDDILIYSNTMKEHVEHVRMVLQRMIQHRLYAKLEKCEFHQTQIAFLGYVISAEGITMDDTKVQAVQRWPLPQNLKELQRFLGFANFYRRFIRGFSSIAAPLTAMTKRNSHKLSWSSEARQAFSDLKTQFTTAPILRHPNPDLPFIVEVDASNTGVGAVLSQRQGQPSKMYPCAFFSRKLTSAERNYDVGNRELLAMKLALEEWRHWLEGASQQFTILTDHKNLEYLLSAKRL-NPRQARWALFFTRFDFIVTYRPGSKNSKADALSRLSEDKTPISDETIIPTNLLVAPVQWDILTEIQEANRENNPPVDCPNHLIFVPNNIRTRL 652          
BLAST of SMED30001607 vs. Ensembl Zebrafish
Match: CR533578.3 (pep chromosome:GRCz11:16:23466094:23471387:-1 gene:ENSDARG00000115891.1 transcript:ENSDART00000180899.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR533578.3)

HSP 1 Score: 175.637 bits (444), Expect = 1.101e-43
Identity = 138/475 (29.05%), Postives = 228/475 (48.00%), Query Frame = -2
Query:  604 PRRQPMHLEGKIEVLVKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFST-KDNFVLTGYHLGXXXXXXLFKD*CILSWKALFLKEL*YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTET-VIAYGSRPM----KNDTVTRKELLVINEYVSYFKQYLYG--KRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGEKTRHENA----KEAKARVKHICMFQKTEVMHRV-----FEAQESNKQFEKMKKCVNNGNFDKKDVLFKL 1977
            P  QP H +   E + ++L K G IR   S  +A    V KKDGS+R C+DYRGL  IT    +P+      L+ L  ++Y++ +DL  AY  V I    +  TAFST + ++  T    G      +F+      ++ +  + +       L      K  +  ++ VL R+    L    EKCEF++ +  FLG+ IS EGI  +D K++ ++     +  K+L+ FLG  N+++RFI+ ++ IA PL A       K++WS E   AF   K      PIL +P  +  FI++ DA    +G+VLSQ +   ++    A+ SR +    +N  V  +ELL +   +  ++ +L G  ++F + TDHK L +L + K+  NP+   W    + +DF +  R G K    +A     E K  +    +     ++  V      E QE+N++      C N+  F   ++  +L
Sbjct:  523 PLSQPEH-KAMSEYIDEELAK-GFIRPSTSPASAGFFFVKKKDGSLRPCIDYRGLNEITVKFRYPLPLVPPALEQLRKARYYTKLDLRSAYNLVRIRAGDEWKTAFSTTRGHYEYTVMPFGLSNCPSVFQSFMNDVFRDMLDRWVIIYIDDILIYSNTMKEHVEHVRMVLQRMIQHRLYAKLEKCEFHQTQIAFLGYVISAEGITMDDTKVQAVQRWPLPQNLKELQRFLGFANFYRRFIRGFSSIAAPLTAMTKRNSHKLSWSSEARQAFSDLKTQFTTAPILRHPNPDLPFIVEVDASNTGVGAVLSQRQGQPSKMYPCAFFSRKLTSAERNYDVGNRELLAMKLALEEWRHWLEGASQQFTILTDHKNLEYLRSAKRL-NPRQARWALFFTRFDFIVTYRPGSKNSKADALSRLSEDKTPISDETIIPTNLLVAPVQWDILTEIQEANRENNPPVDCPNHLIFVPNNIRTRL 994          
BLAST of SMED30001607 vs. Ensembl Zebrafish
Match: CU929458.1 (pep chromosome:GRCz11:11:43363075:43368382:1 gene:ENSDARG00000114395.1 transcript:ENSDART00000179934.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CU929458.1)

HSP 1 Score: 174.096 bits (440), Expect = 2.696e-43
Identity = 138/475 (29.05%), Postives = 228/475 (48.00%), Query Frame = -2
Query:  604 PRRQPMHLEGKIEVLVKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFST-KDNFVLTGYHLGXXXXXXLFKD*CILSWKALFLKEL*YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTET-VIAYGSRPM----KNDTVTRKELLVINEYVSYFKQYLYG--KRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGEKTRHENA----KEAKARVKHICMFQKTEVMHRV-----FEAQESNKQFEKMKKCVNNGNFDKKDVLFKL 1977
            P  QP H +   E + ++L K G IR   S  +A    V KKDGS+R C+DYRGL  IT    +P+      L+ L  ++Y++ +DL  AY  V I    +  TAFST + ++  T    G      +F+      ++ +  + +       L      K  +  ++ VL R+    L    EKCEF++ +  FLG+ IS EGI  +D K++ ++     +  K+L+ FLG  N+++RFI+ ++ IA PL A       K++WS E   AF   K      PIL +P  +  FI++ DA    +G+VLSQ +   ++    A+ SR +    +N  V  +ELL +   +  ++ +L G  ++F + TDHK L +L + K+  NP+   W    + +DF +  R G K    +A     E K  +    +     ++  V      E QE+N++      C N+  F   ++  +L
Sbjct:  523 PLSQPEH-KAMSEYIDEELAK-GFIRPSTSPASAGFFFVKKKDGSLRPCIDYRGLNEITVKFRYPLPLVPPALEQLRKARYYTKLDLRSAYNLVRIRAGDEWKTAFSTTRGHYEYTVMPFGLSNCPSVFQSFMNDVFRDMLDRWVIIYIDDILIYSNTMKEHVEHVRIVLQRMIQHRLYAKLEKCEFHQTQIAFLGYVISAEGITMDDTKVQAVQRWPLPQNLKELQRFLGFANFYRRFIRGFSSIAAPLTAMTKRNSHKLSWSSEARQAFCDLKTQFTTAPILRHPNPDLPFIVEVDASNTGVGAVLSQRQGQPSKMYPCAFFSRKLTSAERNYDVGNRELLAMKLALEEWRHWLEGASQQFTILTDHKNLEYLRSAKRL-NPRQARWALFFTRFDFIVTYRPGSKNSKADALSRLSEDKTPISDETIIPTNLLVAPVQWDILTEIQEANRENNPPVDCPNHLIFVPNNIRTRL 994          
BLAST of SMED30001607 vs. Ensembl Zebrafish
Match: BX511224.1 (pep chromosome:GRCz11:2:18017000:18022765:1 gene:ENSDARG00000113243.1 transcript:ENSDART00000186877.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX511224.1)

HSP 1 Score: 173.326 bits (438), Expect = 5.233e-43
Identity = 124/420 (29.52%), Postives = 205/420 (48.81%), Query Frame = -2
Query:  763 MHAPRRQPMHLEGKIEVLVKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFST-KDNFVLTGYHLGXXXXXXLFKD*CILSWKAL--FLKEL*YIW--RIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLK-EDGTETVIAYGSRPM----KNDTVTRKELLVINEYVSYFKQYLYGK--RFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGEKTRHENA 1986
            +  P R+ M      E  + D + A +IR   S   A    V KKDGS+R C+DYRGL SIT   ++P+       + L  + +F+ +DL  AY+ V I P  +  TAF+T + +F       G      +F+    L    L   + +  Y++   I +F+    +  I  ++ VL R+   GL +  EKC F+ +   FLGH +S EG+  + +KI+ + N       K L+ FLG  N+++RFI +++++A PL  ++T  +    WS   + AF   K      PIL  P  +R F+++ DA    +G++LSQ    DG     AY S  +    +N  +  +ELL +   +  ++ +L G    F+V TDHK L ++ + K+  + Q + W      ++F +  R G K    +A
Sbjct:  532 LSVPEREAM------EKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNSITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVCIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQ---ALVNDVLRDMIDQFIYVYLDDILIFSHSL-QEHIQHVRRVLQRLLENGLYVKAEKCVFHAQSVQFLGHIVSVEGMRMDPEKIQAVVNWPTPDSRKALQRFLGFANFYRRFIHNFSQLAAPL-TSLTSSKTPFRWSSAAEAAFSKLKGCFVSAPILIAPDPSRQFVVEVDASEVGVGAILSQRSASDGKVHPCAYFSHRLSSAERNYDIGNRELLAVKLALEEWRHWLEGSGVPFIVWTDHKNLEYIKSAKRLNSRQAR-WALFFGRFNFTISYRPGSKNIKPDA 939          
BLAST of SMED30001607 vs. Ensembl Xenopus
Match: anxa6 (annexin A6 [Source:Xenbase;Acc:XB-GENE-989741])

HSP 1 Score: 208.379 bits (529), Expect = 2.917e-55
Identity = 137/429 (31.93%), Postives = 221/429 (51.52%), Query Frame = -2
Query:  763 EMKINRG---PIMHAPRRQPMHLEGKIEVLVKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFSTKDN-FVLTGYHLGXXXXXXLFKD*C--ILSWKALFLKEL*YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKK--ITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGSR---PMKNDTVT-RKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGEKTRHENA 2013
            E K++ G   PI     R    +  +++  + +++  GVI    S W + +V+V KKDGS R CVDYR L  +T  +++PM     LLD L ++KY +++DL + Y+Q+ + P  QE +AF T    +  T    G +     F+     +L     F +   Y+  I +F++   +  +  L+ V  +IQ+AGL + PEKC     +  +LGH +    +  +  K+E I      K  KQ+ +FLG + Y+++FI +Y+ +A PL   +T  ++   I W+ E + A    K+ +  +P+L  P  +R FIL TDA    +G+VLSQ+   G E  +AY SR   P +    T  KE L I   +   + YLYG+ F V TDH  L +L       N +   W   L +Y+F +++RKG++  H NA
Sbjct:  327 EHKVDTGTQLPIRSPAYRVAEAVRPEMKSQIDEMLAFGVITPSHSPWASPVVLVPKKDGSTRFCVDYRRLNDVTTTDAYPMPRVDELLDRLGNAKYLTTLDLSRGYWQIPLAPSAQEKSAFLTPFGLYQFTVMPFGMRNAPATFQRLVNRLLEGMQDFAQA--YLDDIAVFSQTW-EEHLQHLQRVFAQIQDAGLTLKPEKCHLAMAEVQYLGHRVGGGQLRPDPAKVEAICQWPIPKTQKQVLAFLGTSGYYRKFIPNYSTVAKPL-TDLTSRQRSRTIVWTPECESAMNALKQALASSPVLAAPDFSRRFILQTDASNFGLGAVLSQVNTYGEEHPVAYLSRKLLPREAAYATIEKECLAIVWALQKLQPYLYGREFTVVTDHNPLSWLQRV-SGDNGKLLRWSLLLQQYNFTIQHRKGKE--HHNA 748          
BLAST of SMED30001607 vs. Ensembl Xenopus
Match: ENSXETT00000006041.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:37317867:37322724:1 gene:ENSXETG00000003070.1 transcript:ENSXETT00000006041.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 180.259 bits (456), Expect = 4.806e-45
Identity = 127/420 (30.24%), Postives = 205/420 (48.81%), Query Frame = -2
Query:  763 VKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFSTKDNFV-LTGYHLGXXXXXXLFKD*CILSWKALFLKE-L*YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPL------YAAITGCEKKIT-----------------WSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGSRPM----KNDTVTRKELLVIN-EYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGEKTRHENA 1932
            +++L  AG+I++ +S + + +V+V KK+GSIRMCVDYR L   T  + +        L+ L  SK+FS +DL   YYQ+ + PE +E TAF     F        G       F+     +   + L E L Y+  + +F     ++   +LK V  R++  GLK++PEKC+F +    ++GH +S EGI T+  KIE + +    +   +LRSFLG   Y++RF+K ++K+A PL         + G ++ I                  W++E D AF   K  +   P+L Y    + + L  DA    +G +L Q + +     +A+ SR +    +N    + E L +    V    +YLYG  F V+TD+  L ++ TT K  +     W+A L+ Y F L+ R G   R  + 
Sbjct:  346 LEELKAAGIIKESRSPYASPIVVVRKKNGSIRMCVDYRTLNQRTIPDQYTTPRIEDALNCLVGSKWFSVLDLRSGYYQLPMHPEDKEKTAFICPLGFFEFNRMPQGLCGAPATFQRLMERTVGDMHLLEVLVYLDDLIVFGRTLEEHEQRLLK-VFDRLEKEGLKLSPEKCQFCQPSVNYVGHVVSAEGIATDPSKIEAVSSWPKPRTITELRSFLGFCGYYRRFVKGFSKVAQPLNQLLQSNTEVEGSDRDILAKRLRGQGWTRESIEDFWTEECDKAFDQLKYCLTHAPVLAYADATKPYTLHIDASREGLGGILYQ-EYNKELRPVAFISRSLSPSERNYPAHKLEFLALKWAVVDKLHEYLYGAEFEVQTDNNPLTYILTTAKL-DATGHRWLAALAHYKFSLRYRPGRDNRDADG 762          

HSP 2 Score: 58.5362 bits (140), Expect = 8.780e-8
Identity = 26/53 (49.06%), Postives = 39/53 (73.58%), Query Frame = -1
Query: 1493 GQFCFNRLPFGLATAPATFQRLMHTLLEGIIFKGVIVYLEDILIYGKTIKEHD 1651
            G F FNR+P GL  APATFQRLM   +  +    V+VYL+D++++G+T++EH+
Sbjct:  441 GFFEFNRMPQGLCGAPATFQRLMERTVGDMHLLEVLVYLDDLIVFGRTLEEHE 493          
BLAST of SMED30001607 vs. Ensembl Xenopus
Match: ENSXETT00000024810.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV464121.1:1437:3201:1 gene:ENSXETG00000014958.1 transcript:ENSXETT00000024810.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 136.732 bits (343), Expect = 3.403e-39
Identity = 88/260 (33.85%), Postives = 125/260 (48.08%), Query Frame = -2
Query:  721 LKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKK-ITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGSRPMKNDTVT----RKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGEKTRHENAKEAKARVKHICMFQ 1485
            L+ VL RI+ AGL + P KC F   +  +LGH +    +     K+E I N       KQ+ +FLG   Y++RFI +Y+ IA PL    +    + +TW+ E   A    K  +   P+L  P  +R FI+ TDA    IG+VLSQ+ E G E  I Y SR +    V      KE L I   +   + YL+G  F V TDH  L +L       N +   W   L +++F +++RKG  + H NA     R    C  Q
Sbjct:   56 LQRVLERIRQAGLTLKPGKCHFGMAEVQYLGHRVGSGRVMPEPAKVEVIVNWPTPTTQKQVLAFLGTAGYYRRFIPNYSAIAKPLTDLTSKRRPRVVTWTPECATAMSALKSALVNAPVLYAPDFSRGFIVHTDASTYGIGAVLSQVDEKGGEHPIIYLSRKLLPREVAYATIEKECLAIVWALKKLQPYLFGSAFTVVTDHNPLSWLQRV-SGDNGKLLRWSLALQQFNFTIQHRKG--SHHGNADGLSRRDGEDCTGQ 312          

HSP 2 Score: 47.7506 bits (112), Expect = 3.403e-39
Identity = 22/45 (48.89%), Postives = 31/45 (68.89%), Query Frame = -1
Query: 1496 LPFGLATAPATFQRLMHTLLEGIIFKGVIVYLEDILIYGKTIKEH 1630
            +PFG+  APATFQR+++ LLEG   +    YL+DI I+  T +EH
Sbjct:    9 MPFGMKNAPATFQRVVNQLLEGCQ-EFAQAYLDDIAIFSNTWEEH 52          
BLAST of SMED30001607 vs. Ensembl Xenopus
Match: ENSXETT00000035398.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:9869556:9871940:-1 gene:ENSXETG00000011182.1 transcript:ENSXETT00000035398.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.591 bits (366), Expect = 4.735e-35
Identity = 115/399 (28.82%), Postives = 184/399 (46.12%), Query Frame = -2
Query:  763 VKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFSTKD-NFVLTGYHLGXXXXXXLFKD*CILSWKALFLKEL*-YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQL-KEDGTETVIAYGSRPM----KNDTVTRKELLVINEYVSYFKQYLYGKRFMVR--TDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGEKTRHENA 1932
            + + ++ G IR   S   A    V KKDG +R C+DYRGL  IT    +P+     L D L  +K FS +DL  AY  + I    +  TAF+T+D ++       G      +F++     ++ L  K +  Y+  I +F++    +   + K  L+R++   L    EKC F   K  FLG+ IS  G   +  K+  I+     +  K ++ F+G  NY+++FIK ++    P+ + I    +   W     +AFQ  K       +L +P  +  F ++ DA     G++LSQ    DG     AY S+      +N  +  +ELL +   +  ++  L G    V   TDHK L FL + K+ +NP+   W    S + F L  R G K R  +A
Sbjct:   22 ISENLQRGFIRPSTSPAGAGFFFVEKKDGGLRPCIDYRGLNKITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQEFVNDIFRDLLGKSVVVYLDDILIFSQDLETHRSQV-KEALSRLRENSLFAKLEKCTFEVPKISFLGYIISSRGFEMDPAKVSAIQKWPLPQSTKAIQRFIGFANYYRQFIKGFSSRIAPILSLIRKGGRPNCWPPVALEAFQSLKDAFISASVLRHPEPHLPFFIEVDASDVGAGAILSQRHSADGKLHPCAYFSKKFSSAEQNYDIGNRELLAVKLALEEWRHLLEGASHPVTIYTDHKNLEFLQSLKR-QNPRQARWSLFFSRFHFVLTYRPGTKNRKADA 418          
BLAST of SMED30001607 vs. Ensembl Xenopus
Match: ENSXETT00000034712.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:33567219:33572531:-1 gene:ENSXETG00000011772.1 transcript:ENSXETT00000034712.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.747 bits (369), Expect = 1.008e-34
Identity = 116/399 (29.07%), Postives = 186/399 (46.62%), Query Frame = -2
Query:  763 VKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFSTKD-NFVLTGYHLGXXXXXXLFKD*CILSWKALFLKEL*-YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQL-KEDGTETVIAYGSRPM----KNDTVTRKELLVINEYVSYFKQYLYGKRFMVR--TDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGEKTRHENA 1932
            + + ++ G IR   S   A    V KKDG +R C+DYRGL  IT    +P+     L D L  +K FS +DL  AY  + I    +  TAF+T+D ++       G      +F++     ++ L  K +  Y+  I +F++    +   + K  L+R++   L    EKC F   K  FLG+ IS  G   +  K+  I+     +  K ++ F+G  NY+++FIKD++    P+ + I    +   W     +AFQ  K       +L +P  +  F ++ DA     G++LSQ    DG     AY S+      +N  +  +ELL +   +  ++  L G    V   TDHK L FL + K+ +NP+   W    S ++F L  R G K R  +A
Sbjct:  540 ISENLQRGFIRPSTSPAGAGFFFVEKKDGGLRPCIDYRGLNKITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQEFVNDIFRDLLGKSVVVYLDDILIFSQDLETHRSQV-KEALSRLRENFLFAKLEKCTFEVPKISFLGYIISSRGFEMDPAKVSAIQKWPLPQSTKAIQRFIGFANYYRQFIKDFSSRIAPILSLIRKGGRPNCWPPVALEAFQSLKDAFISASVLRHPEPHLPFFIEVDASDVGAGAILSQRHSADGKLHPCAYFSKKFSSAEQNYDIGNRELLAVKLALEEWRHLLEGASHPVTIYTDHKNLEFLQSLKR-QNPRQARWSLFFSRFNFVLTYRPGTKNRKADA 936          
BLAST of SMED30001607 vs. Ensembl Mouse
Match: Rtl1 (retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:MGI:2656842])

HSP 1 Score: 68.1662 bits (165), Expect = 4.426e-12
Identity = 51/212 (24.06%), Postives = 99/212 (46.70%), Query Frame = -2
Query:  859 LKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQL-KEDGTETVIAYGSRPMKNDTV--TRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKA 1485
            ++ VL R +   +  + +K +F+R+    LG  IS +G+  N   +  I         + L+S + +   ++ F++++A IA PL   +   E    W +E  +A +  K+   ++P+L +P+    F L+TD     + + L Q   E G ++  A+ SRP+    V   R E+ ++         ++   R++  T+   +I LNT   A
Sbjct: 1010 VRQVLVRFRYHNIYCSLDKTQFHRQTAEILGFNISPKGVKLNKNLMNLIVGCPVPGSRRCLQSVIDLVYPYRHFVENFAVIAAPLVRQLLSSEP-YYWGEEEQEALESLKRAFRKSPVLYHPKPQNPFYLETDITGSFLSASLVQTDDETGKKSTCAFYSRPLSTMEVEYPRVEMRIL----PIRAAFMVWCRYLENTEEPIMILLNTEDLA 1216          

HSP 2 Score: 24.2534 bits (51), Expect = 4.426e-12
Identity = 11/47 (23.40%), Postives = 25/47 (53.19%), Query Frame = -1
Query: 1487 PFGLATAPATFQRLMHTLLEGIIFKGVIVYLEDILIYGKTIKEHDSN 1627
            PF + +       ++H +L+ I+   VI +  ++L+Y  + +EH  +
Sbjct:  963 PFTMNSYSDEGNNIVHFILKDILGLFVICHGREVLVYSMSQEEHSQH 1009          
BLAST of SMED30001607 vs. Ensembl Mouse
Match: Rtl1 (retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:MGI:2656842])

HSP 1 Score: 68.1662 bits (165), Expect = 4.426e-12
Identity = 51/212 (24.06%), Postives = 99/212 (46.70%), Query Frame = -2
Query:  859 LKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQL-KEDGTETVIAYGSRPMKNDTV--TRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKA 1485
            ++ VL R +   +  + +K +F+R+    LG  IS +G+  N   +  I         + L+S + +   ++ F++++A IA PL   +   E    W +E  +A +  K+   ++P+L +P+    F L+TD     + + L Q   E G ++  A+ SRP+    V   R E+ ++         ++   R++  T+   +I LNT   A
Sbjct: 1010 VRQVLVRFRYHNIYCSLDKTQFHRQTAEILGFNISPKGVKLNKNLMNLIVGCPVPGSRRCLQSVIDLVYPYRHFVENFAVIAAPLVRQLLSSEP-YYWGEEEQEALESLKRAFRKSPVLYHPKPQNPFYLETDITGSFLSASLVQTDDETGKKSTCAFYSRPLSTMEVEYPRVEMRIL----PIRAAFMVWCRYLENTEEPIMILLNTEDLA 1216          

HSP 2 Score: 24.2534 bits (51), Expect = 4.426e-12
Identity = 11/47 (23.40%), Postives = 25/47 (53.19%), Query Frame = -1
Query: 1487 PFGLATAPATFQRLMHTLLEGIIFKGVIVYLEDILIYGKTIKEHDSN 1627
            PF + +       ++H +L+ I+   VI +  ++L+Y  + +EH  +
Sbjct:  963 PFTMNSYSDEGNNIVHFILKDILGLFVICHGREVLVYSMSQEEHSQH 1009          
BLAST of SMED30001607 vs. UniProt/SwissProt
Match: sp|P04323|POL3_DROME (Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 3.468e-48
Identity = 141/467 (30.19%), Postives = 236/467 (50.54%), Query Frame = -2
Query:  676 ISGSNLVSHEMKINRGPIMHAPRRQPMHLEGKIEVLVKDLIKAGVIRKCKSAWNALLVIVAKK-DGS----IRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFSTKD-NFVLTGYHLGXXXXXXLFKD*CILSWKALFLKE-L*YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGSRPMK----NDTVTRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGEKTRHENA-KEAKARVKHICMFQKTEVMHRVFEAQESN 2040
            ++ +N   H +       +++    P   E ++E  ++D++  G+IR   S +N+ + +V KK D S     R+ +DYR L  IT  +  P+ +   +L  L    YF+++DL + ++Q+ + PE    TAFSTK  ++       G +     F+       + L  K  L Y+  I +F+    +++   L  V  ++  A LK+  +KCEF +++  FLGH ++ +GI  N +KIE I+        K++++FLG+T Y+++FI ++A IA P+   +    K  T + E D AF+  K ++ E PIL  P   + F L TDA    +G+VLSQ   DG    ++Y SR +     N +   KELL I      F+ YL G+ F + +DH+ L +L   K   N +   W   LSE+DF++K  KG+    EN   +A +R+K    +   +  H    A+E N
Sbjct:  191 LTFTNQTKHTINTKHNLPLYSKYSYPQAYEQEVESQIQDMLNQGIIRTSNSPYNSPIWVVPKKQDASGKQKFRIVIDYRKLNEITVGDRHPIPNMDEILGKLGRCNYFTTIDLAKGFHQIEMDPESVSKTAFSTKHGHYEYLRMPFGLKNAPATFQRCMNDILRPLLNKHCLVYLDDIIVFSTSLDEHLQS-LGLVFEKLAKANLKLQLDKCEFLKQETTFLGHVLTPDGIKPNPEKIEAIQKYPIPTKPKEIKAFLGLTGYYRKFIPNFADIAKPMTKCLKKNMKIDTTNPEYDSAFKKLKYLISEDPILKVPDFTKKFTLTTDASDVALGAVLSQ---DGHP--LSYISRTLNEHEINYSTIEKELLAIVWATKTFRHYLLGRHFEISSDHQPLSWLYRMKDP-NSKLTRWRVKLSEFDFDIKYIKGK----ENCVADALSRIKLEETYLSEQTQH---SAEEDN 643          

HSP 2 Score: 58.151 bits (139), Expect = 5.678e-7
Identity = 23/52 (44.23%), Postives = 37/52 (71.15%), Query Frame = -1
Query: 1496 GQFCFNRLPFGLATAPATFQRLMHTLLEGIIFKGVIVYLEDILIYGKTIKEH 1651
            G + + R+PFGL  APATFQR M+ +L  ++ K  +VYL+DI+++  ++ EH
Sbjct:  327 GHYEYLRMPFGLKNAPATFQRCMNDILRPLLNKHCLVYLDDIIVFSTSLDEH 378          
BLAST of SMED30001607 vs. UniProt/SwissProt
Match: sp|Q7LHG5|YI31B_YEAST (Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-I PE=1 SV=2)

HSP 1 Score: 184.496 bits (467), Expect = 1.454e-45
Identity = 135/426 (31.69%), Postives = 224/426 (52.58%), Query Frame = -2
Query:  781 VSHEMKINRGPIMHAPRRQPMHL----EGKIEVLVKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFSTKDN-FVLTGYHLGXXXXXXLFKD*CILSWKALFLKEL*YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRI-FILDTDARFGTIGSVLSQL-KEDGTETVIAYGSRPM----KNDTVTRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFL-NTTKKARNPQFQTWIANLSEYDFELKNRKGEK 2022
            V H+++I  G     PR QP H+    E +I  +V+ L+    I   KS  ++ +V+V KKDG+ R+CVDYR L   T ++ FP+     LL  + +++ F+++DL   Y+Q+ + P+ +  TAF T    +  T    G       F      +++ L    + Y+  I +F+E   +     L  VL R++N  L +  +KC+F  ++  FLG++I  + I     K   I++    K  KQ + FLG+ NY++RFI + +KIA P+   I  C+K   W+++ D A +  K  +C +P+L  P  N+  + L TDA    IG+VL ++  ++    V+ Y S+ +    KN      ELL I + + +F+  L+GK F +RTDH +L+ L N  + AR  + Q W+ +L+ YDF L+   G K
Sbjct:  610 VKHDIEIKPG--ARLPRLQPYHVTEKNEQEINKIVQKLLDNKFIVPSKSPCSSPVVLVPKKDGTFRLCVDYRTLNKATISDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYMADTFRDLRFVNV-YLDDILIFSESP-EEHWKHLDTVLERLKNENLIVKKKKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLGMINYYRRFIPNCSKIAQPIQLFI--CDKS-QWTEKQDKAIEKLKAALCNSPVL-VPFNNKANYRLTTDASKDGIGAVLEEVDNKNKLVGVVGYFSKSLESAQKNYPAGELELLGIIKALHHFRYMLHGKHFTLRTDHISLLSLQNKNEPAR--RVQRWLDDLATYDFTLEYLAGPK 1025          
BLAST of SMED30001607 vs. UniProt/SwissProt
Match: sp|Q99315|YG31B_YEAST (Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-G PE=1 SV=3)

HSP 1 Score: 183.341 bits (464), Expect = 3.894e-45
Identity = 135/426 (31.69%), Postives = 223/426 (52.35%), Query Frame = -2
Query:  781 VSHEMKINRGPIMHAPRRQPMHL----EGKIEVLVKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFSTKDN-FVLTGYHLGXXXXXXLFKD*CILSWKALFLKEL*YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRI-FILDTDARFGTIGSVLSQL-KEDGTETVIAYGSRPM----KNDTVTRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFL-NTTKKARNPQFQTWIANLSEYDFELKNRKGEK 2022
            V H+++I  G     PR QP H+    E +I  +V+ L+    I   KS  ++ +V+V KKDG+ R+CVDYR L   T ++ FP+     LL  + +++ F+++DL   Y+Q+ + P+ +  TAF T    +  T    G       F      +++ L    + Y+  I +F+E   +     L  VL R++N  L +  +KC+F  ++  FLG++I  + I     K   I++    K  KQ + FLG+ NY++RFI + +KIA P+   I  C+K   W+++ D A    K  +C +P+L  P  N+  + L TDA    IG+VL ++  ++    V+ Y S+ +    KN      ELL I + + +F+  L+GK F +RTDH +L+ L N  + AR  + Q W+ +L+ YDF L+   G K
Sbjct:  584 VKHDIEIKPG--ARLPRLQPYHVTEKNEQEINKIVQKLLDNKFIVPSKSPCSSPVVLVPKKDGTFRLCVDYRTLNKATISDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYMADTFRDLRFVNV-YLDDILIFSESP-EEHWKHLDTVLERLKNENLIVKKKKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLGMINYYRRFIPNCSKIAQPIQLFI--CDKS-QWTEKQDKAIDKLKDALCNSPVL-VPFNNKANYRLTTDASKDGIGAVLEEVDNKNKLVGVVGYFSKSLESAQKNYPAGELELLGIIKALHHFRYMLHGKHFTLRTDHISLLSLQNKNEPAR--RVQRWLDDLATYDFTLEYLAGPK 999          
BLAST of SMED30001607 vs. UniProt/SwissProt
Match: sp|P20825|POL2_DROME (Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 4.156e-44
Identity = 132/447 (29.53%), Postives = 237/447 (53.02%), Query Frame = -2
Query:  739 ISGSNLVSHEMKINRGPIMHAPRRQPMHLEGKIEV--LVKDLIKAGVIRKCKSAWNALLVIVAKK-DGS----IRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFSTKD-NFVLTGYHLGXXXXXXLFKD*CILSWKALFLKE-L*YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGSRPMK----NDTVTRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGEKTRHENAKEAKARVK 2040
            ++ +N + H +       +++ ++ P+    +IEV   V++++  G+IR+  S +N+   +V KK D S     R+ +DYR L  IT  + +P+ +   +L  L   +YF+++DL + ++Q+ +  E    TAFSTK  ++       G +     F+       + L  K  L Y+  I +F+    +++  I + V T++ +A LK+  +KCEF +K+  FLGH ++ +GI  N  K++ I +       K++R+FLG+T Y+++FI +YA IA P+ + +    K  T   E  +AF+  K ++   PIL  P   + F+L TDA    +G+VLSQ   +G    I++ SR +     N +   KELL I      F+ YL G++F++ +DH+ L +L+  K+    + + W   LSEY F++   KG   +  +  +A +R+K
Sbjct:  189 LTFTNTIKHVLNTTHNSPIYS-KQYPLAQTHEIEVENQVQEMLNQGLIRESNSPYNSPTWVVPKKPDASGANKYRVVIDYRKLNEITIPDRYPIPNMDEILGKLGKCQYFTTIDLAKGFHQIEMDEESISKTAFSTKSGHYEYLRMPFGLRNAPATFQRCMNNILRPLLNKHCLVYLDDIIIFSTSLTEHLNSI-QLVFTKLADANLKLQLDKCEFLKKEANFLGHIVTPDGIKPNPIKVKAIVSYPIPTKDKEIRAFLGLTGYYRKFIPNYADIAKPMTSCLKKRTKIDTQKLEYIEAFEKLKALIIRDPILQLPDFEKKFVLTTDASNLALGAVLSQ---NGHP--ISFISRTLNDHELNYSAIEKELLAIVWATKTFRHYLLGRQFLIASDHQPLRWLHNLKEP-GAKLERWRVRLSEYQFKIDYIKG---KENSVADALSRIK 624          
BLAST of SMED30001607 vs. UniProt/SwissProt
Match: sp|Q8I7P9|POL5_DROME (Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 3.023e-42
Identity = 137/449 (30.51%), Postives = 223/449 (49.67%), Query Frame = -2
Query:  784 ISGSNLVSHEMKIN-RGPIMHAPRRQPMHLEGKIEVLVKDLIKAGVIRKCKSAWNALLVIVAKK-----DGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFST---KDNFVLTGYHLGXXXXXXLFKD*CILS---WKALFLKEL*YIWRIYLFTEK---Q*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGP-------LYAAITGCEK---KITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGSRPM----KNDTVTRKELLVINEYVSYFKQYLYGKRFM-VRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGE 2040
            +S    V  E++ N + PI       P+++ G++E  + +L++ G+IR   S +N+ + IV KK     +   RM VD++ L ++T  +++P+ D    L  L ++KYF+++DL   ++Q+ +       TAFST   K  F+   + L             IL     K  ++    YI  I +F+E      KN    L+ VL  +  A L++N EK  F   +  FLG+ ++ +GI  + KK+  I         K+L+ FLG+T+Y+++FI+DYAK+A P       LYA I   +     IT  +    +F   K ++C + IL +P   + F L TDA    IG+VLSQ  + G +  IAY SR +    +N     KE+L I   +   + YLYG   + V TDH+ L F     +  N + + W A + EY+ EL  + G+
Sbjct:  106 MSVETAVKAEIRTNTQDPIYAKSYPYPVNMRGEVERQIDELLQDGIIRPSNSPYNSPIWIVPKKPKPNGEKQYRMVVDFKRLNTVTIPDTYPIPDINATLASLGNAKYFTTLDLTSGFHQIHMKESDIPKTAFSTLNGKYEFLRLPFGLKNAPAIFQRMIDDILREHIGKVCYV----YIDDIIVFSEDYDTHWKN----LRLVLASLSKANLQVNLEKSHFLDTQVEFLGYIVTADGIKADPKKVRAISEMPPPTSVKELKRFLGMTSYYRKFIQDYAKVAKPLTNLTRGLYANIKSSQSSKVPITLDETALQSFNDLKSILCSSEILAFPCFTKPFHLTTDASNWAIGAVLSQ-DDQGRDRPIAYISRSLNKTEENYATIEKEMLAIIWSLDNLRAYLYGAGTIKVYTDHQPLTFA-LGNRNFNAKLKRWKARIEEYNCELIYKPGK 544          
BLAST of SMED30001607 vs. TrEMBL
Match: A0A0V0RD69 (Retrovirus-related Pol polyprotein from transposon 17.6 (Fragment) OS=Trichinella nelsoni OX=6336 GN=pol PE=4 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 2.724e-76
Identity = 164/521 (31.48%), Postives = 275/521 (52.78%), Query Frame = -2
Query:  547 SNLVSHEMKINRG-PIMHAPRRQPMHLEGKIEVLVKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFSTKDN-FVLTGYHLGXXXXXXLFKD*CILSWKALFLKE-L*YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGSR----PMKNDTVTRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGEKTRHENAKEAKARVKHIC-MFQKTEVMH----------RVFEAQESNKQFEKMKKCVNNGNFDKKDV--------LFKLRDNLKINDGLLIVNKNGID 2031
            ++LV+H ++     PI   PRR P+     +E LV  ++++GVI      W++ +V+V KKDGS R CVDYR L ++T  ++ P+      LD LA S++FS++DL   Y+QV +    +E TAFST    F       G       F+       + L  K  L Y+  I ++   + +++  + K VL R+Q+ GLKI P+KC+  R+   +LGH +++ GI T+ +K   ++     +C K+++ F+G+ +Y++RF+K++A IAGPL+  +T   ++ +W  E + A    K V+   PIL +P  +R F+LD DA    +G+VLSQ    G   V+AY SR    P +    TR+E+L +     +F+ YLYG++F  RTDH  L +L   ++    Q   W+  L+EY+FE+ +R G++  H NA     RV   C +   TE             R+ E Q+++ +  ++++ +   ++ ++          L+  RD L + DG+L       D
Sbjct:  124 TSLVTHRIETGEARPIKQPPRRLPVAQRSVMERLVGQMLESGVIEPASGPWSSPVVLVRKKDGSPRFCVDYRRLNAVTRVDAQPLPRIDDTLDALAGSQWFSTLDLASGYWQVEVAEPDREKTAFSTPMGLFQFRVMPFGLCNAPATFQRLMENVLRGLTFKGCLVYLDDIIVYGRTEEEHLERLAK-VLHRLQSVGLKIRPDKCQLMRRSVRYLGHVVTQHGIGTDPEKTAAVQEWPRPRCVKEVQQFMGLASYYRRFVKNFASIAGPLH-KLTRKGQRWSWGPEQEGALTKLKSVLSSPPILSHPHFDRPFLLDVDASEDALGAVLSQPNHQGLPVVVAYASRSLSQPERKYCATRREMLALVWATRHFRPYLYGRKFTARTDHNALKWLRNFREPEG-QVARWLERLAEYEFEVVHRPGQQ--HRNADALSRRVCKQCGVINPTEDAQVAAMTLGQTGRIQEWQDADPELRQIREWLEKRDWPQEPPAGSHMFRSLWSQRDRLTLRDGILCRTWEAPD 639          
BLAST of SMED30001607 vs. TrEMBL
Match: A0A0V1NCS2 (Retrovirus-related Pol polyprotein from transposon 17.6 (Fragment) OS=Trichinella sp. T8 OX=92180 GN=pol PE=4 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 4.386e-76
Identity = 154/452 (34.07%), Postives = 252/452 (55.75%), Query Frame = -2
Query:  709 SNLVSHEMKINRG-PIMHAPRRQPMHLEGKIEVLVKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFSTKDN-FVLTGYHLGXXXXXXLF-----KD*CILSWKALFLKEL*YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGSRPM----KNDTVTRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGEKTRHENAKEAKARVKHICMFQKTEV 2031
            ++LV H ++     P+   PRR P      ++ L+++++ AGVI      W++ +V+V KKDGS R CVDYR L ++T  ++ P+      LD LA +K+FS++DL   Y+QV +  E +E TAFST    F       G       F     K    L+WK   +    Y+  I +F + + +  +  L+ VL R+Q+ GLKI PEKC+  R+   +LGH ++++GI T+ +K   ++     +C +++R FLG+ +Y++RF++++A +A PL+ A+T   +K  W  + ++AF + KK +   PIL +P  +R F+LD DA    +G+VLSQ       +VIAY SR +    +    TR+E+L +     +F+ YLYG+RF+ RTDH +L +L   ++    Q   W+  L+E+DFE+ +R G K  H+NA     RV   C  + +  
Sbjct:  352 TSLVQHRIETGGAQPVKLPPRRLPQAQRETVDRLIREMLHAGVIEPASGPWSSPVVLVRKKDGSPRFCVDYRRLNAVTRVDAQPIPRIDDTLDALAGAKWFSTLDLASGYWQVEVAEEDREKTAFSTPLGLFQFRVMPFGLCNAPATFQRLMEKALRGLTWKTCLV----YLDDIIVFGKTE-EEHLERLEGVLARLQSVGLKIKPEKCQLMRQSVHYLGHVVTQQGIGTDPEKTAAVQKWPTPRCVREVRQFLGLASYYRRFVRNFAGVANPLH-ALTKKGEKWHWGPKEEEAFTLLKKALVSPPILGHPDFDRTFLLDVDASEDAVGAVLSQQGGQDPPSVIAYASRSLSRAERGYCATRREMLALVWATQHFRPYLYGRRFIARTDHNSLRWLRNFREPEG-QVARWLERLAEFDFEVVHRAGRK--HQNADALSRRVCKQCGLEGSPA 794          
BLAST of SMED30001607 vs. TrEMBL
Match: A0A0V0T9Q4 (Transposon Ty3-G Gag-Pol polyprotein OS=Trichinella murrelli OX=144512 GN=TY3B-G PE=4 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 7.255e-76
Identity = 170/565 (30.09%), Postives = 296/565 (52.39%), Query Frame = -2
Query:  451 SNLVSHEMKINRG-PIMHAPRRQPMHLEGKIEVLVKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFSTKDN-FVLTGYHLGXXXXXXLF-----KD*CILSWKALFLKEL*YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGSRPM----KNDTVTRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGEKTRHENAKEAKARVKHICMFQ-----------KTEVMHRVFEAQESNKQFEKMKKCVNNGNFDKKDV--------LFKLRDNLKINDGLLIVNKNGID------LLLVPIEFTQLLVTKIHGKM--CHVGVKQLVHYI 2031
            ++LV H ++     P+   PRR P      ++ L+++++ AGVI      W++ +V+V KKDGS R CVDYR L ++T  ++ P+      LD LA +K+FS++DL   Y+QV +  E +E TAFST    F       G       F     K    L+WK   +    Y+  I +F + + +  +  L+ VL+R+Q+ GLKI PEKC+  R+   +LGH ++++GI T+ +K   ++     +C +++R FLG+ +Y++RF++++A +A PL+ A+T   +K  W  + ++AF + KK +   PIL +P  +R F+LD DA    +G+VLSQ       +VIAY SR +    +    TR+E+L +     +F+ YLYG+RF+ RTDH +L +L   ++    Q   W+  L+E+DFE+ +R G K  H+NA     RV   C  +           K +  + + + QES+K+ +++++      + +           L+  RD + + +G +       D      L ++P +    ++  +H      H+GV + +  +
Sbjct:  372 TSLVQHRIETGGAQPVKLPPRRLPQAQRETVDRLIREMLHAGVIEPASGPWSSPVVLVRKKDGSPRFCVDYRRLNAVTRVDAQPIPRIDDTLDALAGAKWFSTLDLASGYWQVEVAEEDREKTAFSTPLGLFQFRVMPFGLCNAPATFQRLMEKALRGLTWKTCLV----YLDDIIVFGKTE-EEHLERLEGVLSRLQSVGLKIKPEKCQLMRQSVHYLGHVVTQQGIGTDPEKTAAVQKWPTPRCVREVRQFLGLASYYRRFVRNFAGVANPLH-ALTKKGEKWHWGPKEEEAFTLLKKALVSPPILGHPDFDRTFLLDVDASEDAVGAVLSQQGGQDPPSVIAYASRSLSRAERGYCATRREMLALVWATQHFRPYLYGRRFIARTDHNSLRWLRNFREPEG-QVARWLERLAEFDFEVVHRAGRK--HQNADALSRRVCKQCGLEGSPAEVPVGAVKLDAANPIKQWQESDKELQQIREWSTQRTWPRAAPEGSRLLRSLWAQRDRIVVREGTICRKWETPDTGETRLLQVIPRQRIPEILAAVHNGQSGAHLGVAKTLAKV 927          
BLAST of SMED30001607 vs. TrEMBL
Match: A0A0V0RP87 (Transposon Ty3-G Gag-Pol polyprotein OS=Trichinella nelsoni OX=6336 GN=TY3B-G PE=4 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 9.534e-76
Identity = 171/558 (30.65%), Postives = 294/558 (52.69%), Query Frame = -2
Query:  472 SNLVSHEMKINRG-PIMHAPRRQPMHLEGKIEVLVKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFSTKDN-FVLTGYHLGXXXXXXLF-----KD*CILSWKALFLKEL*YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGSRPM----KNDTVTRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGEKTRHENAKEAKARVKHICMFQ-----------KTEVMHRVFEAQESNKQFEKMKKCVNNGNFDKKDV--------LFKLRDNLKINDGLLIVNKNGID------LLLVPIEFTQLLVTKIHGKM--CHVGV 2031
            ++LV H ++     P+   PRR P      ++ L+++++ AGVI      W++ +V+V KKDGS R CVDYR L ++T  ++ P+      LD LA +K+FS++DL   Y+QV +  E +E TAFST    F       G       F     K    L+WK   +    Y+  I +F + + +  +  L+ VL+R+Q+ GLKI PEKC+  R+   +LGH ++++GI T+ +K   ++     +C +++R FLG+ +Y++RF++++A +A PL+ A+T   +K  W  + ++AF + KK +   PIL +P  +R F+LD DA    +G+VLSQ  E    +VIAY SR +    +    TR+E+L +     +F+ YLYG+RF+ RTDH +L +L + ++    Q   W+  L+E+DFE+ +R G K  H+NA     RV   C  +           K +    + + QES+K+ +++++      + +           L+  RD + + +G +       D      L ++P +    ++  +H      H+GV
Sbjct:  584 TSLVQHRIETGGAQPVKLPPRRLPQAQRETVDRLIREMLHAGVIEPASGPWSSPVVLVRKKDGSPRFCVDYRRLNAVTRVDAQPIPRIDDTLDALAGAKWFSTLDLASGYWQVEVAEEDREKTAFSTPLGLFQFRVMPFGLCNAPATFQRLMEKALRGLTWKTCLV----YLDDIIVFGKTE-EEHLERLEGVLSRLQSVGLKIKPEKCQLMRQSVHYLGHVVTQQGIGTDPEKTAAVQKWPTPRCVREVRQFLGLASYYRRFVRNFAGVANPLH-ALTKKGEKWHWGPKEEEAFTLLKKALVSPPILGHPDFDRTFLLDVDASEDAVGAVLSQQGERDPPSVIAYASRSLSRAERGYCATRREMLALVWATQHFRPYLYGRRFIARTDHNSLRWLRSFREPEG-QVARWLERLAEFDFEVVHRAGRK--HQNADALSRRVCKQCGMEGSPAEVPVGAVKLDAASPIKQWQESDKELQQIREWSTQRTWPRAAPEGSRLLRSLWAQRDRIVVREGTICRKWETPDTGETRLLQVIPRQRIPEILAAVHNGQSGAHLGV 1132          
BLAST of SMED30001607 vs. TrEMBL
Match: A0A0V1ND63 (Retrovirus-related Pol polyprotein from transposon 17.6 (Fragment) OS=Trichinella sp. T8 OX=92180 GN=pol PE=4 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 1.812e-75
Identity = 153/450 (34.00%), Postives = 252/450 (56.00%), Query Frame = -2
Query:  715 SNLVSHEMKINRG-PIMHAPRRQPMHLEGKIEVLVKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFSTKDN-FVLTGYHLGXXXXXXLF-----KD*CILSWKALFLKEL*YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGSRPM----KNDTVTRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGEKTRHENAKEAKARVKHICMFQKT 2031
            ++LV H ++     P+   PRR P      ++ L+++++ AGVI      W++ +V+V KKDGS R CVDYR L ++T  ++ P+      LD LA +K+FS++DL   Y+QV +  E +E TAFST    F       G       F     K    L+WK   +    Y+  I +F + + +  +  L+ VL R+Q+ GLKI PEKC+  R+   +LGH ++++GI T+ +K   ++     +C +++R FLG+ +Y++RF++++A +A PL+ A+T   +K  W  + ++AF + KK +   PIL +P  +R F++D DA    +G+VLSQ       +VIAY SR +    +    TR+E+L +     +F+ YLYG+RF+ RTDH +L +L   ++    Q   W+  L+E+DFE+ +R G K  H+NA     RV   C  + +
Sbjct:  352 TSLVQHRIETGGAQPVKLPPRRLPQAQRETVDRLIREMLHAGVIEPASGPWSSPVVLVRKKDGSPRFCVDYRRLNAVTRVDAQPIPRIDDTLDALAGAKWFSTLDLASGYWQVEVAEEDREKTAFSTPLGLFQFRVMPFGLCNAPATFQRLMEKALRGLTWKTCLV----YLDDIIVFGKTE-EEHLERLEGVLARLQSVGLKIKPEKCQLMRQSVHYLGHIVTQQGIGTDPEKTAAVQKWPTPRCVREVRQFLGLASYYRRFVRNFAGVANPLH-ALTKKGEKWHWGPKEEEAFTLLKKALVSPPILGHPDFDRTFLVDVDASEDAVGAVLSQQGGQDPPSVIAYASRSLSRAERGYCATRREMLALVWATQHFRPYLYGRRFIARTDHNSLRWLRNFREPEG-QVARWLERLAEFDFEVVHRAGRK--HQNADALSRRVCKQCGLEGS 792          
BLAST of SMED30001607 vs. Ensembl Cavefish
Match: ENSAMXT00000048272.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000106.1:219951:223307:1 gene:ENSAMXG00000032559.1 transcript:ENSAMXT00000048272.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 260.381 bits (664), Expect = 7.826e-71
Identity = 150/436 (34.40%), Postives = 246/436 (56.42%), Query Frame = -2
Query:  763 SNLVSHEMKINRGP-IMHAPRRQPMHLEGKIE--VLVKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAF-STKDNFVLTGYHLGXXXXXXLFK---D*CI--LSWKALFLKEL*YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGSRPM----KNDTVTRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGEKTRHENA 2031
            ++LV H++++  GP +   PRR  M  E +IE    ++  +++G+     S+W + +V+V KKD + R+CVDYR L + T  +++P+   +  L+ L+ +K+FS++DL   Y+QV + P  ++  AF S K  F       G       F+   D  +  L W+   +    Y+  I L   K    ++  L  V  R + A LK+ P KC  +R++  +LGH +S +GI T+ +K+  ++      C  ++R F+G+  Y++RF++D+A IA PL+  +T    +  W+ E   AF+  K  +  TP+L YPR +   ILDTDA    IG+VLSQ+ +DG E V+AYGSR +    +N   TR+ELL + E+  +F+QYL G+ F+VR+DH +L +L   K+    Q   W+  L+EYDF++ +R G    H+NA
Sbjct:   64 TSLVQHDIQLLPGPPVKQQPRR--MAFEKQIESDAQIQQSLESGLASPSNSSWASPIVLVRKKDQTYRLCVDYRALNARTVKDAYPLPRIQDTLETLSTAKWFSTLDLASGYWQVALTPRARKAVAFCSRKGLFTWNVMPFGLCNAPATFQRLMDRVLAGLQWETCLV----YLDDIILLG-KDVPEILQRLAQVFDRFRQANLKLKPTKCCLFRREVSYLGHIVSAQGIATDPEKVRKVQQWPQPTCVSEVRQFVGLAAYYRRFVQDFATIAKPLH-ELTKKHVRFQWTPECQTAFEELKSSLTSTPVLGYPRDHGNLILDTDASNFGIGAVLSQV-QDGAERVLAYGSRRLSSTEQNYCTTRRELLAVVEFTRHFRQYLLGRPFIVRSDHSSLRWLVNMKEPEG-QLARWLEKLAEYDFQVVHRPGH--HHQNA 487          
BLAST of SMED30001607 vs. Ensembl Cavefish
Match: ENSAMXT00000052614.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001686.1:18497:23810:-1 gene:ENSAMXG00000038033.1 transcript:ENSAMXT00000052614.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.815 bits (486), Expect = 1.221e-59
Identity = 97/249 (38.96%), Postives = 151/249 (60.64%), Query Frame = -2
Query:  763 MIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGSRPM----KNDTVTRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGEKTRHENA 1497
            M+  L  V  R + A LK+ P KC  +R++  +LGH +S +GI T+ +K+  ++      C  ++R F+G+  Y++RF++D+A IA PL+  +T    +  W+ E   AF+  K  +  TP+L YPR +   ILDTDA    IG+VLSQ+ +DG E V+AYGSR +    +N   TR+ELL + E+  +F+QYL G+ F+VR+DH +L +L   K+    Q   W+  L+EYDF++ +R G    H+NA
Sbjct:   69 MLQRLAQVFDRFRQANLKLKPTKCCLFRRQVSYLGHIVSAQGIATDPEKVRKVQQWPQPTCVSEVRQFVGLAAYYRRFVQDFATIAKPLH-ELTKKHVRFQWTPECQAAFEELKSSLTSTPVLGYPRDHGNLILDTDASNFGIGAVLSQV-QDGAERVLAYGSRRLSSTEQNYCTTRRELLAVVEFTRHFRQYLLGRPFIVRSDHSSLRWLVNIKEPEG-QLARWLEKLAEYDFQVVHRPGH--HHQNA 312          

HSP 2 Score: 60.077 bits (144), Expect = 1.221e-59
Identity = 26/51 (50.98%), Postives = 37/51 (72.55%), Query Frame = -1
Query: 1499 GQFCFNRLPFGLATAPATFQRLMHTLLEGIIFKGVIVYLEDILIYGKTIKE 1651
            G F +N +PFGL  APATFQRLM  +L G+ ++  +VYL+DI++ GK + E
Sbjct:   18 GLFTWNVMPFGLCNAPATFQRLMDRVLAGLQWETCLVYLDDIILLGKDVPE 68          
BLAST of SMED30001607 vs. Ensembl Cavefish
Match: ENSAMXT00000034038.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:3120146:3124090:1 gene:ENSAMXG00000040885.1 transcript:ENSAMXT00000034038.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 224.942 bits (572), Expect = 3.268e-59
Identity = 145/438 (33.11%), Postives = 231/438 (52.74%), Query Frame = -2
Query:  787 SNLVSHEMK-INRGPIMHAPRRQPMHLEGKIEVLVKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFSTKDN-FVLTGYHLGXXXXXXLFKD*CILSWKAL-FLKEL*YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKK--------------ITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGSRPMKNDTVTRK-----ELLVINEYVS-YFKQYLYGKRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKG 2031
            + +V HE+  ++  P     R+ P      +   + ++ +AGVIR  KS + + +V+V KKDGS+R+C+DYR L S +  ++FP+      L+ L ++KYFS++DL   Y+QV +    +  TAFST    F       G Q     F+      +  L F   L Y+  I +F+ +     +  L+ V  R++  GLK+ P+KC   R++  +LGH +S +GI T+  KI  +   +  +   +L  FLG   Y++RFI+ YA IA PLY   +G  +K                W++E ++AFQ  K  +   P+L Y   ++ F+L TDA    +G+VL+Q+ +DG E VIAY SR + N   TR      E L +   V+  F  +LYG +F V TD+  L ++ TT K  +   Q W+A LS +DF+++ R+G
Sbjct:  224 TTVVKHEIPLVDPRPFRLPYRKIPPSQYQAVRKAITEMEEAGVIRPSKSPYASPIVVVTKKDGSLRICMDYRKLNSCSTRDAFPLPRVEEALEALGEAKYFSTLDLTSGYWQVEVAEADKHKTAFSTPMGLFEANRMPFGLQNSPSTFQRLMTCCFGDLNFESLLIYLDDIVIFS-RTFDEHLERLQMVFDRLRKYGLKLKPQKCHLLRREVLYLGHVVSSDGIKTDPDKISKVAGWKVPENRHELLQFLGFAGYYRRFIEGYASIAAPLYRLTSGDPRKKKRGRKGPPAVGLPFIWTEECENAFQTLKTKLTTAPVLGYADYSQPFVLQTDASLAGLGAVLAQV-QDGRERVIAYASRGL-NPAETRYPAHKLEFLALKWAVTDKFYDHLYGHKFSVLTDNNPLKYVMTTAKL-DATGQRWVAQLSMFDFDIRYRQG 657          
BLAST of SMED30001607 vs. Ensembl Cavefish
Match: ENSAMXT00000042253.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000503.1:15658:18693:-1 gene:ENSAMXG00000039114.1 transcript:ENSAMXT00000042253.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 216.468 bits (550), Expect = 5.867e-57
Identity = 152/472 (32.20%), Postives = 238/472 (50.42%), Query Frame = -2
Query:  571 EVLVKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFSTKDN-FVLTGYHLGXXXXXXLFKD*CILSWKALFLKEL*YIWR----IYL----FTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDY--PRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGSRPM----KNDTVTRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGEKTRHENAKEAKARVKHICMFQKTEVMHRVFEAQESNKQFEKMKKCVNNGNFDKKDVLFKLRDNLKINDGLL 1941
            E LV+D+  AGVI    S W+A +V+  KKDG+ R CVDYR L ++T+ +S+P+      LD L+ S +FSS+DL   Y+QV +    +E TAFS     +  T    G       F+         L  + L  I R    +YL           + +  L+ VL  IQ A LK+NP KC   R++  FLGH +S  G+ T+ KK E +++    + AK +RSF+G+ +Y++RFI+ +  + G   + +T       WS E + AF   K  +C  P+L Y   R   ++I     R   +G+VLSQ+ +DG+E VIAY SR +    +N  VT +ELL + E + +F+ Y+YG  F++RTDH +L +L   ++    Q   WI+ + E+ FE+ +R G    H N   A A  +  C+    +   R  E          +   V  G    +  + ++RD  + +  L+
Sbjct:  157 EQLVRDMASAGVIEPSSSPWSAPVVLAKKKDGNWRFCVDYRRLNAVTKLDSYPLPRIDDTLDQLSGSAWFSSLDLRSGYWQVPLAEGDREKTAFSLGSALWHFTVLPFGLCNSPATFER--------LMERVLSGIPRSCCVVYLDDVMAHGTDFDSALSHLEVVLGAIQAANLKLNPAKCNLLRQRVNFLGHVVSGAGVETDPKKTEAVRDWPVPRNAKMVRSFVGLASYYRRFIRGFRDVGG-NASHLTRPGVTFRWSDEAERAFGELKSRLCNAPVLAYRNVREASLWIRIASDR--GLGAVLSQV-QDGSERVIAYYSRRLDKAERNYCVTCRELLAVVEGLKHFRPYVYGVPFLLRTDHASLQWLMRFREPEG-QLARWISRIQEFSFEVVHRPGRS--HGN---ADALSRRPCVAVDCKHCARAEEKSAETAHCAAVSADVTGGVVVAQVSVEQIRDAQRADRDLM 610          
BLAST of SMED30001607 vs. Ensembl Cavefish
Match: ENSAMXT00000054230.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:19483082:19487098:1 gene:ENSAMXG00000038338.1 transcript:ENSAMXT00000054230.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 216.083 bits (549), Expect = 2.272e-56
Identity = 140/451 (31.04%), Postives = 240/451 (53.22%), Query Frame = -2
Query:  763 SNLVSHEMKI-NRGPIMHAPRRQPMHLEGKIEVLVKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFSTKDN-FVLTGYHLGXXXXXXLFKD*CILS-------WKALFLKEL*YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLY---AAITGCEKK--------ITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGS---RP----MKNDTVTRKELLVINEYVSY-FKQYLYGKRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGEKTRHENA 2031
            +NL+ HE+ + +  P+    RR P      ++  +  L++A V+R+  S + + +V+V KKDGS+RMCVDYR L S T  ++FP+      LD L+ +++FS++DL   Y QV +  + +  TAF T    F       G       F+   ++        +++L L    Y+  I +F+    +++   L+ VL R+Q  GLK    KC F++++  +LGH IS +G+ T+  KIE +   +  +   +LRSFLG  +Y++RF++ +A++AGPL+   AA+ G + K        + W+ + + +F+  K  +   P+L Y   +  FIL+ DA +  +G+VLSQ + DG    +AY S   RP    M N +  + E L +   ++  F++YL G + +V TD+  L +L + K         W A L+ +DFE+K R G   ++ +A
Sbjct:  285 TNLIEHEIPLLDNIPVRQRHRRIPPSDYELVKAHIDQLLEAQVVRESSSPYASPIVLVKKKDGSLRMCVDYRLLNSKTRKDAFPLPRIEESLDALSGARWFSTLDLASGYNQVPVAEQDKPKTAFCTPFGLFEWNRMPFGLCNAPSTFQR--LMQRMFGDQQYQSLLL----YLDDIIVFSSSVSQHLQ-RLEVVLGRLQKEGLKAKLSKCVFFKQEVGYLGHVISNKGVSTDPAKIEAVAQWQRPRTVSELRSFLGFASYYRRFVEGFAQLAGPLHKLVAALVGSKTKKGSGQALGMAWTAQCEQSFEALKARLVSAPVLAYADFSLPFILEIDASYSGLGAVLSQ-EHDGAVRPVAYASRGLRPPERNMDNYSSMKLEFLALKWAMTEKFREYLLGHKCVVYTDNNPLSYLQSAKLGA--MEHRWAAQLAAFDFEIKYRSGRSNKNADA 725          

HSP 2 Score: 57.7658 bits (138), Expect = 1.066e-7
Identity = 21/52 (40.38%), Postives = 37/52 (71.15%), Query Frame = -1
Query: 1496 GQFCFNRLPFGLATAPATFQRLMHTLLEGIIFKGVIVYLEDILIYGKTIKEH 1651
            G F +NR+PFGL  AP+TFQRLM  +     ++ +++YL+DI+++  ++ +H
Sbjct:  414 GLFEWNRMPFGLCNAPSTFQRLMQRMFGDQQYQSLLLYLDDIIVFSSSVSQH 465          
BLAST of SMED30001607 vs. Ensembl Medaka
Match: ENSORLT00000040305.1 (pep primary_assembly:ASM223467v1:1:25459511:25466649:-1 gene:ENSORLG00000028409.1 transcript:ENSORLT00000040305.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 257.684 bits (657), Expect = 4.465e-69
Identity = 155/473 (32.77%), Postives = 260/473 (54.97%), Query Frame = -2
Query:  649 SNLVSHEMKINRG-PIMHAPRRQPMHLEGKIEVLVKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFSTKDN-FVLTGYHLGXXXXXXLFK---D*CI--LSWKALFLKEL*YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGSRPM----KNDTVTRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGEKTRHENAKEAKAR-VKHICMFQKTEVMHRVFEAQESNKQFEKMKKC 2031
            +N+V H++    G  +   PRR     +   +  V+  ++AG+ R   S+W A +V+V KKD S R+CVDYR L   T  +++P+   +  LD L+ +KYFS++DL   Y+QV + P  ++  AF T+   F       G       F+   D  +  L W+A  +    Y+  I +        M+  L+ V TR++ A LK+ P KC  ++++  +LGH +S +GI T+ +KI+ +++    K   ++R F+G+ +Y++RF+ D+A IA PL+  +T    +  W+ E  +AF+  K+ +   PIL YP  +   +LDTDA    +G+VLSQ+ + G E V+AYGSR +    +N   TR+ELL + E+ S+F+QYL G+ F++RTDH +L +L   K+    Q   W+  L+EYDF++ +R G+   H+NA     R  + +C  +  +       + +SN   +K  +C
Sbjct:  818 TNVVQHDILTTPGSAVKQQPRRMSREKQEAADQQVQQSLEAGLARHSNSSWAAPIVMVKKKDQSPRLCVDYRPLNDRTIKDAYPLPRIQDTLDTLSTAKYFSTLDLTSGYWQVEMTPRARKAAAFCTRKGLFEWNVMPFGLCNAPATFQRLMDRVLAGLQWEACLV----YLDDIIVLGCNS-NQMMERLEQVFTRLRQANLKLKPSKCRLFQEQVAYLGHVVSAQGISTDPQKIQKVQDWPIPKNISEVRQFVGLASYYRRFVADFATIARPLH-ELTKKYARFDWTTECQEAFEELKERLTSAPILGYPLDSGELLLDTDASDWGVGAVLSQV-QGGEERVLAYGSRRLTTTEQNYCTTRRELLAVVEFTSHFRQYLLGRSFVLRTDHSSLRWLTRLKEPEG-QLARWLEKLAEYDFQVLHRPGKV--HQNADALSRRPCRELCACKLPD------PSTDSNTSQDKQVQC 1274          

HSP 2 Score: 56.225 bits (134), Expect = 3.186e-7
Identity = 24/46 (52.17%), Postives = 34/46 (73.91%), Query Frame = -1
Query: 1514 GQFCFNRLPFGLATAPATFQRLMHTLLEGIIFKGVIVYLEDILIYG 1651
            G F +N +PFGL  APATFQRLM  +L G+ ++  +VYL+DI++ G
Sbjct:  947 GLFEWNVMPFGLCNAPATFQRLMDRVLAGLQWEACLVYLDDIIVLG 992          
BLAST of SMED30001607 vs. Ensembl Medaka
Match: ENSORLT00000036827.1 (pep primary_assembly:ASM223467v1:16:28613823:28617539:1 gene:ENSORLG00000023550.1 transcript:ENSORLT00000036827.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 240.35 bits (612), Expect = 4.449e-64
Identity = 159/488 (32.58%), Postives = 253/488 (51.84%), Query Frame = -2
Query:  664 IYLWRQNLISGSNLVSHEMKINRG-PIMHAPRRQPMHLEGKIEVLVKDLIKAGVIRKCKSAWNALLVIVAKKDGS-IRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFSTKDNF----VLTGYHLGXXXXXXLFKD*CILSWKALFLKEL*YIWR----IYL----FTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGSRPMKND----TVTRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGEKTRHENAKEAKARVKHI--CMF-QKTEVMHRVFEAQESNKQFE 2064
            I+   ++ +  ++LV HE+      PI   PRR P+  +   +  ++++++ G+I    S W + +V+V KK G  +R CVDYR L  +T+ +S+P+      LD ++ S +FSS+DL   Y+QV + P  +  TAF T        VL+    G       F+         L  K L  I R    +YL          K  +  L+ VL RI  AGLK++P+KC F R++  FLGH I  EGI T ++K++ +++       + L+SFLG+ +Y++RF++ ++ IA PL+  +   +    W++E + AF   KK +  +PIL  P     FILDTDA    +G+VLSQ+   G E V+AY S+ +        VTR+ELL + + + +F+ YL G  F VRTDH  L +L T K+    Q   W+  L+ + F +++R G  +RH NA     R   +  C + +K E    V   +E +   E
Sbjct:  247 IFALSEDEVGLTHLVHHEIDTGDARPIKTRPRRLPLAHQVAADSAIEEMLRGGIIEPSDSPWASGVVMVKKKKGPKMRFCVDYRPLNGVTKKDSYPLPRIDESLDLVSGSSWFSSLDLRSGYWQVPLSPAARPKTAFCTGRGLWQFRVLS---FGLCNAPATFER--------LMEKVLASIPRQECLVYLDDILVHGGSFKAALESLRKVLQRIAAAGLKLHPDKCCFMRRELEFLGHKIGGEGISTLEEKVQAVRDWPTPTTLRDLKSFLGLASYYRRFVRGFSCIAAPLF-HLQRKDCDFVWTQECEQAFSSLKKALTNSPILTPPDPKLPFILDTDASDVGMGAVLSQMGSAG-ERVVAYFSKTLSKAERRYCVTRRELLAVVKAIGHFRYYLCGLPFTVRTDHSALQWLMTFKEPEG-QIARWLEELASFSFTVEHRPG--SRHANADAMSRRPCALAGCQYCEKREAREAVISREEQSHTGE 718          
BLAST of SMED30001607 vs. Ensembl Medaka
Match: ENSORLT00000030651.1 (pep primary_assembly:ASM223467v1:5:21308959:21315033:-1 gene:ENSORLG00000024220.1 transcript:ENSORLT00000030651.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 219.55 bits (558), Expect = 2.543e-57
Identity = 135/434 (31.11%), Postives = 228/434 (52.53%), Query Frame = -2
Query:  781 SNLVSHEMKINRG-PIMHAPRRQPMHLEGKIEVLVKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFSTKDN-FVLTGYHLGXXXXXXLFK----------D*CILSWKALFLKEL*YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEK-KITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGSRPMKND----TVTRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGEK 2031
            + L+SH +++  G PI   P R P  L G++   V+ +++ GVI    S W++ +VIV KKD S+R+C+D+R L +++E +++PM     LL+ +  + + +++DL + Y+QV +    +  TAF T    F  T    G       F+          + C     A +L ++     IY  T +Q    +  L+ VL ++QNAGL +N  KCE+ RK+  +LG+ +    +     K+E I+N    +  K++RSFLG+  +++RF+  +A IA PL A     +K  +TW+ E + AFQ  K  +C  P+L  P  ++ F++  DA    +G+VL+Q  + G E  + Y SR ++      +   KE L I   +   + YL G+ F + TDH+ L ++NT K   N +   W   L  Y F L++R G++
Sbjct: 1061 TTLISHSIRLKDGRPIRQRPYRVPQKLVGRLNDEVRKMLELGVIEPSNSEWSSPVVIVPKKDDSLRICIDFRKLNAVSEFDAYPMPRIDDLLEKIGAANFITTLDLCKGYWQVPLSNTCRPYTAFKTPAGLFQFTVMPFGLHGAPATFQRLMDRVLQGCNHC----SAAYLDDV----VIYSHTWEQ---HLDHLRLVLRKLQNAGLTLNVSKCEWARKETRYLGYLLGGGEVRPQVDKVEVIRNCPRPRTKKEVRSFLGLAGWYRRFVHQFATIAAPLTALTEKRQKNPVTWTDECEQAFQALKNKLCSCPVLKSPNFDQRFLVQVDASAVGLGAVLAQ-GDPGEERPVLYLSRKLQPRETRYSTVEKEGLAIKWALDSLRYYLLGREFDLETDHRALTWINTMKDHHN-RLTRWYLALQPYKFNLRHRPGKQ 1481          
BLAST of SMED30001607 vs. Ensembl Medaka
Match: ENSORLT00000034492.1 (pep primary_assembly:ASM223467v1:15:13490768:13497120:-1 gene:ENSORLG00000024904.1 transcript:ENSORLT00000034492.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 218.394 bits (555), Expect = 4.905e-57
Identity = 126/423 (29.79%), Postives = 222/423 (52.48%), Query Frame = -2
Query:  784 SNLVSHEMKINRG-PIMHAPRRQPMHLEGKIEVLVKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFSTKDN-FVLTGYHLGXXXXXXLFKD*CILSWKALFLKEL*YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAIT-GCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGSRPM----KNDTVTRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGE 2031
            + L  H +++    P+   P R P  L GK+   V  ++ +GVI    S W + +VIV KKDGS+R+C+D+R L S++E +++PM     LL+ +  + Y +++D+ + Y+QV +    +  TAF T    F  T    G       F+       +        Y+  + +F+    +  +  LK VL +++++GL +N  KCE+ +++  +LG+ + +  +     K+E ++N    K  K++RSFLG+  +++RF+ D+A IA PL A    G +  + W++E + AF   K  +C TP+L  P  N+ F++  DA    +G+VL Q  + G E  + Y SR +       +V  KE L I   +   + YL G+ F + TDH+ L ++N+ K  RN +   W  +L  + F +++R G+
Sbjct: 1028 TTLAEHTIRLKEAKPVRQQPYRVPQQLIGKLHEEVDAMLSSGVIEPSNSEWCSPVVIVTKKDGSLRICIDFRKLNSVSEFDAYPMPRIDDLLEKIGSAAYITTLDMCKGYWQVPLAASSRPYTAFQTPSGLFQFTVMPFGLHGAPATFQRLMNKVLQGCEEFSAAYLDDVVIFSSTW-EEHLQHLKRVLGKLKDSGLSLNISKCEWAKQETQYLGYQLGKGEVRPQLDKVEAVRNCPRPKTKKEIRSFLGLAGWYRRFVPDFATIAAPLTALTAKGQKNPLCWTEECERAFNALKACLCSTPVLRSPDFNKRFLVQVDASAVGLGAVLVQ-GDPGQEHPVLYLSRKLLPRETRYSVVEKEALAIKWALERLRYYLVGREFDLETDHRALTWINSMKD-RNSRITRWYLSLQPFRFNVRHRPGK 1447          
BLAST of SMED30001607 vs. Ensembl Medaka
Match: ENSORLT00000040552.1 (pep primary_assembly:ASM223467v1:6:4563337:4567860:1 gene:ENSORLG00000025739.1 transcript:ENSORLT00000040552.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 218.394 bits (555), Expect = 5.815e-57
Identity = 134/434 (30.88%), Postives = 228/434 (52.53%), Query Frame = -2
Query:  781 SNLVSHEMKINRG-PIMHAPRRQPMHLEGKIEVLVKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFSTKDN-FVLTGYHLGXXXXXXLFK----------D*CILSWKALFLKEL*YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEK-KITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGSRPMKND----TVTRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGEK 2031
            + L+SH +++  G PI   P R P  L G++   V+ +++ GVI    S W++ +VIV KKD S+R+C+D+R L +++E +++PM     LL+ +  + + +++DL + Y+QV +    +  TAF T    F  T    G       F+          + C     A +L ++     IY  T +Q    +  L+ VL ++QNAGL +N  KCE+ RK+  +LG+ +    +     K+E I+N    +  K++RSFLG+  +++RF+  +A IA PL A     +K  +TW+ E + AFQ  K  +C  P+L  P  ++ F++  DA    +G+VL+Q  + G E  + Y SR ++      +   KE L I   +   + YL G+ F + TDH+ L ++NT K   N +   W   L  Y F +++R G++
Sbjct: 1062 TTLISHSIRLKDGRPIRQRPYRVPQKLVGRLNDEVRKMLELGVIEPSNSEWSSPVVIVPKKDDSLRICIDFRKLNAVSEFDAYPMPRIDDLLEKIGAANFITTLDLCKGYWQVPLSNTCRPYTAFKTPAGLFQFTVMPFGLHGAPATFQRLMDRVLQGCNHC----SAAYLDDV----VIYSHTWEQ---HLDHLRLVLRKLQNAGLTLNVSKCEWARKETRYLGYLLGGGEVRPQVDKVEVIRNCPRPRTKKEVRSFLGLAGWYRRFVHQFATIAAPLTALTEKRQKNPVTWTDECEQAFQALKNKLCSCPVLKSPNFDQRFLVQVDASAVGLGAVLAQ-GDPGEERPVLYLSRKLQPRETRYSTVEKEGLAIKWALDSLRYYLLGREFDLETDHRALTWINTMKDHHN-RLTRWYLALQPYKFNVRHRPGKQ 1482          
BLAST of SMED30001607 vs. Planmine SMEST
Match: SMESG000081257.1 (SMESG000081257.1)

HSP 1 Score: 429.483 bits (1103), Expect = 8.151e-130
Identity = 233/565 (41.24%), Postives = 340/565 (60.18%), Query Frame = -2
Query:  451 IYLWRQNLISGSNLVSHEMKINRGPIMHAPRRQPMHLEGKIEVLVKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFSTKD-NFVLTGYHLGXXXXXXLFKD*CILSWKALFLKEL*-YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGSRPMKNDTVTRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGE-------------------KTRHENAKEAKARVKHICMFQKTEVMHRVFEAQESNKQFEKMKKCVNNGNFDK------KDVLFKLRDNLKINDGLLIVNKNGIDLLLVPIEFTQLLVTKIHGKMCHVGVKQLVHYI 2064
            I++  +  +  + +++HE+K +  PI+  PR QPMHLE K+E LV++L++AGV+RKC+S WN  LVIV K DGS+R+C+D+R L S+TE  SFPM D + LLD L  SK F S+DLGQAYY V +    Q  TAFSTK+  F       G       F+       + L  K +  Y+  I ++ E Q +    +L  V TRI+++GLK+NPEKC F +    F+GH +SE+GI TN +KI +I+N+   K   +LRSFLG+T Y++RFIK+Y+ IA PLYAA TGC+K I W++E    F   KK++CE PIL+YPR +R+FI+DTD  F  IG +        T+  I Y         VTRKELLV++E++ +F+QYLYG+RF+ RTDHK L F+NTTKK  +PQFQTW+AN SEYDF L+ RKG                    +  H++AK+AK R + I   Q +  + ++ + +++  +         NGN            +FK    L+I D +L++N +G   ++VP  + + LV   H ++CH+G+ + + Y+
Sbjct:  428 IFMASRFDLGHTKVITHELKTSGPPILQNPRGQPMHLEAKVEELVQNLLEAGVVRKCQSPWNTPLVIVGKPDGSVRICLDFRLLNSVTEKFSFPMPDMQLLLDCLGKSKIFYSIDLGQAYYLVELNENSQIKTAFSTKEGQFCFNRLPFGLSTAPATFQKLMHQILEGLVFKGVVVYLDDILIYGENQ-ETHDKLLFEVFTRIRDSGLKVNPEKCAFNKSVLNFIGHTVSEKGIQTNKRKISEIENATEPKSTTELRSFLGLTTYYRRFIKNYSMIAAPLYAATTGCDKMIVWTEECRKRFINLKKLLCEAPILEYPRADRLFIIDTDDSFEAIGHL--------TKHEIGY--------CVTRKELLVLHEFIVHFRQYLYGRRFVARTDHKALTFMNTTKKPISPQFQTWMANFSEYDFALQYRKGNEHGNAGGWSRLNNTICSHYQMEHKDAKKAKCRTRCINSLQGSSNIMKIIKQKQNEDKVTSQIISHLNGNEAHISYKTISSSIFKYLKILQIQDNVLMINTDGKLAVVVPDSYVKSLVNYFHIELCHLGINKTLFYL 975          

HSP 2 Score: 149.058 bits (375), Expect = 2.260e-72
Identity = 95/284 (33.45%), Postives = 158/284 (55.63%), Query Frame = -2
Query: 2569 VKQKANDRLATFEIRVRNMVKTIFNSGMSAEDIVQDIIANKVWDDRVKEILLKKSSIQVEEVRSTAKIHENQTLSIFESRNTNEIQV---NSYANVIRRENKNNIQEDVKSKNYTNRHQQNKFLIRPQYVQDDNKYTSIANENYNKNIP---RKQPIVSLKSIARKLYDESRGIKPSQPEILNPGNCFCCGENGNRRYQCPMKNKCLICDKENHTFGKCHLIGNHRP---QMRRTVACIXXXXXXXXXXXXXXXYACEERIIEP---ERKHGKNTEDPIAFISS 3384
            ++Q  ++R  TFEIRV+ +V  +++ G+S E+IV+ ++ + V +DR+K  L  K +I  EE+R+ AK+HE +     + R + E+QV   + YANV + + K  IQ+   ++ Y NR     +  R +  +          + YN+      R  P++S+K I RK+Y+   G+     E L PG CFCCG+N + R++CP+K+KCLIC KE H+F   +L+   R    ++ R+V CI++E ++             + +IEP     +  KN ED +A+ISS
Sbjct:    1 MRQNHDERFVTFEIRVKKLVDEVYDCGISKENIVKLVLCHGVRNDRLKGNLSTKDNITREEIRNLAKVHEAREGYNTKER-SEEVQVVVKSIYANVTQDKQKQWIQKSFNNRIYPNRQTDISYQNRNERNERQFDKVKPVTKQYNERTTMERRPPPLISMKHITRKIYNRFCGLPEPVEERLKPGKCFCCGQNDHMRFECPLKDKCLICGKEGHSFRCFNLLVKSRSNTQRLERSVYCIHKENDDR-----------SDELIEPLIHNVETKKNQEDTVAYISS 272          

HSP 3 Score: 145.206 bits (365), Expect = 2.260e-72
Identity = 75/164 (45.73%), Postives = 114/164 (69.51%), Query Frame = -1
Query: 2033 DMMYKTIDKRKWSLMRVNGVDVEMLWDSDPSVTVMSRAMWEEVGKPSVDES*II--ELFSSGNEMSLGSTIVSVLWNGKVRKISIIIVEKI*PGFIKGVNIMKLFGIKLLEINIIKVTLVNQNYTDLERIKKAMSSLNKGKNPKIERMLVKFGNIFMASKFDLG 2518
            D+M+K  D RKWS+M +NG  VEMLW+S  S++VMS   W  +G P + +S I+  E+FS+ ++  LGS  +   WN K R++++IIV KI P FI GV+ MK+FG++L E+N I+ +LVN+ +TD +R+K  + +L   KN ++  ++ +F NIFMAS+FDLG
Sbjct:  274 DVMFKKDDDRKWSIMEINGFHVEMLWNSGASISVMSEKCWRLIGSPILMDSRILLSEVFSNEDKKPLGSVKIVAKWNKKFRELNVIIVRKIHPNFIGGVDTMKIFGMELKEVNNIESSLVNKRFTDSDRLKNTLLTLKLDKNSELGTLISQFSNIFMASRFDLG 437          
BLAST of SMED30001607 vs. Planmine SMEST
Match: SMESG000038955.1 (SMESG000038955.1)

HSP 1 Score: 362.844 bits (930), Expect = 5.961e-120
Identity = 232/618 (37.54%), Postives = 330/618 (53.40%), Query Frame = -2
Query:  256 IMHAPRRQPMHLEGKIEVLVKDLIKAGVIRKCKSAWNALLVIVAKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQAYYQVGIVPEIQELTAFSTKDN-FVLTGYHLGXXXXXXLFKD*CILSWKALFLKEL*-YIWRIYLFTEKQ*KNMIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKIEDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGSRPMK----NDTVTRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGE-------KTRHEN------------AKEAKARVKHICMFQKTEVMHRVFEAQESNKQFEKMKKCVNNGNFDK------KDVLFKLRDNLKINDGLLIVNKNGIDLLLVPIEFTQLLVTK---IHGKMCH-----VGVKQLVHYIXXXXXXXXKQTKLQLINFIERFNSTIKRMLLSVMSSTNSR-NWIFILKRTIYEYNLKTNRSGNESP 1989
            I H  +++PMHLEGK+E LV++L++AGV+RK  S WN  LVIV K DGSIRMC+D+R L S+TE  SF   D + LLD L +SK FSS+DLGQAYYQV +    Q  TAFSTK+  F       G       F+       + L  K +  Y+  I ++ E Q +    +L  V TRI+++GLK+NPEKC F +    F+GH                                            +Y+ IA P+Y A TG +K I W++E  ++F   KK++CE PIL+YPR +R+F++DTDA FG IG+VLSQ+KED TE VIAYGSR +        VT KELL ++E++ +F+QYLYG+RF+ RTDHK L F+NTTKK  +PQFQTW+ANLSE+DF L+ RKGE       K+R  N            AKEAK R ++I   Q +  + ++ + Q  ++   +    + NGN            +FK    L+I D +L++N +G   ++VP     +L  +     G M        G+KQ        +     Q+ +      ER   T++ ML + ++   ++ NW  +L R  + +N     S   SP
Sbjct:  142 ITHEIKKKPMHLEGKVEELVQNLLEAGVVRKSISPWNTPLVIVGKLDGSIRMCLDFRLLNSVTEKFSFYSPDMKLLLDCLGNSKIFSSIDLGQAYYQVELNENSQIKTAFSTKEGQFCFNRLPFGLSTAPATFQKLMHQILEGLVFKGVVVYLDEILIYGENQ-EIHDKLLFEVFTRIRDSGLKVNPEKCAFNKSVLNFIGHT-------------------------------------------NYSIIAAPMYVATTGNDKMIVWTEECRNSFINLKKLLCEAPILEYPRADRLFVIDTDASFGAIGAVLSQIKEDCTEVVIAYGSRHLTKHEMGHCVTIKELLALHEFIVHFRQYLYGRRFVARTDHKALTFMNTTKKPISPQFQTWMANLSEHDFALQYRKGEEHGNADGKSRLNNTKCSHCLMENKDAKEAKCRTRYINSLQGSSNIMKIIKKQNEDRVTSENISHL-NGNEAHISYETISSRIFKYLKRLQIQDDVLMINTDGKLAVVVPDSPESILTDRGIIFEGSMFRDWMEKFGIKQ------EFSSPYQHQSNI----LAERIIRTVRDMLATSLAEIKTKNNWCRLLPRIEFSFNATIQNSTKFSP 704          

HSP 2 Score: 90.1225 bits (222), Expect = 5.961e-120
Identity = 59/152 (38.82%), Postives = 84/152 (55.26%), Query Frame = -1
Query: 2033 MRVNGVDVEMLWDSDPSVTVMSRAMWEEVGKPSVDES*I--IELFSSGNEMSLGSTIVSVLWNGKVRKISIIIVEKI*PGFIKGVNIMK--LFGIKLLEINIIKVTLVNQNYTDLERIKKAMSSLNKGKNPKIERMLVKFGNIFMASKFDLG 2476
            M +NG  V+MLWDS  S++VMS   W  +G+P + +S I    +FS  +E  LGS  +   WN KV              F +     +  L G K  E+N I+  LVN+ +TD +R+K  +S+L   KN K+  ++ KF NIFMAS+FDLG
Sbjct:    1 MEINGFHVDMLWDSGASISVMSDKYWRLIGRPILMDSRIRLSGVFSKEDEKPLGSVKIVAKWNKKV-------------SFHRRSRHHENILHGAK--EVNNIESLLVNKKFTDSDRLKITLSTLKLDKNSKLGTLISKFSNIFMASRFDLG 137          
BLAST of SMED30001607 vs. Planmine SMEST
Match: SMESG000049233.1 (SMESG000049233.1)

HSP 1 Score: 381.719 bits (979), Expect = 6.890e-119
Identity = 206/296 (69.59%), Postives = 223/296 (75.34%), Query Frame = -2
Query:  451 KRFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGSRPMKNDTVTRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGE-------------------KTRHENAKEAKARVKHICMFQKTEVMHRVFEAQESNKQFEKMKKCVNNGNFD---KKDVLFKLRDNLKINDGLLIVNKNGIDLLLVPIEFTQLLVTKIHGKMCHVGVKQLVHYI 1272
            KRFI DY KIA PLYAAI  C+K++   K     F+  KK+MCE PILDYPR NRIF L+TDA FG IGSVLSQLKEDG                VTRKELL I+EYV+YFKQYLYGK FMVRTDHK LIFLNTTKKA +PQFQTW+ NLS+YDFELK  KGE                   +TRHENAKEAK RVKHICM QKTEVMH++FEAQESNKQFEKMKKCVNNGNF    KKD  FKLRDNLK+NDGLLIVNKNG+DLLLVPIEFTQ LVTKIH KMC VGVK+LVHYI
Sbjct:  123 KRFINDYEKIAVPLYAAIELCKKRLPGRKNAMMLFRFSKKIMCEAPILDYPRENRIFNLNTDASFGEIGSVLSQLKEDGY--------------CVTRKELLAIHEYVNYFKQYLYGKLFMVRTDHKALIFLNTTKKAISPQFQTWMVNLSDYDFELKYHKGEDHSNADGLSRIGGMLCSQCQTRHENAKEAKVRVKHICMIQKTEVMHQLFEAQESNKQFEKMKKCVNNGNFGDFDKKDFFFKLRDNLKMNDGLLIVNKNGMDLLLVPIEFTQQLVTKIHEKMCRVGVKKLVHYI 404          

HSP 2 Score: 155.221 bits (391), Expect = 2.359e-39
Identity = 87/127 (68.50%), Postives = 95/127 (74.80%), Query Frame = -1
Query: 2030 MWEEVGKPSVDES*II--ELFSSGNEMSLGSTIVSVLWNGKVRKISIIIVEKI*PGFIKGVNIMKLFGIKLLEINIIKVTLVNQNYTDLERIKKAMSSLNKGKNPKIERMLVKFGNIFMASKFDLGF 2404
            M E+VGKPS  ES I    +FSSGNE  LGST+VSVLWNGK               FI GV+ M+LFGIK+LEIN I+ TLVNQNYTDLERIKKAMS LNKG+N KIERMLVKFGNIFMASKFDL F
Sbjct:    1 MSEKVGKPSFGESGITLQGVFSSGNEKQLGSTVVSVLWNGK---------------FIGGVDTMELFGIKILEINNIEETLVNQNYTDLERIKKAMSFLNKGQNLKIERMLVKFGNIFMASKFDLRF 112          
BLAST of SMED30001607 vs. Planmine SMEST
Match: SMESG000049233.1 (SMESG000049233.1)

HSP 1 Score: 379.793 bits (974), Expect = 1.468e-118
Identity = 205/295 (69.49%), Postives = 222/295 (75.25%), Query Frame = -2
Query:  451 RFIKDYAKIAGPLYAAITGCEKKITWSKE*DDAFQVFKKVMCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGSRPMKNDTVTRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKARNPQFQTWIANLSEYDFELKNRKGE-------------------KTRHENAKEAKARVKHICMFQKTEVMHRVFEAQESNKQFEKMKKCVNNGNFD---KKDVLFKLRDNLKINDGLLIVNKNGIDLLLVPIEFTQLLVTKIHGKMCHVGVKQLVHYI 1269
            RFI DY KIA PLYAAI  C+K++   K     F+  KK+MCE PILDYPR NRIF L+TDA FG IGSVLSQLKEDG                VTRKELL I+EYV+YFKQYLYGK FMVRTDHK LIFLNTTKKA +PQFQTW+ NLS+YDFELK  KGE                   +TRHENAKEAK RVKHICM QKTEVMH++FEAQESNKQFEKMKKCVNNGNF    KKD  FKLRDNLK+NDGLLIVNKNG+DLLLVPIEFTQ LVTKIH KMC VGVK+LVHYI
Sbjct:   96 RFINDYEKIAVPLYAAIELCKKRLPGRKNAMMLFRFSKKIMCEAPILDYPRENRIFNLNTDASFGEIGSVLSQLKEDGY--------------CVTRKELLAIHEYVNYFKQYLYGKLFMVRTDHKALIFLNTTKKAISPQFQTWMVNLSDYDFELKYHKGEDHSNADGLSRIGGMLCSQCQTRHENAKEAKVRVKHICMIQKTEVMHQLFEAQESNKQFEKMKKCVNNGNFGDFDKKDFFFKLRDNLKMNDGLLIVNKNGMDLLLVPIEFTQQLVTKIHEKMCRVGVKKLVHYI 376          

HSP 2 Score: 122.094 bits (305), Expect = 1.301e-28
Identity = 70/110 (63.64%), Postives = 79/110 (71.82%), Query Frame = -1
Query: 2081 MWEEVGKPSVDES*II--ELFSSGNEMSLGSTIVSVLWNGKVRKISIIIVEKI*PGFIKGVNIMKLFGIKLLEINIIKVTLVNQNYTDLERIKKAMSSLNKGKNPKIERM 2404
            M E+VGKPS  ES I    +FSSGNE  LGST+VSVLWNGK               FI GV+ M+LFGIK+LEIN I+ TLVNQNYTDLERIKKAMS LNKG+N KIER+
Sbjct:    1 MSEKVGKPSFGESGITLQGVFSSGNEKQLGSTVVSVLWNGK---------------FIGGVDTMELFGIKILEINNIEETLVNQNYTDLERIKKAMSFLNKGQNLKIERI 95          
BLAST of SMED30001607 vs. Planmine SMEST
Match: SMESG000017400.1 (SMESG000017400.1)

HSP 1 Score: 350.903 bits (899), Expect = 2.432e-111
Identity = 189/250 (75.60%), Postives = 215/250 (86.00%), Query Frame = -2
Query: 2554 MSAEDIVQDIIANKVWDDRVKEILLKKSSIQVEEVRSTAKIHENQTLSIFESRNTNEIQVNSYANVIRRENKNNIQEDVKSKNYTNRHQQNKFLIRPQYVQDDNKYTSIANENYNKNIPRKQPIVSLKSIARKLYDESRGIKPSQPEILNPGNCFCCGENGNRRYQCPMKNKCLICDKENHTFGKCHLIGNHRPQMRRTVACIXXXXXXXXXXXXXXXYACEERIIEPERKHGKNTEDPIAFISSVGLSN 3303
            MS EDIV+DII+NKV +DRVKEILL KS IQ+EEVRSTAKI++N TLSI E RNTNEIQVNSY+N +RRENK++ QED+K KNY NR+QQ+ FL R QYVQD+NKYT+IAN+NY KN+PRKQP VSLKSI RK+YD SR IK  QPEILNPGNCF C E+  RRYQ PMKNKCLIC KENHTFG+CHL+G+HRPQ RRTVACI+EE NND+NFDDNNSYA  ER IE +RKHGKN EDPI FISSVGL+N
Sbjct:    1 MSEEDIVRDIISNKVREDRVKEILLTKSRIQMEEVRSTAKIYKNITLSISEIRNTNEIQVNSYSNAVRRENKSDNQEDIKLKNYINRYQQSNFLKRSQYVQDNNKYTAIANKNYYKNMPRKQPSVSLKSITRKIYDGSRVIKQRQPEILNPGNCFYCEESALRRYQYPMKNKCLICGKENHTFGRCHLLGSHRPQRRRTVACIHEEDNNDKNFDDNNSYASGERTIEQKRKHGKNIEDPITFISSVGLNN 250          
The following BLAST results are available for this feature:
BLAST of SMED30001607 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RTL19.731e-1221.70retrotransposon Gag like 1 [Source:HGNC Symbol;Acc... [more]
RTL19.731e-1221.70retrotransposon Gag like 1 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of SMED30001607 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001607 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001607 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX571665.12.438e-4429.26pep chromosome:GRCz11:17:35431724:35437222:1 gene:... [more]
CR354395.25.041e-4429.05pep chromosome:GRCz11:12:13553730:13556536:-1 gene... [more]
CR533578.31.101e-4329.05pep chromosome:GRCz11:16:23466094:23471387:-1 gene... [more]
CU929458.12.696e-4329.05pep chromosome:GRCz11:11:43363075:43368382:1 gene:... [more]
BX511224.15.233e-4329.52pep chromosome:GRCz11:2:18017000:18022765:1 gene:E... [more]
back to top
BLAST of SMED30001607 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
anxa62.917e-5531.93annexin A6 [Source:Xenbase;Acc:XB-GENE-989741][more]
ENSXETT00000006041.14.806e-4530.24pep primary_assembly:Xenopus_tropicalis_v9.1:6:373... [more]
ENSXETT00000024810.13.403e-3933.85pep primary_assembly:Xenopus_tropicalis_v9.1:KV464... [more]
ENSXETT00000035398.14.735e-3528.82pep primary_assembly:Xenopus_tropicalis_v9.1:3:986... [more]
ENSXETT00000034712.11.008e-3429.07pep primary_assembly:Xenopus_tropicalis_v9.1:9:335... [more]
back to top
BLAST of SMED30001607 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Rtl14.426e-1224.06retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:M... [more]
Rtl14.426e-1224.06retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of SMED30001607 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P04323|POL3_DROME3.468e-4830.19Retrovirus-related Pol polyprotein from transposon... [more]
sp|Q7LHG5|YI31B_YEAST1.454e-4531.69Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomy... [more]
sp|Q99315|YG31B_YEAST3.894e-4531.69Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomy... [more]
sp|P20825|POL2_DROME4.156e-4429.53Retrovirus-related Pol polyprotein from transposon... [more]
sp|Q8I7P9|POL5_DROME3.023e-4230.51Retrovirus-related Pol polyprotein from transposon... [more]
back to top
BLAST of SMED30001607 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0V0RD692.724e-7631.48Retrovirus-related Pol polyprotein from transposon... [more]
A0A0V1NCS24.386e-7634.07Retrovirus-related Pol polyprotein from transposon... [more]
A0A0V0T9Q47.255e-7630.09Transposon Ty3-G Gag-Pol polyprotein OS=Trichinell... [more]
A0A0V0RP879.534e-7630.65Transposon Ty3-G Gag-Pol polyprotein OS=Trichinell... [more]
A0A0V1ND631.812e-7534.00Retrovirus-related Pol polyprotein from transposon... [more]
back to top
BLAST of SMED30001607 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000048272.17.826e-7134.40pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000052614.11.221e-5938.96pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000034038.13.268e-5933.11pep primary_assembly:Astyanax_mexicanus-2.0:14:312... [more]
ENSAMXT00000042253.15.867e-5732.20pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000054230.12.272e-5631.04pep primary_assembly:Astyanax_mexicanus-2.0:14:194... [more]
back to top
BLAST of SMED30001607 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001607 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001607 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001607 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000040305.14.465e-6932.77pep primary_assembly:ASM223467v1:1:25459511:254666... [more]
ENSORLT00000036827.14.449e-6432.58pep primary_assembly:ASM223467v1:16:28613823:28617... [more]
ENSORLT00000030651.12.543e-5731.11pep primary_assembly:ASM223467v1:5:21308959:213150... [more]
ENSORLT00000034492.14.905e-5729.79pep primary_assembly:ASM223467v1:15:13490768:13497... [more]
ENSORLT00000040552.15.815e-5730.88pep primary_assembly:ASM223467v1:6:4563337:4567860... [more]
back to top
BLAST of SMED30001607 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081257.18.151e-13041.24SMESG000081257.1[more]
SMESG000038955.15.961e-12037.54SMESG000038955.1[more]
SMESG000049233.16.890e-11969.59SMESG000049233.1[more]
SMESG000049233.11.468e-11869.49SMESG000049233.1[more]
SMESG000017400.12.432e-11175.60SMESG000017400.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001607 ID=SMED30001607|Name=SMED30001607|organism=Schmidtea mediterranea sexual|type=transcript|length=4069bp
AAAAAACATCAAATATTTTAACTATTTTGATTGCGCATATTGTCAGGATT
ATTAGATTCTAGCTCAGGAATATTTGATCCGGTACGTCTTTCTAACTGTG
TTTCTATTTGCCGCCAACCTTTGAAAATATTGAATTCTAAAATCACCAAT
TTCAGACATTTCAATTACTGTCATCGTGTTTAGACGTATAAATTGCTCAG
AAATATTTAAATTAACATCATTGTTGAAACCATTATGACCCAAAAAAGAT
TTAGCTGGAGACTCATTACCAGATCTGTTTGTTTTTAAATTGTATTCGTA
AATTGTCCTTTTCAGAATAAATATCCAGTTTCTTGAATTTGTCGAAGACA
TGACAGATAGTAGCATTCTTTTAATGGTAGAATTAAACCGTTCAATAAAA
TTAATTAATTGAAGTTTGGTTTGTTTATTTTACACCACATTCTTGACATT
TATATAATGCACTAGTTGTTTTACTCCGACATGGCACATTTTTCCGTGAA
TTTTAGTAACAAGTAGTTGAGTGAATTCGATGGGGACCAATAATAAATCA
ATCCCATTTTTATTTACAATCAAAAGACCATCATTTATTTTCAAATTATC
CCTTAGCTTAAAAAGGACATCTTTTTTATCAAAATTTCCATTATTTACAC
ATTTTTTCATCTTTTCAAATTGCTTATTGCTTTCTTGAGCTTCAAATACT
CGGTGCATTACTTCTGTCTTTTGAAACATACAAATGTGTTTTACTCTGGC
TTTAGCTTCCTTAGCATTTTCATGTCTTGTTTTTTCACCTTTACGGTTTT
TTAATTCAAAATCGTATTCTGATAAATTCGCTATCCAAGTTTGAAATTGT
GGATTTCTTGCTTTCTTGGTCGTATTGAGAAATATCAATGTCTTGTGATC
TGTTCGCACCATGAATCTTTTCCCATATAAATATTGTTTGAAGTAACTAA
CGTATTCATTTATGACGAGTAATTCTTTTCTCGTGACAGTATCATTTTTC
ATGGGTCTAGATCCATATGCTATGACTGTCTCTGTACCGTCTTCTTTGAG
CTGACTTAGCACTGATCCGATTGTTCCAAAACGGGCATCTGTGTCGAGAA
TAAAAATTCTATTTCCCCGGGGATAATCTAAAATTGGGGTTTCACACATT
ACTTTTTTGAAAACCTGAAAAGCATCATCTCATTCTTTCGACCAGGTAAT
CTTTTTTTCGCATCCTGTTATTGCTGCATAAAGAGGACCTGCGATCTTTG
CATAATCTTTTATAAATCTTTTAAAATAATTTGTAATACCTAAAAAGGAC
CTTAATTGCTTTGCACATTTTGAATTTTCCGAATTTTTAATATCTTCTAT
CTTTTTATCATTTGTATGAATCCCTTCTTCACTTATGGCATGACCAAGAA
AAAACCATTTCTTTCTGTAAAACTCACATTTCTCAGGATTGATCTTTAAA
CCTGCATTTTGAATTCTTGTTAGCACAGCTTTAAGTATTGGAATCATGTT
CTTTTATTGTTTTTCCGTAAATAAGTATATCCTCCAAATATACTATAACT
CCTTTAAAAATAATGCCTTCCAAGAGAGTATGCATCAGTCTTTGAAAAGT
AGCTGGAGCTGTTGCTAACCCAAATGGTAGCCTGTTAAAACAAAATTGTC
CTTAGTACTGAATGCAGTCAACTCTTGTATTTCTGGAACTATACCAACTT
GGTAATATGCCTGTCCTAAGTCTACTGAGGAAAAATATTTTGAATCTGCT
AAGTAATCTAACAGGAATCGAGTGTCTCTCATCGGAAATGATTCGTTTTC
TGTGATTGATTTGAGGCCTCTGTAGTCAACGCACATTCTGATGCTTCCAT
CTTTCTTAGCTACAATAACTAACAGAGCATTCCAAGCACTTTTACACTTA
CGAATCACTCCAGCTTTTATGAGGTCTTTTACTAAAACTTCTATTTTACC
TTCCAAATGCATAGGTTGCCTTCTGGGGGCGTGCATAATTGGGCCTCGAT
TTATTTTCATTTCATGACTAACCAGGTTTGAACCCGAGATCAAATTTTGA
CGCCATAAATATATTCCCAAATTTTACTAACATCCTTTCAATCTTTGGAT
TCTTTCCTTTGTTTAGAGACGACATTGCTTTCTTTATCCTTTCCAAATCG
GTATAATTTTGATTAACTAAAGTTACTTTAATAATATTTATTTCTAAAAG
TTTGATTCCAAATAGCTTCATTATGTTCACACCCTTAATAAACCCTGGTT
AAATTTTTTCAACTATGATTATGCTAATTTTACGTACTTTTCCATTCCAT
AAAACACTGACAATAGTACTTCCTAGTGACATTTCGTTTCCAGATGAAAA
CAATTCAATAATTCAACTCTCATCGACGCTTGGTTTCCCTACTTCTTCCC
ACATTGCTCTGCTCATCACTGTTACAGAAGGATCTGAATCCCACAACATC
TCAACATCCACTCCATTTACTCTCATTAAACTCCATTTCCGTTTATCTAT
GGTCTTATACATCATATCCCTCTTTATATCATTTCGTTTTCTTTCTAAAT
TCAATTGCTCAATCCTACTGACGAAATGAAAGCAATGGGATCCTCCGTGT
TTTTTCCATGTTTTCTTTCCGGCTCAATTATTCTCTCTTCACAAGCATAT
GAATTATTATCATCAAAATTTTCATCATTGTTATATTCTTCATAAATACA
TGCAACAGTTCGTCTCATTTGTGGTCTGTGGTTACCTATCAGATGACATT
TTCCAAAGGTATGGTTTTCCTTATCACAAATTAAACATTTATTTTTCATT
GGACACTGATAACGTCTATTCCCATTTTCTCCACAACAAAAACAATTACC
TGGGTTCAAAATCTCTGGTTGGCTTGGTTTAATTCCGCGACTTTCATCGT
ATAGTTTTCTAGCTATACTTTTCAATGACACGATTGGTTGCTTCCTTGGG
ATATTTTTATTATAATTTTCATTAGCGATCGATGTATATTTATTGTCATC
TTGAACATATTGGGGACGTATTAAAAATTTATTCTGTTGATGCCTATTTG
TATAATTTTTTGACTTGACATCTTCTTGAATATTATTTTTATTTTCTCTC
CGTATCACATTAGCGTAACTGTTTACTTGAATTTCATTAGTATTTCTACT
CTCGAAAATTGATAGTGTCTGATTTTCATGTATTTTAGCAGTTGATCTAA
CTTCCTCCACCTGTATGCTTGACTTTTTCAATAGAATTTCCTTGACTCGA
TCATCCCATACTTTATTCGCAATAATATCTTGAACAATGTCTTCTGCGCT
CATTCCTGAATTAAATATGGTTTTAACCATATTTCGGACTCTAATCTCAA
ATGTTGCCAATCTGTCATTTGCTTTTTGTTTCACGGCATTTAAATCAAAG
ATCTGTCTTGTAATTGTTTTTTTAATGGTAAAACAATCTACAAACCAGTT
TTTTGCTTTTTCATCTGTTGAACAGCTGTCTCTATAACACTTCCATAACA
CTGCACCTTAATCTTTCTATAACATATAGAAAGCACTAATTAAACTTTGA
CTTTCGATTTGCAGCAATTCGGTAATATCTTTTATCCGTTTTTCAGCTTC
CGTCGTGCTTCGACTATCGAACTTCCGTACATTAAAATCAAGCATGCTGC
AAGCCTGCTTTGATAACAATTCCAAAAATCTTTTTGTTTGGCTTCTTGCT
TTCCAATAAAGTACGATTTGTCTGATGGATTTAGCATAAACTATTTAATA
ACAGAAAATGGAATACAGAACACATTCTAATACACACTCATCAAAGCGAT
CCATTCTGGAAGATTATTGATTTACAGCGCATCAGTATGTCAGGACATAA
GGACAAAGAAAGGGTAAGGGTAGCGGGAAAAATTGCGAGATCGTTGCAAC
AGTACAAATGAATAGCTATCGGAAAAAGATTAATGCGAACGACCAAAATC
ATGAAAAGGAATATTTTGAATAATATGTAAGAACTAAACAAATTATTTTG
AGTTGAGACGGAAAATATGGGCGGAACGCTGCGCAAATTTTCGGAAATAG
TTAAAACATTTATCATAAA
back to top

protein sequence of SMED30001607-orf-1

>SMED30001607-orf-1 ID=SMED30001607-orf-1|Name=SMED30001607-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=240bp
MCETPILDYPRGNRIFILDTDARFGTIGSVLSQLKEDGTETVIAYGSRPM
KNDTVTRKELLVINEYVSYFKQYLYGKRFMVRTDHKTLIFLNTTKKARNP
QFQTWIANLSEYDFELKNRKGEKTRHENAKEAKARVKHICMFQKTEVMHR
VFEAQESNKQFEKMKKCVNNGNFDKKDVLFKLRDNLKINDGLLIVNKNGI
DLLLVPIEFTQLLVTKIHGKMCHVGVKQLVHYINVKNVV*
back to top

protein sequence of SMED30001607-orf-2

>SMED30001607-orf-2 ID=SMED30001607-orf-2|Name=SMED30001607-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=132bp
MKINRGPIMHAPRRQPMHLEGKIEVLVKDLIKAGVIRKCKSAWNALLVIV
AKKDGSIRMCVDYRGLKSITENESFPMRDTRFLLDYLADSKYFSSVDLGQ
AYYQVGIVPEIQELTAFSTKDNFVLTGYHLG*
back to top

protein sequence of SMED30001607-orf-3

>SMED30001607-orf-3 ID=SMED30001607-orf-3|Name=SMED30001607-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=260bp
MVKTIFNSGMSAEDIVQDIIANKVWDDRVKEILLKKSSIQVEEVRSTAKI
HENQTLSIFESRNTNEIQVNSYANVIRRENKNNIQEDVKSKNYTNRHQQN
KFLIRPQYVQDDNKYTSIANENYNKNIPRKQPIVSLKSIARKLYDESRGI
KPSQPEILNPGNCFCCGENGNRRYQCPMKNKCLICDKENHTFGKCHLIGN
HRPQMRRTVACIYEEYNNDENFDDNNSYACEERIIEPERKHGKNTEDPIA
FISSVGLSN*
back to top

protein sequence of SMED30001607-orf-4

>SMED30001607-orf-4 ID=SMED30001607-orf-4|Name=SMED30001607-orf-4|organism=Schmidtea mediterranea sexual|type=polypeptide|length=106bp
MIPILKAVLTRIQNAGLKINPEKCEFYRKKWFFLGHAISEEGIHTNDKKI
EDIKNSENSKCAKQLRSFLGITNYFKRFIKDYAKIAGPLYAAITGCEKKI
TWSKE*
back to top

protein sequence of SMED30001607-orf-5

>SMED30001607-orf-5 ID=SMED30001607-orf-5|Name=SMED30001607-orf-5|organism=Schmidtea mediterranea sexual|type=polypeptide|length=101bp
MLLSVMSSTNSRNWIFILKRTIYEYNLKTNRSGNESPAKSFLGHNGFNND
VNLNISEQFIRLNTMTVIEMSEIGDFRIQYFQRLAANRNTVRKTYRIKYS
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR011528NERD
IPR000477RT_dom
IPR012337RNaseH-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding