Zinc finger-like protein

Overview
NameZinc finger-like protein
Smed IDSMED30001601
Length (bp)2482
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger-like protein (SMED30001601) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger-like protein (SMED30001601) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger-like protein (SMED30001601) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger-like protein (SMED30001601) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001601

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridial progenitor cellSMED30001601SMESG000026829.1 SMED30001601smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30001601SMESG000026829.1 dd_Smed_v4_2946_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30001601SMESG000026829.1 dd_Smed_v4_2946_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001601SMESG000026829.1 dd_Smed_v4_2946_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001601SMESG000026829.1 dd_Smed_v4_2946_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001601SMESG000026829.1 dd_Smed_v4_2946_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001601SMESG000026829.1 Contig39268newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001601SMESG000026829.1 Contig39268uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30001601SMESG000026829.1 dd_Smed_v4_2946_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger-like protein vs. Ensembl Human
Match: IKZF3 (IKAROS family zinc finger 3 [Source:HGNC Symbol;Acc:HGNC:13178])

HSP 1 Score: 70.8626 bits (172), Expect = 4.820e-12
Identity = 51/175 (29.14%), Postives = 82/175 (46.86%), Query Frame = 3
Query: 1482 DLTLTVKQEHINYTDTDNKIERFFNSNLPIWPCATSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKSNITVKLSSSECLEYLERM 2000
            D ++ VK E+    +   K E   N+  P  P + S +   Y + +    ++       +    + +S   NC+ C L   S N L  H  + +  R F+C  C A+FTQ+ NL RH   H G KPF C++C+ A  R+D L  H+  +H  S    +I  ++ S   L  L+R+
Sbjct:   55 DDSMKVKDEYSERDENVLKSEPMGNAEEPEIPYSYSREYNEYENIKLERHVV-------SFDSSRPTSGKMNCDVCGLSCISFNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHTGEKPFKCHLCNYACQRRDALTGHLR-THSASAEARHIKAEMGSERAL-VLDRL 220          
BLAST of Zinc finger-like protein vs. Ensembl Human
Match: IKZF3 (IKAROS family zinc finger 3 [Source:HGNC Symbol;Acc:HGNC:13178])

HSP 1 Score: 69.707 bits (169), Expect = 8.154e-12
Identity = 51/175 (29.14%), Postives = 82/175 (46.86%), Query Frame = 3
Query: 1482 DLTLTVKQEHINYTDTDNKIERFFNSNLPIWPCATSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKSNITVKLSSSECLEYLERM 2000
            D ++ VK E+    +   K E   N+  P  P + S +   Y + +    ++       +    + +S   NC+ C L   S N L  H  + +  R F+C  C A+FTQ+ NL RH   H G KPF C++C+ A  R+D L  H+  +H  S    +I  ++ S   L  L+R+
Sbjct:   21 DDSMKVKDEYSERDENVLKSEPMGNAEEPEIPYSYSREYNEYENIKLERHVV-------SFDSSRPTSGKMNCDVCGLSCISFNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHTGEKPFKCHLCNYACQRRDALTGHLR-THSASAEARHIKAEMGSERAL-VLDRL 186          
BLAST of Zinc finger-like protein vs. Ensembl Human
Match: ZNF746 (zinc finger protein 746 [Source:HGNC Symbol;Acc:HGNC:21948])

HSP 1 Score: 70.0922 bits (170), Expect = 1.112e-11
Identity = 30/80 (37.50%), Postives = 39/80 (48.75%), Query Frame = 3
Query: 1677 KSSKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRH 1910
            +      C +C   F     L +H    +  R F CT C   FT+RS L  H   H G +PF C VC K++ RKDHL +H
Sbjct:  506 RDGSALRCGECGRCFTRPAHLIRHRMLHTGERPFPCTECEKRFTERSKLIDHYRTHTGVRPFTCTVCGKSFIRKDHLRKH 585          
BLAST of Zinc finger-like protein vs. Ensembl Human
Match: ZNF746 (zinc finger protein 746 [Source:HGNC Symbol;Acc:HGNC:21948])

HSP 1 Score: 70.0922 bits (170), Expect = 1.149e-11
Identity = 30/80 (37.50%), Postives = 39/80 (48.75%), Query Frame = 3
Query: 1677 KSSKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRH 1910
            +      C +C   F     L +H    +  R F CT C   FT+RS L  H   H G +PF C VC K++ RKDHL +H
Sbjct:  505 RDGSALRCGECGRCFTRPAHLIRHRMLHTGERPFPCTECEKRFTERSKLIDHYRTHTGVRPFTCTVCGKSFIRKDHLRKH 584          
BLAST of Zinc finger-like protein vs. Ensembl Human
Match: GFI1 (growth factor independent 1 transcriptional repressor [Source:HGNC Symbol;Acc:HGNC:4237])

HSP 1 Score: 69.3218 bits (168), Expect = 1.173e-11
Identity = 33/83 (39.76%), Postives = 47/83 (56.63%), Query Frame = 3
Query: 1683 SKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSH 1925
            ++ + C  C  +F+  + + KHTF  +  +  +C  C   F+Q SNL  HS KH GFKPF C++C K + RK  L RH E  H
Sbjct:  337 TRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH 419          
BLAST of Zinc finger-like protein vs. Ensembl Celegans
Match: pag-3 (Zinc finger protein PAG-3 [Source:UniProtKB/TrEMBL;Acc:G5EDE1])

HSP 1 Score: 72.7886 bits (177), Expect = 2.045e-13
Identity = 33/85 (38.82%), Postives = 49/85 (57.65%), Query Frame = 3
Query: 1683 SKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPG 1931
            ++ + C  C  +F+  + + KHT+  +  +  +CT C   F+Q SNL  H+ KH GFKPF C+VC + + RK    RH E  HPG
Sbjct:  179 TRPYPCEYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCGKAFSQSSNLITHTRKHTGFKPFACDVCGRTFQRKVDRRRHRESHHPG 263          

HSP 2 Score: 50.447 bits (119), Expect = 2.773e-6
Identity = 28/88 (31.82%), Postives = 44/88 (50.00%), Query Frame = 3
Query: 1686 KVFNCNQCKLQFNSLNALCKHT---FSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            K F+C +C   F+++ AL +H     SD + F C  C   F + S L  H L H   +P+ C  C K +++K  + +H  + H G  P
Sbjct:  124 KPFHCQKCTKLFSTIAALEQHQQVHVSD-KQFECKQCGKTFKRSSTLSTHLLIHSDTRPYPCEYCGKRFHQKSDMKKHTYI-HTGEKP 209          
BLAST of Zinc finger-like protein vs. Ensembl Celegans
Match: K11D2.4 (pep chromosome:WBcel235:I:12518787:12527906:1 gene:WBGene00010770.1 transcript:K11D2.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K11D2.4)

HSP 1 Score: 62.003 bits (149), Expect = 9.622e-10
Identity = 24/73 (32.88%), Postives = 45/73 (61.64%), Query Frame = 3
Query: 1698 CNQCKLQFNSLNALCKHT--FSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRH 1910
            C++C  +F +   L +H    ++ +A+ CTFC+ +FTQ+S+L +H   H G KPF+C  C +++ ++   + H
Sbjct:  249 CDRCGKRFKARGGLQQHMRIHNNEKAYVCTFCAKSFTQKSHLDQHERIHTGVKPFLCAFCGRSFRQRSQQIGH 321          
BLAST of Zinc finger-like protein vs. Ensembl Celegans
Match: K11D2.4 (pep chromosome:WBcel235:I:12523505:12527906:1 gene:WBGene00010770.1 transcript:K11D2.4c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K11D2.4)

HSP 1 Score: 61.6178 bits (148), Expect = 1.040e-9
Identity = 24/73 (32.88%), Postives = 45/73 (61.64%), Query Frame = 3
Query: 1698 CNQCKLQFNSLNALCKHT--FSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRH 1910
            C++C  +F +   L +H    ++ +A+ CTFC+ +FTQ+S+L +H   H G KPF+C  C +++ ++   + H
Sbjct:  175 CDRCGKRFKARGGLQQHMRIHNNEKAYVCTFCAKSFTQKSHLDQHERIHTGVKPFLCAFCGRSFRQRSQQIGH 247          
BLAST of Zinc finger-like protein vs. Ensembl Celegans
Match: K11D2.4 (pep chromosome:WBcel235:I:12523211:12527906:1 gene:WBGene00010770.1 transcript:K11D2.4e.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K11D2.4)

HSP 1 Score: 61.6178 bits (148), Expect = 1.190e-9
Identity = 24/73 (32.88%), Postives = 45/73 (61.64%), Query Frame = 3
Query: 1698 CNQCKLQFNSLNALCKHT--FSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRH 1910
            C++C  +F +   L +H    ++ +A+ CTFC+ +FTQ+S+L +H   H G KPF+C  C +++ ++   + H
Sbjct:  237 CDRCGKRFKARGGLQQHMRIHNNEKAYVCTFCAKSFTQKSHLDQHERIHTGVKPFLCAFCGRSFRQRSQQIGH 309          
BLAST of Zinc finger-like protein vs. Ensembl Celegans
Match: klu-1 (KLUmpfuss related [Source:UniProtKB/TrEMBL;Acc:O46016])

HSP 1 Score: 62.003 bits (149), Expect = 1.330e-9
Identity = 39/126 (30.95%), Postives = 53/126 (42.06%), Query Frame = 3
Query: 1608 ISTQQPTTMLMKPKKTQAIAGHKKSSKV----FNCNQCKLQFNSLNALCKHTFSDHRAFRCTF-----------CSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            IST  P  +  + K     A    SS+     + C  C   F   + L KH  S HR   CT            CS +F++   L RH   H G KP+ C  C++ + R DHL  H+  +H G  P
Sbjct:  300 ISTPGPLKVFPRSKDDMTFAPRDDSSRAKQMQYPCTLCGQAFAVHDRLAKHIASRHRQRSCTLDDASKVHKCNMCSKSFSRSDMLTRHMRLHTGAKPYSCPTCNQVFSRSDHLSTHLR-THTGEKP 424          

HSP 2 Score: 51.9878 bits (123), Expect = 1.508e-6
Identity = 24/82 (29.27%), Postives = 42/82 (51.22%), Query Frame = 3
Query: 1680 SSKVFNCNQCKLQFNSLNALCKHT--FSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEV 1919
            +SKV  CN C   F+  + L +H    +  + + C  C+  F++  +L  H   H G KP+ C +C+ +  R+D + RH+  
Sbjct:  365 ASKVHKCNMCSKSFSRSDMLTRHMRLHTGAKPYSCPTCNQVFSRSDHLSTHLRTHTGEKPYACPMCNYSASRRDMISRHMRT 446          
BLAST of Zinc finger-like protein vs. Ensembl Fly
Match: sens-2 (gene:FBgn0051632 transcript:FBtr0079341)

HSP 1 Score: 71.2478 bits (173), Expect = 2.843e-12
Identity = 33/83 (39.76%), Postives = 48/83 (57.83%), Query Frame = 3
Query: 1683 SKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSH 1925
            ++ + CN C  +F+  + + KHT+  +  +  +C  C   F+Q SNL  HS KH G+KPF C +C KA+ RK  L RH E  H
Sbjct:  589 TRPYPCNYCGKRFHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGYKPFSCKLCHKAFQRKVDLRRHKETQH 671          
BLAST of Zinc finger-like protein vs. Ensembl Fly
Match: sens-2 (gene:FBgn0051632 transcript:FBtr0345446)

HSP 1 Score: 71.2478 bits (173), Expect = 2.843e-12
Identity = 33/83 (39.76%), Postives = 48/83 (57.83%), Query Frame = 3
Query: 1683 SKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSH 1925
            ++ + CN C  +F+  + + KHT+  +  +  +C  C   F+Q SNL  HS KH G+KPF C +C KA+ RK  L RH E  H
Sbjct:  589 TRPYPCNYCGKRFHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGYKPFSCKLCHKAFQRKVDLRRHKETQH 671          
BLAST of Zinc finger-like protein vs. Ensembl Fly
Match: sens (gene:FBgn0002573 transcript:FBtr0075862)

HSP 1 Score: 69.3218 bits (168), Expect = 8.222e-12
Identity = 35/104 (33.65%), Postives = 59/104 (56.73%), Query Frame = 3
Query: 1683 SKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKSN---ITVKLSSSEC 1979
            ++ + C  C  +F+  + + KHT+  +  +  +CT C   F+Q SNL  H  KH G+KPF C++C +++ RK  L RH E  H  + P  +   + +++SSS C
Sbjct:  438 TRPYPCQYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCLKAFSQSSNLITHMRKHTGYKPFGCHLCDQSFQRKVDLRRHRESRHEEAPPVEDLKPLKMEVSSSSC 541          

HSP 2 Score: 66.6254 bits (161), Expect = 5.723e-11
Identity = 32/91 (35.16%), Postives = 48/91 (52.75%), Query Frame = 3
Query: 1674 KKSSKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            K+S + F C QC   F   + L  H    SD R + C +C   F Q+S++++H+  H G KP  C VC KA+ +  +L+ H+   H G  P
Sbjct:  407 KRSGRNFQCKQCGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCLKAFSQSSNLITHMR-KHTGYKP 496          
BLAST of Zinc finger-like protein vs. Ensembl Fly
Match: Cf2 (gene:FBgn0000286 transcript:FBtr0089649)

HSP 1 Score: 66.6254 bits (161), Expect = 5.670e-11
Identity = 36/108 (33.33%), Postives = 51/108 (47.22%), Query Frame = 3
Query: 1623 PTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHT--FSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            P T+ M  K     A      + + C+ C   F   N L +HT   +  + FRC +C   FT +  L +H   H G KPF C  C K++  KD+L +HI  +H G  P
Sbjct:  378 PGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFRCGYCGRAFTVKDYLNKHLTTHTGEKPFHCGYCEKSFSVKDYLTKHIR-THTGEKP 484          

HSP 2 Score: 58.151 bits (139), Expect = 2.033e-8
Identity = 38/159 (23.90%), Postives = 73/159 (45.91%), Query Frame = 3
Query: 1491 LTVKQEHINYTDTDNKIERFFNSNLPIWPCATSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKH---------TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            + +K+E ++ +D+ + +     +++P++    +    P +     + +L+  +   A   HK   K   C  C   F +   L  H              R + C++C  +FTQ + L++H+  H G KPF C  C +A+  KD+L +H+  +H G  P
Sbjct:  311 VIIKEEPLSLSDSGDVV-----NSVPVY----AIQANPGVPAPASSGVLVGTQTVPADLAHKIRHK---CPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFRCGYCGRAFTVKDYLNKHL-TTHTGEKP 456          

HSP 3 Score: 53.1434 bits (126), Expect = 7.842e-7
Identity = 26/85 (30.59%), Postives = 38/85 (44.71%), Query Frame = 3
Query: 1680 SSKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHP 1928
              K F C  C   F   + L KH  T +  + F C +C  +F+ +  L +H   H G KP+ C  C K + ++  L  H    HP
Sbjct:  425 GEKPFRCGYCGRAFTVKDYLNKHLTTHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVHTTKLHP 509          
BLAST of Zinc finger-like protein vs. Ensembl Fly
Match: prg (gene:FBgn0285971 transcript:FBtr0079674)

HSP 1 Score: 66.6254 bits (161), Expect = 6.262e-11
Identity = 31/86 (36.05%), Postives = 50/86 (58.14%), Query Frame = 3
Query: 1692 FNCNQCKLQFNSLNALCKHTFSDH---RAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            + CN C ++  +  AL  H  + H   R + C  C   F +RS+L++H++ H G +PF CNVCSK++ R  +L +H+ + H G  P
Sbjct:  237 YCCNFCNIKLVTRPALISHIKTLHDPDRPYVCAHCRKGFVRRSDLKKHTIVHTGVRPFTCNVCSKSFSRNTNLTKHMRI-HSGVKP 321          

HSP 2 Score: 52.373 bits (124), Expect = 1.439e-6
Identity = 29/105 (27.62%), Postives = 48/105 (45.71%), Query Frame = 3
Query: 1602 PYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRH 1910
            PY        ++ +P     I       + + C  C+  F   + L KHT   +  R F C  CS +F++ +NL +H   H G KPF+C  C +++     ++RH
Sbjct:  236 PYCCNFCNIKLVTRPALISHIKTLHDPDRPYVCAHCRKGFVRRSDLKKHTIVHTGVRPFTCNVCSKSFSRNTNLTKHMRIHSGVKPFVCQQCPRSFQTAVEMMRH 340          
BLAST of Zinc finger-like protein vs. Ensembl Zebrafish
Match: znf740a (zinc finger protein 740a [Source:ZFIN;Acc:ZDB-GENE-030131-5064])

HSP 1 Score: 68.9366 bits (167), Expect = 1.163e-13
Identity = 31/87 (35.63%), Postives = 50/87 (57.47%), Query Frame = 3
Query: 1686 KVFNCNQCKLQFNSLNALCKHTFSDH--RAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            K + C+ C ++F     L +H+ +    + + CT C   F QR +LQRHSL H G KP+ C++C   ++++ HL RH  ++H G  P
Sbjct:    5 KPYACSMCDMRFFHRYHLQRHSLTHTGVKPYACTMCDMRFFQRYHLQRHSLTHTGVKPYACSMCDMRFFQRYHLQRH-SLTHTGVKP 90          

HSP 2 Score: 65.855 bits (159), Expect = 1.748e-12
Identity = 29/84 (34.52%), Postives = 48/84 (57.14%), Query Frame = 3
Query: 1686 KVFNCNQCKLQFNSLNALCKHTFSDH--RAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPG 1931
            K + C  C ++F     L +H+ +    + + C+ C   F QR +LQRHSL H G KP+ C++C   ++++ HL RH  ++H G
Sbjct:   33 KPYACTMCDMRFFQRYHLQRHSLTHTGVKPYACSMCDMRFFQRYHLQRHSLTHTGVKPYACSMCDMRFFQRYHLERH-SLTHTG 115          

HSP 3 Score: 59.3066 bits (142), Expect = 3.005e-10
Identity = 24/63 (38.10%), Postives = 37/63 (58.73%), Query Frame = 3
Query: 1752 FSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            +S  + + C+ C   F  R +LQRHSL H G KP+ C +C   ++++ HL RH  ++H G  P
Sbjct:    1 YSGVKPYACSMCDMRFFHRYHLQRHSLTHTGVKPYACTMCDMRFFQRYHLQRH-SLTHTGVKP 62          
BLAST of Zinc finger-like protein vs. Ensembl Zebrafish
Match: gfi1b (growth factor independent 1B transcription repressor [Source:ZFIN;Acc:ZDB-GENE-091118-129])

HSP 1 Score: 68.1662 bits (165), Expect = 1.132e-11
Identity = 33/83 (39.76%), Postives = 47/83 (56.63%), Query Frame = 3
Query: 1683 SKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSH 1925
            ++ + C  C  +F+  + + KHT+  +  +  +C  C   F+Q SNL  HS KH GFKPF C +CSK + RK  L RH E  H
Sbjct:  249 TRPYPCQYCGKRFHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCEICSKGFQRKVDLRRHHESQH 331          

HSP 2 Score: 49.6766 bits (117), Expect = 9.149e-6
Identity = 26/89 (29.21%), Postives = 42/89 (47.19%), Query Frame = 3
Query: 1680 SSKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
             ++ F C+ C+  F    +L +H    S  R+F C  C   F + S L  H L H   +P+ C  C K +++K  + +H  + H G  P
Sbjct:  192 GTRPFECSICRKSFGHAVSLEQHMNVHSQERSFECKMCGKTFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTYI-HTGEKP 279          
BLAST of Zinc finger-like protein vs. Ensembl Zebrafish
Match: gfi1b (growth factor independent 1B transcription repressor [Source:ZFIN;Acc:ZDB-GENE-091118-129])

HSP 1 Score: 68.1662 bits (165), Expect = 1.132e-11
Identity = 33/83 (39.76%), Postives = 47/83 (56.63%), Query Frame = 3
Query: 1683 SKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSH 1925
            ++ + C  C  +F+  + + KHT+  +  +  +C  C   F+Q SNL  HS KH GFKPF C +CSK + RK  L RH E  H
Sbjct:  249 TRPYPCQYCGKRFHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCEICSKGFQRKVDLRRHHESQH 331          

HSP 2 Score: 49.6766 bits (117), Expect = 9.149e-6
Identity = 26/89 (29.21%), Postives = 42/89 (47.19%), Query Frame = 3
Query: 1680 SSKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
             ++ F C+ C+  F    +L +H    S  R+F C  C   F + S L  H L H   +P+ C  C K +++K  + +H  + H G  P
Sbjct:  192 GTRPFECSICRKSFGHAVSLEQHMNVHSQERSFECKMCGKTFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTYI-HTGEKP 279          
BLAST of Zinc finger-like protein vs. Ensembl Zebrafish
Match: gfi1aa (growth factor independent 1A transcription repressor a [Source:ZFIN;Acc:ZDB-GENE-050522-534])

HSP 1 Score: 68.1662 bits (165), Expect = 1.273e-11
Identity = 33/83 (39.76%), Postives = 47/83 (56.63%), Query Frame = 3
Query: 1683 SKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSH 1925
            ++ + C  C  +F+  + + KHTF  +  +  +C  C   F+Q SNL  HS KH GFKPF C++C K + RK  L RH E  H
Sbjct:  300 TRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHKETQH 382          
BLAST of Zinc finger-like protein vs. Ensembl Zebrafish
Match: gfi1aa (growth factor independent 1A transcription repressor a [Source:ZFIN;Acc:ZDB-GENE-050522-534])

HSP 1 Score: 68.1662 bits (165), Expect = 1.273e-11
Identity = 33/83 (39.76%), Postives = 47/83 (56.63%), Query Frame = 3
Query: 1683 SKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSH 1925
            ++ + C  C  +F+  + + KHTF  +  +  +C  C   F+Q SNL  HS KH GFKPF C++C K + RK  L RH E  H
Sbjct:  300 TRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHKETQH 382          
BLAST of Zinc finger-like protein vs. Ensembl Xenopus
Match: fzd1 (frizzled class receptor 1 [Source:Xenbase;Acc:XB-GENE-481861])

HSP 1 Score: 69.3218 bits (168), Expect = 1.029e-11
Identity = 41/142 (28.87%), Postives = 72/142 (50.70%), Query Frame = 3
Query: 1581 ATSTDIKPYISTQQPTTMLMKPKKTQAIAGHKK---SSKVFNCNQCKLQFNSLNALCKHTFS--DHRAFRCTFCSANFTQRSNLQRHSLKHVG---FKPFICNVCSKAYYRKDHLVRHIEV---SHPGSDPKSNITVKLSSS 1973
            A S   +PY+      T + K    Q ++ H+K     + F C QC   F   + L  H +S   H+ F C+ C  +F+++++L  H  +H G   ++P++CN+CSK + +K HL  H +V     P + P+   + + SS+
Sbjct:  178 AGSCQYRPYVCNICSKTFVKK----QHLSSHRKVHTEERPFTCPQCGRSFRQSSTLTTHLWSHAGHKPFHCSCCPKSFSRKTDLVAHMRRHTGDCQYRPYVCNICSKTFVKKQHLSSHRKVHTEERPFTCPQCGRSFRQSST 315          

HSP 2 Score: 59.3066 bits (142), Expect = 1.547e-8
Identity = 29/93 (31.18%), Postives = 49/93 (52.69%), Query Frame = 3
Query: 1650 KTQAIAGHKK---SSKVFNCNQCKLQFNSLNALCKHTFS--DHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHI 1913
            K Q ++ H+K     + F C QC   F   + L  H +S   H+ F C+ C  +F+++++L  H  +H G +P+ C  C + + RK  L RH+
Sbjct:  284 KKQHLSSHRKVHTEERPFTCPQCGRSFRQSSTLTTHLWSHAGHKPFHCSCCPKSFSRKTDLVAHMRRHTGERPYECPYCWERFIRKKSLQRHL 376          

HSP 3 Score: 53.5286 bits (127), Expect = 1.102e-6
Identity = 34/105 (32.38%), Postives = 48/105 (45.71%), Query Frame = 3
Query: 1647 KKTQAIAGHKKSS-----KVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            +KT  +A  ++ +     + + CN C   F     L  H    ++ R F C  C  +F Q S L  H   H G KPF C+ C K++ RK  LV H+   H G  P
Sbjct:  253 RKTDLVAHMRRHTGDCQYRPYVCNICSKTFVKKQHLSSHRKVHTEERPFTCPQCGRSFRQSSTLTTHLWSHAGHKPFHCSCCPKSFSRKTDLVAHMR-RHTGERP 356          
BLAST of Zinc finger-like protein vs. Ensembl Xenopus
Match: wdr37 (WD repeat domain 37 [Source:Xenbase;Acc:XB-GENE-5740160])

HSP 1 Score: 68.9366 bits (167), Expect = 1.032e-11
Identity = 33/83 (39.76%), Postives = 47/83 (56.63%), Query Frame = 3
Query: 1683 SKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSH 1925
            ++ + C  C  +F+  + + KHTF  +  +  +C  C   F+Q SNL  HS KH GFKPF C++C K + RK  L RH E  H
Sbjct:  298 TRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH 380          
BLAST of Zinc finger-like protein vs. Ensembl Xenopus
Match: IKZF3 (IKAROS family zinc finger 3 [Source:NCBI gene;Acc:100491406])

HSP 1 Score: 69.3218 bits (168), Expect = 1.337e-11
Identity = 34/74 (45.95%), Postives = 44/74 (59.46%), Query Frame = 3
Query: 1698 CNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHI 1913
            C+ C L  NSLN L  H  + +  R F+C  C A+FTQ+ NL RH   H G KPF C++CS A  R+D L  H+
Sbjct:  121 CDICGLACNSLNVLLVHKRSHTGERPFQCNQCGASFTQKGNLLRHGKLHTGEKPFKCHLCSYACQRRDALTGHL 194          
BLAST of Zinc finger-like protein vs. Ensembl Xenopus
Match: ttc8 (tetratricopeptide repeat domain 8 [Source:Xenbase;Acc:XB-GENE-1000122])

HSP 1 Score: 69.3218 bits (168), Expect = 2.068e-11
Identity = 45/122 (36.89%), Postives = 63/122 (51.64%), Query Frame = 3
Query: 1584 TSTDIKPYISTQQPTTMLMKPK-KTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            T T  KPY+ TQ       K   +T ++  +  + K+F+C +C   F     L  H  T +  + F CT C   FTQ+ NLQ+H L H   K F+CNVC K++ R +HL  H+ V H G  P
Sbjct:  476 THTGEKPYVCTQCGKGFSRKGNLETHSLIHY--TEKLFSCTECGKCFRLKQHLKSHMKTHTGVKDFVCTECGKQFTQKQNLQQHLLIHTSEKTFVCNVCGKSHSRNEHLKAHLRV-HTGEKP 594          

HSP 2 Score: 54.6842 bits (130), Expect = 5.917e-7
Identity = 30/89 (33.71%), Postives = 43/89 (48.31%), Query Frame = 3
Query: 1680 SSKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            + K F C +C   F     L  H  T +  + F CT C   F  +  L++H   H G KPF+C+ C K + RK+ L  H+ + H G  P
Sbjct:  647 TKKPFICTECGKCFRIKGNLKSHEKTHTGKKDFACTECGKRFIDKRGLRQHQWIHTGEKPFVCSECGKGHRRKEQLKAHLCI-HTGEKP 734          

HSP 3 Score: 53.5286 bits (127), Expect = 1.424e-6
Identity = 38/118 (32.20%), Postives = 53/118 (44.92%), Query Frame = 3
Query: 1584 TSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPG 1931
            T T  KPY+ TQ       K         H  + K F+C +C   F     L  H  T +  + + CT C   F+++ NL+ HSL H   K F C  C K +  K HL  H++ +H G
Sbjct:  420 THTGEKPYVCTQCGKGFSQKGNLNTHSLSHS-TEKPFSCTECGKSFKDTAHLHIHERTHTGEKPYVCTQCGKGFSRKGNLETHSLIHYTEKLFSCTECGKCFRLKQHLKSHMK-THTG 535          

HSP 4 Score: 53.1434 bits (126), Expect = 2.003e-6
Identity = 29/87 (33.33%), Postives = 44/87 (50.57%), Query Frame = 3
Query: 1686 KVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            K F CN+C   + + + L  H  T +  + + C  C  +FT +++L RHS  H G KP+ C  C K +  K  L  H + +H G  P
Sbjct:  761 KRFLCNECGKTYKTKSDLNIHHRTHTGEKPYPCAECGRSFTTKASLHRHSHTHTGIKPYACTECGKCFRNKADLKYH-QSAHTGEKP 846          

HSP 5 Score: 51.6026 bits (122), Expect = 6.276e-6
Identity = 33/97 (34.02%), Postives = 43/97 (44.33%), Query Frame = 3
Query: 1656 QAIAGHKKSSKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            Q   G     K   C +C   F   + L  H  T +  + + CT C   F+Q+ NL  HSL H   KPF C  C K++    HL  H E +H G  P
Sbjct:  387 QRHQGASAKGKPLTCTECGKSFKYKSDLRVHERTHTGEKPYVCTQCGKGFSQKGNLNTHSLSHSTEKPFSCTECGKSFKDTAHLHIH-ERTHTGEKP 482          
BLAST of Zinc finger-like protein vs. Ensembl Xenopus
Match: ttc8 (tetratricopeptide repeat domain 8 [Source:Xenbase;Acc:XB-GENE-1000122])

HSP 1 Score: 68.9366 bits (167), Expect = 2.332e-11
Identity = 45/122 (36.89%), Postives = 63/122 (51.64%), Query Frame = 3
Query: 1584 TSTDIKPYISTQQPTTMLMKPK-KTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            T T  KPY+ TQ       K   +T ++  +  + K+F+C +C   F     L  H  T +  + F CT C   FTQ+ NLQ+H L H   K F+CNVC K++ R +HL  H+ V H G  P
Sbjct:  405 THTGEKPYVCTQCGKGFSRKGNLETHSLIHY--TEKLFSCTECGKCFRLKQHLKSHMKTHTGVKDFVCTECGKQFTQKQNLQQHLLIHTSEKTFVCNVCGKSHSRNEHLKAHLRV-HTGEKP 523          

HSP 2 Score: 54.299 bits (129), Expect = 8.514e-7
Identity = 30/89 (33.71%), Postives = 43/89 (48.31%), Query Frame = 3
Query: 1680 SSKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            + K F C +C   F     L  H  T +  + F CT C   F  +  L++H   H G KPF+C+ C K + RK+ L  H+ + H G  P
Sbjct:  576 TKKPFICTECGKCFRIKGNLKSHEKTHTGKKDFACTECGKRFIDKRGLRQHQWIHTGEKPFVCSECGKGHRRKEQLKAHLCI-HTGEKP 663          

HSP 3 Score: 53.1434 bits (126), Expect = 1.949e-6
Identity = 38/118 (32.20%), Postives = 53/118 (44.92%), Query Frame = 3
Query: 1584 TSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPG 1931
            T T  KPY+ TQ       K         H  + K F+C +C   F     L  H  T +  + + CT C   F+++ NL+ HSL H   K F C  C K +  K HL  H++ +H G
Sbjct:  349 THTGEKPYVCTQCGKGFSQKGNLNTHSLSHS-TEKPFSCTECGKSFKDTAHLHIHERTHTGEKPYVCTQCGKGFSRKGNLETHSLIHYTEKLFSCTECGKCFRLKQHLKSHMK-THTG 464          

HSP 4 Score: 52.373 bits (124), Expect = 3.063e-6
Identity = 29/87 (33.33%), Postives = 44/87 (50.57%), Query Frame = 3
Query: 1686 KVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            K F CN+C   + + + L  H  T +  + + C  C  +FT +++L RHS  H G KP+ C  C K +  K  L  H + +H G  P
Sbjct:  690 KRFLCNECGKTYKTKSDLNIHHRTHTGEKPYPCAECGRSFTTKASLHRHSHTHTGIKPYACTECGKCFRNKADLKYH-QSAHTGEKP 775          

HSP 5 Score: 50.8322 bits (120), Expect = 9.528e-6
Identity = 33/97 (34.02%), Postives = 43/97 (44.33%), Query Frame = 3
Query: 1656 QAIAGHKKSSKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            Q   G     K   C +C   F   + L  H  T +  + + CT C   F+Q+ NL  HSL H   KPF C  C K++    HL  H E +H G  P
Sbjct:  316 QRHQGASAKGKPLTCTECGKSFKYKSDLRVHERTHTGEKPYVCTQCGKGFSQKGNLNTHSLSHSTEKPFSCTECGKSFKDTAHLHIH-ERTHTGEKP 411          
BLAST of Zinc finger-like protein vs. Ensembl Mouse
Match: Zfp936 (zinc finger protein 936 [Source:MGI Symbol;Acc:MGI:3642994])

HSP 1 Score: 73.559 bits (179), Expect = 4.544e-13
Identity = 38/89 (42.70%), Postives = 54/89 (60.67%), Query Frame = 3
Query: 1680 SSKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
              K + CNQC   F  LN L  H  T +  + ++C  C   FTQRS+LQRH + H G +P+ICN C+KAY ++++L +H E +H G  P
Sbjct:  172 GEKPYECNQCGKAFLHLNYLRIHERTHTGEKPYQCNQCGKAFTQRSHLQRHKVVHTGVRPYICNQCNKAYPQQNYLRKH-ERTHTGEKP 259          

HSP 2 Score: 53.1434 bits (126), Expect = 1.059e-6
Identity = 35/105 (33.33%), Postives = 50/105 (47.62%), Query Frame = 3
Query: 1641 KPKKTQAIAGHKKS---SKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            KP K   +  H+++    K + CN+C   F  L  L  H    S  + + C  C   F   + L+ H   H G KP+ CN C KA+ ++ HL RH +V H G  P
Sbjct:  128 KPYKPSYLRMHERTHTGEKPYQCNECDKAFLQLRYLRLHERRHSGEKPYECNQCGKAFLHLNYLRIHERTHTGEKPYQCNQCGKAFTQRSHLQRH-KVVHTGVRP 231          

HSP 3 Score: 52.373 bits (124), Expect = 1.943e-6
Identity = 39/124 (31.45%), Postives = 56/124 (45.16%), Query Frame = 3
Query: 1590 TDIKPYISTQ-----QPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            T ++PYI  Q          L K ++T          K + CNQC   F+  + L  H  T +  + ++C  C   F+ +SNLQ H   H G KP+ CN C KA+    +L  H E +H    P
Sbjct:  227 TGVRPYICNQCNKAYPQQNYLRKHERTHT------GEKPYICNQCNKAFSHQSNLRIHEKTHTGEKPYKCNQCDKAFSHQSNLQIHERTHTGEKPYKCNQCDKAFAHLKYLRAH-ERTHTQEKP 343          
BLAST of Zinc finger-like protein vs. Ensembl Mouse
Match: Zfp936 (zinc finger protein 936 [Source:MGI Symbol;Acc:MGI:3642994])

HSP 1 Score: 73.559 bits (179), Expect = 4.603e-13
Identity = 38/89 (42.70%), Postives = 54/89 (60.67%), Query Frame = 3
Query: 1680 SSKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
              K + CNQC   F  LN L  H  T +  + ++C  C   FTQRS+LQRH + H G +P+ICN C+KAY ++++L +H E +H G  P
Sbjct:  173 GEKPYECNQCGKAFLHLNYLRIHERTHTGEKPYQCNQCGKAFTQRSHLQRHKVVHTGVRPYICNQCNKAYPQQNYLRKH-ERTHTGEKP 260          

HSP 2 Score: 53.1434 bits (126), Expect = 1.034e-6
Identity = 35/105 (33.33%), Postives = 50/105 (47.62%), Query Frame = 3
Query: 1641 KPKKTQAIAGHKKS---SKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            KP K   +  H+++    K + CN+C   F  L  L  H    S  + + C  C   F   + L+ H   H G KP+ CN C KA+ ++ HL RH +V H G  P
Sbjct:  129 KPYKPSYLRMHERTHTGEKPYQCNECDKAFLQLRYLRLHERRHSGEKPYECNQCGKAFLHLNYLRIHERTHTGEKPYQCNQCGKAFTQRSHLQRH-KVVHTGVRP 232          

HSP 3 Score: 52.373 bits (124), Expect = 2.015e-6
Identity = 39/124 (31.45%), Postives = 56/124 (45.16%), Query Frame = 3
Query: 1590 TDIKPYISTQ-----QPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            T ++PYI  Q          L K ++T          K + CNQC   F+  + L  H  T +  + ++C  C   F+ +SNLQ H   H G KP+ CN C KA+    +L  H E +H    P
Sbjct:  228 TGVRPYICNQCNKAYPQQNYLRKHERTHT------GEKPYICNQCNKAFSHQSNLRIHEKTHTGEKPYKCNQCDKAFSHQSNLQIHERTHTGEKPYKCNQCDKAFAHLKYLRAH-ERTHTQEKP 344          
BLAST of Zinc finger-like protein vs. Ensembl Mouse
Match: Zfp746 (zinc finger protein 746 [Source:MGI Symbol;Acc:MGI:1916478])

HSP 1 Score: 71.633 bits (174), Expect = 2.910e-12
Identity = 33/86 (38.37%), Postives = 44/86 (51.16%), Query Frame = 3
Query: 1677 KSSKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHP 1928
            + S    C +C   F     L +H    +  R F CT C   FT+RS L  H   H G +PF C VC K++ RKDHL +H + +HP
Sbjct:  512 RDSSALRCGECGRCFTRPAHLIRHRMLHTGERPFPCTECEKRFTERSKLIDHYRTHTGVRPFTCTVCGKSFIRKDHLRKH-QRNHP 596          
BLAST of Zinc finger-like protein vs. Ensembl Mouse
Match: Zfp746 (zinc finger protein 746 [Source:MGI Symbol;Acc:MGI:1916478])

HSP 1 Score: 71.2478 bits (173), Expect = 2.932e-12
Identity = 33/86 (38.37%), Postives = 44/86 (51.16%), Query Frame = 3
Query: 1677 KSSKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHP 1928
            + S    C +C   F     L +H    +  R F CT C   FT+RS L  H   H G +PF C VC K++ RKDHL +H + +HP
Sbjct:  511 RDSSALRCGECGRCFTRPAHLIRHRMLHTGERPFPCTECEKRFTERSKLIDHYRTHTGVRPFTCTVCGKSFIRKDHLRKH-QRNHP 595          
BLAST of Zinc finger-like protein vs. Ensembl Mouse
Match: Gfi1 (growth factor independent 1 transcription repressor [Source:MGI Symbol;Acc:MGI:103170])

HSP 1 Score: 70.0922 bits (170), Expect = 5.151e-12
Identity = 33/83 (39.76%), Postives = 47/83 (56.63%), Query Frame = 3
Query: 1683 SKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSH 1925
            ++ + C  C  +F+  + + KHTF  +  +  +C  C   F+Q SNL  HS KH GFKPF C++C K + RK  L RH E  H
Sbjct:  404 TRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH 486          
BLAST of Zinc finger-like protein vs. UniProt/SwissProt
Match: sp|Q3B7M4|ZN746_BOVIN (Zinc finger protein 746 OS=Bos taurus OX=9913 GN=ZNF746 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.652e-12
Identity = 39/123 (31.71%), Postives = 54/123 (43.90%), Query Frame = 3
Query: 1578 CATSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            C  S  ++  +S  Q  +   +P      AG  +      C +C   F     L +H    +  R F CT C   FT+RS L  H   H G +PF C VC K++ RKDHL +H      G+ P
Sbjct:  459 CGKSFQLQVSLSAHQ-RSCGGQPDGVPGAAGSARDGSGLRCGECGRCFTRPAHLIRHRMLHTGERPFPCTECEKRFTERSKLIDHYRTHTGVRPFTCTVCGKSFIRKDHLRKHQRNHAAGAKP 580          
BLAST of Zinc finger-like protein vs. UniProt/SwissProt
Match: sp|Q3U133|ZN746_MOUSE (Zinc finger protein 746 OS=Mus musculus OX=10090 GN=Znf746 PE=1 SV=3)

HSP 1 Score: 71.633 bits (174), Expect = 2.036e-11
Identity = 33/86 (38.37%), Postives = 44/86 (51.16%), Query Frame = 3
Query: 1677 KSSKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHP 1928
            + S    C +C   F     L +H    +  R F CT C   FT+RS L  H   H G +PF C VC K++ RKDHL +H + +HP
Sbjct:  512 RDSSALRCGECGRCFTRPAHLIRHRMLHTGERPFPCTECEKRFTERSKLIDHYRTHTGVRPFTCTVCGKSFIRKDHLRKH-QRNHP 596          
BLAST of Zinc finger-like protein vs. UniProt/SwissProt
Match: sp|Q6NUN9|ZN746_HUMAN (Zinc finger protein 746 OS=Homo sapiens OX=9606 GN=ZNF746 PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 5.520e-11
Identity = 30/80 (37.50%), Postives = 39/80 (48.75%), Query Frame = 3
Query: 1677 KSSKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRH 1910
            +      C +C   F     L +H    +  R F CT C   FT+RS L  H   H G +PF C VC K++ RKDHL +H
Sbjct:  505 RDGSALRCGECGRCFTRPAHLIRHRMLHTGERPFPCTECEKRFTERSKLIDHYRTHTGVRPFTCTVCGKSFIRKDHLRKH 584          
BLAST of Zinc finger-like protein vs. UniProt/SwissProt
Match: sp|Q99684|GFI1_HUMAN (Zinc finger protein Gfi-1 OS=Homo sapiens OX=9606 GN=GFI1 PE=1 SV=2)

HSP 1 Score: 69.3218 bits (168), Expect = 5.635e-11
Identity = 33/83 (39.76%), Postives = 47/83 (56.63%), Query Frame = 3
Query: 1683 SKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSH 1925
            ++ + C  C  +F+  + + KHTF  +  +  +C  C   F+Q SNL  HS KH GFKPF C++C K + RK  L RH E  H
Sbjct:  337 TRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH 419          
BLAST of Zinc finger-like protein vs. UniProt/SwissProt
Match: sp|Q5DWN0|GFI1_CANLF (Zinc finger protein Gfi-1 OS=Canis lupus familiaris OX=9615 GN=GFI1 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 5.942e-11
Identity = 33/83 (39.76%), Postives = 47/83 (56.63%), Query Frame = 3
Query: 1683 SKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSH 1925
            ++ + C  C  +F+  + + KHTF  +  +  +C  C   F+Q SNL  HS KH GFKPF C++C K + RK  L RH E  H
Sbjct:  337 TRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH 419          
BLAST of Zinc finger-like protein vs. TrEMBL
Match: A0A3P7P208 (Uncharacterized protein (Fragment) OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS10570 PE=4 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 3.872e-52
Identity = 81/115 (70.43%), Postives = 98/115 (85.22%), Query Frame = 3
Query: 1656 QAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKSNITVKLSSSECLEYLERM 2000
            +A A  ++ +K F CNQC+  F SLNALC+HT+S H+AFRC +C A FTQRSNLQRHSL+HVGFKPF+C VCSK YYRKDHLVRHIE++HPGSDPKS+I VKLSS+ECL+YLE +
Sbjct:   19 EAWAASRRYAKSFVCNQCRFVFGSLNALCEHTYSLHKAFRCNYCQAQFTQRSNLQRHSLRHVGFKPFVCAVCSKEYYRKDHLVRHIEITHPGSDPKSSIIVKLSSAECLDYLESL 133          
BLAST of Zinc finger-like protein vs. TrEMBL
Match: A0A5J4NLS5 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0012199 PE=4 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 5.560e-49
Identity = 86/139 (61.87%), Postives = 105/139 (75.54%), Query Frame = 3
Query: 1587 STDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKSNITVKLSSSECLEYLERMQ 2003
            S   +P +   +PTT L  P ++   + +++  K F CNQC   F SLN LC HTFS HR FRCT C A FTQRSNLQRHSL+HVGFKPF+C VC KAYYRKDHLVRHIEVSHPG DP+ ++TVKL+S+ECL+YLE++Q
Sbjct:  274 SAPTQPTVGDVKPTT-LASPVESAENSLNRRFGKSFVCNQCHKDFASLNLLCAHTFSVHRGFRCTICRAQFTQRSNLQRHSLRHVGFKPFVCKVCDKAYYRKDHLVRHIEVSHPGRDPRVSLTVKLTSAECLDYLEKLQ 411          
BLAST of Zinc finger-like protein vs. TrEMBL
Match: A0A0X3NK25 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR117237 PE=4 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.065e-48
Identity = 80/115 (69.57%), Postives = 97/115 (84.35%), Query Frame = 3
Query: 1656 QAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKSNITVKLSSSECLEYLERM 2000
            +A A  ++ +K F CNQC+  F SLNALC+HT+S H+AFRC +C A FTQRSNLQRHSL+HVGFKPF+C VCSK YYRKDHLVRHIE++H GSDPKS+I VKLSS+ECL+YLE +
Sbjct:  313 EAWAASRRYAKSFVCNQCRFVFGSLNALCEHTYSLHKAFRCNYCQAQFTQRSNLQRHSLRHVGFKPFVCAVCSKEYYRKDHLVRHIEITHAGSDPKSSIIVKLSSAECLDYLESL 427          
BLAST of Zinc finger-like protein vs. TrEMBL
Match: A0A0X3P137 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR117237 PE=4 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 2.023e-48
Identity = 80/115 (69.57%), Postives = 97/115 (84.35%), Query Frame = 3
Query: 1656 QAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKSNITVKLSSSECLEYLERM 2000
            +A A  ++ +K F CNQC+  F SLNALC+HT+S H+AFRC +C A FTQRSNLQRHSL+HVGFKPF+C VCSK YYRKDHLVRHIE++H GSDPKS+I VKLSS+ECL+YLE +
Sbjct:  366 EAWAASRRYAKSFVCNQCRFVFGSLNALCEHTYSLHKAFRCNYCQAQFTQRSNLQRHSLRHVGFKPFVCAVCSKEYYRKDHLVRHIEITHAGSDPKSSIIVKLSSAECLDYLESL 480          
BLAST of Zinc finger-like protein vs. TrEMBL
Match: A0A0R3TLZ2 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS8300 PE=4 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 2.086e-48
Identity = 79/114 (69.30%), Postives = 95/114 (83.33%), Query Frame = 3
Query: 1659 AIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKSNITVKLSSSECLEYLERM 2000
            A+A  ++  K F CNQCKL F SLN+LC+HT+S H++FRC FC A FTQRSNLQRHSL+HVGFKPF+C VC K YYRKDHLVRHIEV+HPG+D K NI VKLSS+ECL+YL+ +
Sbjct:  256 ALASSRRYGKSFICNQCKLAFLSLNSLCEHTYSQHKSFRCNFCGAQFTQRSNLQRHSLRHVGFKPFVCGVCQKEYYRKDHLVRHIEVTHPGTDAKKNIIVKLSSAECLDYLDAI 369          
BLAST of Zinc finger-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000039062.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000145.1:518085:531993:-1 gene:ENSAMXG00000032552.1 transcript:ENSAMXT00000039062.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.633 bits (174), Expect = 1.033e-12
Identity = 30/83 (36.14%), Postives = 48/83 (57.83%), Query Frame = 3
Query: 1692 FNCNQCKLQFNSLNALCKHTFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            + C+ C+  F+ L  L  H  +  RAF C +C  +F Q ++L+RH   H G +PF C  CSK++ ++ +L RH+ + H G  P
Sbjct:  247 YRCSHCRKTFSDLKRLQTHQQAHERAFGCNWCGKSFYQSADLRRHLRTHTGERPFRCTWCSKSFSQRSNLRRHVRI-HTGERP 328          

HSP 2 Score: 67.0106 bits (162), Expect = 2.793e-11
Identity = 28/68 (41.18%), Postives = 42/68 (61.76%), Query Frame = 3
Query: 1686 KVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAY 1883
            + F CN C   F     L +H  T +  R FRCT+CS +F+QRSNL+RH   H G +P+ C +C++++
Sbjct:  271 RAFGCNWCGKSFYQSADLRRHLRTHTGERPFRCTWCSKSFSQRSNLRRHVRIHTGERPYQCTLCTRSF 338          
BLAST of Zinc finger-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000039663.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000145.1:523206:531993:-1 gene:ENSAMXG00000032552.1 transcript:ENSAMXT00000039663.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 4.191e-12
Identity = 29/79 (36.71%), Postives = 41/79 (51.90%), Query Frame = 3
Query: 1692 FNCNQCKLQFNSLNALCKHTFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHP 1928
            + C  C   F+ L  L  H  +  +AF CT+C   F   S+LQRH   H G +PF C  CSK +++ + L RH+    P
Sbjct:  193 YKCPHCINTFSDLKTLQIHQQAHEQAFGCTWCKKGFYNSSDLQRHMRTHTGERPFGCTWCSKGFFKTEELRRHLRTPFP 271          
BLAST of Zinc finger-like protein vs. Ensembl Cavefish
Match: gfi1ab (zinc finger protein Gfi-1-like [Source:NCBI gene;Acc:103028167])

HSP 1 Score: 68.9366 bits (167), Expect = 7.490e-12
Identity = 33/83 (39.76%), Postives = 46/83 (55.42%), Query Frame = 3
Query: 1683 SKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSH 1925
            ++ + C  C  +F+  + + KHTF  +  +  +C  C   F+Q SNL  HS KH GFKPF C +C K + RK  L RH E  H
Sbjct:  294 TRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACELCGKGFQRKVDLRRHKETQH 376          
BLAST of Zinc finger-like protein vs. Ensembl Cavefish
Match: GFI1B (growth factor independent 1B transcriptional repressor [Source:NCBI gene;Acc:103023716])

HSP 1 Score: 68.1662 bits (165), Expect = 8.925e-12
Identity = 33/83 (39.76%), Postives = 47/83 (56.63%), Query Frame = 3
Query: 1683 SKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSH 1925
            ++ + C  C  +F+  + + KHT+  +  +  +C  C   F+Q SNL  HS KH GFKPF C +CSK + RK  L RH E  H
Sbjct:  249 TRPYPCQYCGKRFHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCEICSKGFQRKVDLRRHHESQH 331          

HSP 2 Score: 50.0618 bits (118), Expect = 5.846e-6
Identity = 26/89 (29.21%), Postives = 42/89 (47.19%), Query Frame = 3
Query: 1680 SSKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
             ++ F C+ C+  F    +L +H    S  R+F C  C   F + S L  H L H   +P+ C  C K +++K  + +H  + H G  P
Sbjct:  192 GTRPFGCSICRKTFGHAVSLEQHMNVHSQERSFECKMCGKTFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTYI-HTGEKP 279          
BLAST of Zinc finger-like protein vs. Ensembl Cavefish
Match: GFI1 (growth factor independent 1 transcriptional repressor [Source:HGNC Symbol;Acc:HGNC:4237])

HSP 1 Score: 67.3958 bits (163), Expect = 1.312e-11
Identity = 34/83 (40.96%), Postives = 48/83 (57.83%), Query Frame = 3
Query: 1683 SKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSH 1925
            ++ F C  C  +F+  + + KHTF  +  +  +C  C   F+Q SNL  HS KH GFKPF C++C+K + RK  L RH E  H
Sbjct:  227 TRPFACPYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCAKGFQRKVDLRRHREAQH 309          
BLAST of Zinc finger-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005004.1 (pep scaffold:Pmarinus_7.0:GL484587:30140:35096:1 gene:ENSPMAG00000004537.1 transcript:ENSPMAT00000005004.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 2.620e-11
Identity = 29/86 (33.72%), Postives = 43/86 (50.00%), Query Frame = 3
Query: 1680 SSKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPG 1931
              K + C+QC ++F     L +H    S  + F C  C   F Q+ +L+RH   H G KP+ C+ C + Y R D L +H  + H G
Sbjct:   30 GEKAYQCSQCTMRFIQKYLLQRHEKIHSGEKPFTCEQCGMRFIQKYHLERHKRTHSGEKPYECDYCHQYYSRTDQLAKHKRMCHEG 115          
BLAST of Zinc finger-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007831.1 (pep scaffold:Pmarinus_7.0:GL477655:47469:47963:1 gene:ENSPMAG00000007084.1 transcript:ENSPMAT00000007831.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 1.205e-10
Identity = 31/85 (36.47%), Postives = 44/85 (51.76%), Query Frame = 3
Query: 1686 KVFNCNQCKLQFNSLNALCKHTFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            K F C  C+  F   + L  H  +  + FRC  C   F + S+LQ H   H G KPF C+VC KA+ +  +L +H + +H G  P
Sbjct:    4 KPFKCTVCEKAFAQSSYLTIHLRTHTKPFRCPLCGKAFAKSSDLQSHQRTHTGEKPFKCSVCEKAFSQSSNLKKH-QRTHTGEKP 87          

HSP 2 Score: 52.7582 bits (125), Expect = 8.527e-9
Identity = 29/78 (37.18%), Postives = 40/78 (51.28%), Query Frame = 3
Query: 1683 SKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRH 1910
            +K F C  C   F   + L  H  T +  + F+C+ C   F+Q SNL++H   H G KPF C VC KA+     L +H
Sbjct:   29 TKPFRCPLCGKAFAKSSDLQSHQRTHTGEKPFKCSVCEKAFSQSSNLKKHQRTHTGEKPFKCTVCEKAFTESSPLRKH 106          
BLAST of Zinc finger-like protein vs. Ensembl Sea Lamprey
Match: ikzf4 (IKAROS family zinc finger 4 [Source:ZFIN;Acc:ZDB-GENE-180319-1])

HSP 1 Score: 60.8474 bits (146), Expect = 9.292e-10
Identity = 34/94 (36.17%), Postives = 51/94 (54.26%), Query Frame = 3
Query: 1644 PKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEV 1919
            P +T+  +    SSK+  C+ C +     N L  H  + +  R F+C+ C A+FTQ+ NL RH   H   KPF C++CS A  R+D L+ H+  
Sbjct:  118 PGETRRFSSGNGSSKL-ACDVCGMVCIGPNVLMVHKRSHTGERPFQCSQCGASFTQKGNLLRHIKLHTDEKPFKCHLCSYACRRRDALMGHLRT 210          
BLAST of Zinc finger-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008916.1 (pep scaffold:Pmarinus_7.0:GL476670:39536:47416:-1 gene:ENSPMAG00000008063.1 transcript:ENSPMAT00000008916.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 1.101e-9
Identity = 33/88 (37.50%), Postives = 44/88 (50.00%), Query Frame = 3
Query: 1665 AGHKKSSKVFNCNQCKLQFNSLNALCKHT--FSDHRAFRCTF--CSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIE 1916
            AG KK   + +   C   +   + L  H    S  R F CT+  C   FT+   LQRH   H G K FIC+ CSK + R DHL +H++
Sbjct:  580 AGQKKQ-HICHITGCSKVYGKTSHLRAHLRWHSGERPFVCTWLHCGKRFTRSDELQRHKRTHTGEKKFICSECSKRFMRSDHLSKHMK 666          
BLAST of Zinc finger-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003937.1 (pep scaffold:Pmarinus_7.0:GL485487:1616:4240:1 gene:ENSPMAG00000003606.1 transcript:ENSPMAT00000003937.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 1.114e-9
Identity = 31/86 (36.05%), Postives = 44/86 (51.16%), Query Frame = 3
Query: 1689 VFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            ++ CN C   F  L+ L  H    S  R F+C  C   FTQ ++LQ+H L H G KP+ C VC + +    +L  H+ + H G  P
Sbjct:   14 IYECNICGKTFGQLSNLKVHLRIHSGERPFKCQTCGKGFTQLAHLQKHHLVHTGEKPYQCQVCCRRFSSTSNLKTHLRL-HSGEKP 98          
BLAST of Zinc finger-like protein vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 62.3882 bits (150), Expect = 2.415e-10
Identity = 35/109 (32.11%), Postives = 53/109 (48.62%), Query Frame = 3
Query: 1629 TMLMKPKKTQAIAGHKK--------SSKVFNCNQCKLQFNSLNALCKHTFS--DHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSH 1925
            TM + P K++ + G +K        + K   C  C   F+    L  H  S   ++ F C +C   FTQ  NL+ H   H G KP+ C++C K + RK +L  H+ V+H
Sbjct:  564 TMDILPPKSELVGGVEKPKGTQNTRAVKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL-VTH 671          
BLAST of Zinc finger-like protein vs. Ensembl Yeast
Match: ADR1 (Carbon source-responsive zinc-finger transcription factor; required for transcription of the glucose-repressed gene ADH2, of peroxisomal protein genes, and of genes required for ethanol, glycerol, and fatty acid utilization [Source:SGD;Acc:S000002624])

HSP 1 Score: 53.9138 bits (128), Expect = 1.048e-7
Identity = 20/56 (35.71%), Postives = 34/56 (60.71%), Query Frame = 3
Query: 1764 RAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPG 1931
            R+F C  C+  F ++ +L+RH   H   KP+ C +C++ + R+D L+RH +  H G
Sbjct:  102 RSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSG 157          
BLAST of Zinc finger-like protein vs. Ensembl Yeast
Match: PZF1 (Transcription factor IIIA (TFIIIA); essential DNA binding protein required for transcription of 5S rRNA by RNA polymerase III; not involved in transcription of other RNAP III genes; nine conserved zinc fingers; may also bind 5S rRNA [Source:SGD;Acc:S000006390])

HSP 1 Score: 53.1434 bits (126), Expect = 1.185e-7
Identity = 32/88 (36.36%), Postives = 46/88 (52.27%), Query Frame = 3
Query: 1686 KVFNCNQ--CKLQFNSLNALCKHTFSDH---RAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGS 1934
            K + C+   C   F   + L +H  S H   RAF+C  C+ +F ++S+L+RH   H   KPF C+ C K    +  L RH EV+H  S
Sbjct:   47 KTYFCDYDGCDKAFTRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHLYTHSDTKPFQCSYCGKGVTTRQQLKRH-EVTHTKS 133          
BLAST of Zinc finger-like protein vs. Ensembl Yeast
Match: MET32 (Zinc-finger DNA-binding transcription factor; involved in transcriptional regulation of the methionine biosynthetic genes; targets strong transcriptional activator Met4p to promoters of sulfur metabolic genes; feedforward loop exists in the regulation of genes controlled by Met4p and Met32p; lack of such a loop for MET31 may account for the differential actions of Met32p and Met31p; MET32 has a paralog, MET31, that arose from the whole genome duplication [Source:SGD;Acc:S000002661])

HSP 1 Score: 50.0618 bits (118), Expect = 2.519e-7
Identity = 21/55 (38.18%), Postives = 30/55 (54.55%), Query Frame = 3
Query: 1755 SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEV 1919
            +  + F+C  CS  F++ S+L+RH   H    P IC  C K + RKD L RH + 
Sbjct:   93 TGEKRFKCAKCSLEFSRSSDLRRHEKTHFAILPNICPQCGKGFARKDALKRHYDT 147          
BLAST of Zinc finger-like protein vs. Ensembl Yeast
Match: YGR067C_mRNA (Putative protein of unknown function; contains a zinc finger motif similar to that of Adr1p [Source:SGD;Acc:S000003299])

HSP 1 Score: 51.9878 bits (123), Expect = 3.641e-7
Identity = 21/57 (36.84%), Postives = 31/57 (54.39%), Query Frame = 3
Query: 1755 SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSH 1925
            +  + + C+FC   F++  +  RH   H G KPF C VC  ++ R+D L RHI   H
Sbjct:    3 AGQKKYICSFCLKPFSRSEHKIRHERSHAGVKPFQCQVCKHSFVRRDLLQRHIRTVH 59          
BLAST of Zinc finger-like protein vs. Ensembl Nematostella
Match: EDO38869 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBM8])

HSP 1 Score: 65.4698 bits (158), Expect = 3.387e-12
Identity = 36/82 (43.90%), Postives = 48/82 (58.54%), Query Frame = 3
Query: 1692 FNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPG 1931
            F+C  C  +F+  + + KHT   +  +   C +C   F+Q SNL  HS KH+GFKPF C VC +A+YRK  L RH  V H G
Sbjct:  110 FSCEFCGKRFHQKSDMKKHTLVHTGEKPHECRYCGKCFSQSSNLITHSRKHLGFKPFACLVCGRAFYRKVDLRRHSHV-HTG 190          
BLAST of Zinc finger-like protein vs. Ensembl Nematostella
Match: EDO34637 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNP5])

HSP 1 Score: 61.6178 bits (148), Expect = 1.489e-11
Identity = 29/87 (33.33%), Postives = 50/87 (57.47%), Query Frame = 3
Query: 1686 KVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            +VF C +C  +F   ++L  H    SDH+ + CT+C   F ++S++++H+L H G KPF C  C K + +  +++ H+   H G  P
Sbjct:   10 RVFRCLECGKEFRRPSSLSTHKLIHSDHKPYACTYCDKKFLRKSDMKKHTLMHTGAKPFQCKQCGKVFSQSSNMLTHMR-RHTGIKP 95          
BLAST of Zinc finger-like protein vs. Ensembl Nematostella
Match: EDO28606 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNP5])

HSP 1 Score: 61.6178 bits (148), Expect = 1.489e-11
Identity = 29/87 (33.33%), Postives = 50/87 (57.47%), Query Frame = 3
Query: 1686 KVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            +VF C +C  +F   ++L  H    SDH+ + CT+C   F ++S++++H+L H G KPF C  C K + +  +++ H+   H G  P
Sbjct:   10 RVFRCLECGKEFRRPSSLSTHKLIHSDHKPYACTYCDKKFLRKSDMKKHTLMHTGAKPFQCKQCGKVFSQSSNMLTHMR-RHTGIKP 95          
BLAST of Zinc finger-like protein vs. Ensembl Nematostella
Match: EDO44302 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWE6])

HSP 1 Score: 62.003 bits (149), Expect = 3.082e-11
Identity = 32/76 (42.11%), Postives = 45/76 (59.21%), Query Frame = 3
Query: 1692 FNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHI 1913
            F C  C  +F+  + + KHT+  +  +  +C  C   F+Q SNL  HS KH GFKPF C VC +++YRK  L RH+
Sbjct:   83 FPCQYCPKRFHQKSDMKKHTYIHTGEKPHKCLECGKAFSQSSNLITHSRKHSGFKPFSCQVCRRSFYRKVDLRRHM 158          
BLAST of Zinc finger-like protein vs. Ensembl Nematostella
Match: EDO36354 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIW9])

HSP 1 Score: 64.6994 bits (156), Expect = 4.431e-11
Identity = 36/112 (32.14%), Postives = 50/112 (44.64%), Query Frame = 3
Query: 1599 KPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHP 1928
            KP+  TQ P + +      + +  H    K + C  C   F     L  H +  +  R +RC +C   FTQ   LQ H   H G KPF C +C KA+    HL  H++  HP
Sbjct:  226 KPFKCTQCPASFIRYGHLQRHLLIHS-DDKPYKCKLCPKSFTQYRNLQTHMYKHTGERPYRCKYCPKGFTQYGTLQAHERTHTGEKPFKCTLCDKAFITSSHLRWHVKTQHP 336          

HSP 2 Score: 58.5362 bits (140), Expect = 4.149e-9
Identity = 33/90 (36.67%), Postives = 43/90 (47.78%), Query Frame = 3
Query: 1677 KSSKVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            K  K F C QC   F     L +H    SD + ++C  C  +FTQ  NLQ H  KH G +P+ C  C K + +   L  H E +H G  P
Sbjct:  223 KGEKPFKCTQCPASFIRYGHLQRHLLIHSDDKPYKCKLCPKSFTQYRNLQTHMYKHTGERPYRCKYCPKGFTQYGTLQAH-ERTHTGEKP 311          

HSP 3 Score: 51.2174 bits (121), Expect = 9.292e-7
Identity = 29/90 (32.22%), Postives = 42/90 (46.67%), Query Frame = 3
Query: 1677 KSSKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            K  + + C  C   F  L+ L  H    +  R + C  CS  FT    L+ H   H G KP+ C VC +A+ R+D +  H+ + H G  P
Sbjct:  139 KEGEKYRCRLCSKDFTRLSGLKTHIRMHTGERPYVCEVCSFAFTTSRALKMHMRLHTGEKPYKCEVCDRAFTRRDEMHTHMYI-HKGEKP 227          
BLAST of Zinc finger-like protein vs. Ensembl Medaka
Match: ENSORLT00000046979.1 (gastrula zinc finger protein XlCGF57.1 [Source:NCBI gene;Acc:101163567])

HSP 1 Score: 73.9442 bits (180), Expect = 2.709e-13
Identity = 41/136 (30.15%), Postives = 63/136 (46.32%), Query Frame = 3
Query: 1545 RFFNSNLPIWPCATSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDH--RAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKS 1946
            RFF          T T +KPY  +        +    +    H    K + C+ C ++F     L +HT +    + + CT C   F QR  L+RHSL H G KP+ C +C K ++++ HL RH  ++H G  P +
Sbjct:  262 RFFQRYHLARHSLTHTGVKPYACSMCDMRFFQRYHLARHTLTHT-GVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACTMCDMRFIQRYQLERHSLTHTGVKPYACTMCDKRFFQRYHLARH-SLTHMGVKPYA 395          

HSP 2 Score: 70.4774 bits (171), Expect = 3.195e-12
Identity = 41/134 (30.60%), Postives = 62/134 (46.27%), Query Frame = 3
Query: 1545 RFFNSNLPIWPCATSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            RFF          T T +KPY  +        +    +    H    K + C  C ++F     L +H  T +  + + CT C   F QR +L RHSL H+G KP+ C +C K ++++ HL RH  ++H G  P
Sbjct:  290 RFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHTLTHT-GVKPYACTMCDMRFIQRYQLERHSLTHTGVKPYACTMCDKRFFQRYHLARHSLTHMGVKPYACTMCDKRFFQRYHLARH-SLTHMGVKP 421          

HSP 3 Score: 70.0922 bits (170), Expect = 4.042e-12
Identity = 42/136 (30.88%), Postives = 63/136 (46.32%), Query Frame = 3
Query: 1545 RFFNSNLPIWPCATSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDH--RAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKS 1946
            RFF          T T +KPY  T      + + +  +    H    K + C  C  +F     L +H+ +    + + CT C   F QR +L RHSL H+G KPF C +C   + ++ HLVRH  ++H G  P +
Sbjct:  318 RFFQRYHLARHTLTHTGVKPYACTMCDMRFIQRYQLERHSLTHT-GVKPYACTMCDKRFFQRYHLARHSLTHMGVKPYACTMCDKRFFQRYHLARHSLTHMGVKPFACTMCDMRFVQRYHLVRH-SLTHTGVKPYA 451          

HSP 4 Score: 66.6254 bits (161), Expect = 5.260e-11
Identity = 36/121 (29.75%), Postives = 59/121 (48.76%), Query Frame = 3
Query: 1590 TDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDH--RAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKS 1946
            T +KPY  T        +    +    H    K + C+ C ++F     L +HT +    + + C+ C   F QR +L RHSL H G KP+ C++C   ++++ HL RH  ++H G  P +
Sbjct:  193 TGVKPYACTMCDMRFFQRYHLERHKLTHT-GVKPYACSLCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHSLTHTGVKPYACSMCDMRFFQRYHLARHT-LTHTGVKPYA 311          

HSP 5 Score: 65.855 bits (159), Expect = 1.091e-10
Identity = 41/133 (30.83%), Postives = 62/133 (46.62%), Query Frame = 3
Query: 1584 TSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDH--RAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSH------PGSDPKSNITV 1958
            T T +KPY  T        +    +    H    K + C  C  +F     L +H+ +    + F CT C   F QR +L RHSL H G KP+ C++C   + +++HL RH  ++H      PG+ P  + TV
Sbjct:  359 THTGVKPYACTMCDKRFFQRYHLARHSLTHM-GVKPYACTMCDKRFFQRYHLARHSLTHMGVKPFACTMCDMRFVQRYHLVRHSLTHTGVKPYACSMCDMRFIQRNHLERH-SLTHTGMRSSPGALPARSGTV 489          

HSP 6 Score: 61.6178 bits (148), Expect = 1.829e-9
Identity = 29/89 (32.58%), Postives = 49/89 (55.06%), Query Frame = 3
Query: 1686 KVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKS 1946
            K + C  C ++F     L +H+   +  + + CT C   F QR +L+RH L H G KP+ C++C   ++++ HL RH  ++H G  P +
Sbjct:  168 KPYACAVCDMRFIQRYHLERHSLIHTGVKPYACTMCDMRFFQRYHLERHKLTHTGVKPYACSLCDMRFFQRYHLARHT-LTHTGVKPYA 255          
BLAST of Zinc finger-like protein vs. Ensembl Medaka
Match: ENSORLT00000038558.1 (gastrula zinc finger protein XlCGF57.1 [Source:NCBI gene;Acc:101163567])

HSP 1 Score: 73.9442 bits (180), Expect = 2.982e-13
Identity = 41/136 (30.15%), Postives = 63/136 (46.32%), Query Frame = 3
Query: 1545 RFFNSNLPIWPCATSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDH--RAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKS 1946
            RFF          T T +KPY  +        +    +    H    K + C+ C ++F     L +HT +    + + CT C   F QR  L+RHSL H G KP+ C +C K ++++ HL RH  ++H G  P +
Sbjct:  262 RFFQRYHLARHSLTHTGVKPYACSMCDMRFFQRYHLARHTLTHT-GVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACTMCDMRFIQRYQLERHSLTHTGVKPYACTMCDKRFFQRYHLARH-SLTHMGVKPYA 395          

HSP 2 Score: 70.4774 bits (171), Expect = 3.251e-12
Identity = 41/136 (30.15%), Postives = 63/136 (46.32%), Query Frame = 3
Query: 1545 RFFNSNLPIWPCATSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDH--RAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKS 1946
            RFF          T T +KPY  T      + + +  +    H    K + C  C  +F     L +H+ +    + + CT C   F QR +L RHSL H G KP+ C +C K ++++ HL RH  ++H G  P +
Sbjct:  318 RFFQRYHLARHTLTHTGVKPYACTMCDMRFIQRYQLERHSLTHT-GVKPYACTMCDKRFFQRYHLARHSLTHMGVKPYACTMCDMKFFQRYHLARHSLTHTGVKPYACTMCDKRFFQRYHLARH-SLTHMGVKPYA 451          

HSP 3 Score: 67.0106 bits (162), Expect = 4.781e-11
Identity = 41/133 (30.83%), Postives = 64/133 (48.12%), Query Frame = 3
Query: 1584 TSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSH------PGSDPKSNITV 1958
            T T +KPY  T        +    +    H    K + C  C ++F     L +H  T +  + + CT C   F QR +L RHSL H+G KP+ C++C   + +++HL RH  ++H      PG+ P  + TV
Sbjct:  359 THTGVKPYACTMCDKRFFQRYHLARHSLTHM-GVKPYACTMCDMKFFQRYHLARHSLTHTGVKPYACTMCDKRFFQRYHLARHSLTHMGVKPYACSMCDMRFIQRNHLERH-SLTHTGMRSSPGALPARSGTV 489          

HSP 4 Score: 66.6254 bits (161), Expect = 5.399e-11
Identity = 36/121 (29.75%), Postives = 59/121 (48.76%), Query Frame = 3
Query: 1590 TDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDH--RAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKS 1946
            T +KPY  T        +    +    H    K + C+ C ++F     L +HT +    + + C+ C   F QR +L RHSL H G KP+ C++C   ++++ HL RH  ++H G  P +
Sbjct:  193 TGVKPYACTMCDMRFFQRYHLERHKLTHT-GVKPYACSLCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHSLTHTGVKPYACSMCDMRFFQRYHLARHT-LTHTGVKPYA 311          

HSP 5 Score: 62.003 bits (149), Expect = 1.782e-9
Identity = 29/89 (32.58%), Postives = 49/89 (55.06%), Query Frame = 3
Query: 1686 KVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKS 1946
            K + C  C ++F     L +H+   +  + + CT C   F QR +L+RH L H G KP+ C++C   ++++ HL RH  ++H G  P +
Sbjct:  168 KPYACAVCDMRFIQRYHLERHSLIHTGVKPYACTMCDMRFFQRYHLERHKLTHTGVKPYACSLCDMRFFQRYHLARHT-LTHTGVKPYA 255          
BLAST of Zinc finger-like protein vs. Ensembl Medaka
Match: ENSORLT00000033968.1 (gastrula zinc finger protein XlCGF57.1 [Source:NCBI gene;Acc:101163567])

HSP 1 Score: 73.9442 bits (180), Expect = 3.356e-13
Identity = 41/136 (30.15%), Postives = 63/136 (46.32%), Query Frame = 3
Query: 1545 RFFNSNLPIWPCATSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDH--RAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKS 1946
            RFF          T T +KPY  +        +    +    H    K + C+ C ++F     L +HT +    + + CT C   F QR  L+RHSL H G KP+ C +C K ++++ HL RH  ++H G  P +
Sbjct:  262 RFFQRYHLARHSLTHTGVKPYACSMCDMRFFQRYHLARHTLTHT-GVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACTMCDMRFIQRYQLERHSLTHTGVKPYACTMCDKRFFQRYHLARH-SLTHMGVKPYA 395          

HSP 2 Score: 70.4774 bits (171), Expect = 3.791e-12
Identity = 40/123 (32.52%), Postives = 59/123 (47.97%), Query Frame = 3
Query: 1584 TSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKS 1946
            T T +KPY  T        +    +    H    K + C  C ++F     L +H  T +  + + CT C   F QR +L RHSL H+G KPF C +C   + ++ HLVRH  ++H G  P +
Sbjct:  359 THTGVKPYACTMCDKRFFQRYHLARHSLTHM-GVKPYACTMCDMKFFQRYHLARHSLTHTGVKPYACTMCDKRFFQRYHLARHSLTHMGVKPFACTMCDMRFVQRYHLVRH-SLTHTGVKPYA 479          

HSP 3 Score: 70.4774 bits (171), Expect = 4.171e-12
Identity = 41/134 (30.60%), Postives = 62/134 (46.27%), Query Frame = 3
Query: 1545 RFFNSNLPIWPCATSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDH--RAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            RFF          T T +KPY  T      + + +  +    H    K + C  C  +F     L +H+ +    + + CT C   F QR +L RHSL H G KP+ C +C K ++++ HL RH  ++H G  P
Sbjct:  318 RFFQRYHLARHTLTHTGVKPYACTMCDMRFIQRYQLERHSLTHT-GVKPYACTMCDKRFFQRYHLARHSLTHMGVKPYACTMCDMKFFQRYHLARHSLTHTGVKPYACTMCDKRFFQRYHLARH-SLTHMGVKP 449          

HSP 4 Score: 66.6254 bits (161), Expect = 5.924e-11
Identity = 36/121 (29.75%), Postives = 59/121 (48.76%), Query Frame = 3
Query: 1590 TDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDH--RAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKS 1946
            T +KPY  T        +    +    H    K + C+ C ++F     L +HT +    + + C+ C   F QR +L RHSL H G KP+ C++C   ++++ HL RH  ++H G  P +
Sbjct:  193 TGVKPYACTMCDMRFFQRYHLERHKLTHT-GVKPYACSLCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHSLTHTGVKPYACSMCDMRFFQRYHLARHT-LTHTGVKPYA 311          

HSP 5 Score: 65.0846 bits (157), Expect = 1.704e-10
Identity = 46/150 (30.67%), Postives = 69/150 (46.00%), Query Frame = 3
Query: 1542 ERFFNSNLPIWPCATSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSS---KVFNCNQCKLQFNSLNALCKHTFSDH--RAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSH------PGSDPKSNITV 1958
            +RFF          T   +KPY  T       MK  +   +A H  +    K + C  C  +F     L +H+ +    + F CT C   F QR +L RHSL H G KP+ C++C   + +++HL RH  ++H      PG+ P  + TV
Sbjct:  373 KRFFQRYHLARHSLTHMGVKPYACTMCD----MKFFQRYHLARHSLTHTGVKPYACTMCDKRFFQRYHLARHSLTHMGVKPFACTMCDMRFVQRYHLVRHSLTHTGVKPYACSMCDMRFIQRNHLERH-SLTHTGMRSSPGALPARSGTV 517          

HSP 6 Score: 61.6178 bits (148), Expect = 2.167e-9
Identity = 29/89 (32.58%), Postives = 49/89 (55.06%), Query Frame = 3
Query: 1686 KVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKS 1946
            K + C  C ++F     L +H+   +  + + CT C   F QR +L+RH L H G KP+ C++C   ++++ HL RH  ++H G  P +
Sbjct:  168 KPYACAVCDMRFIQRYHLERHSLIHTGVKPYACTMCDMRFFQRYHLERHKLTHTGVKPYACSLCDMRFFQRYHLARHT-LTHTGVKPYA 255          
BLAST of Zinc finger-like protein vs. Ensembl Medaka
Match: ENSORLT00000047040.1 (gastrula zinc finger protein XlCGF57.1 [Source:NCBI gene;Acc:101163567])

HSP 1 Score: 73.9442 bits (180), Expect = 3.356e-13
Identity = 41/136 (30.15%), Postives = 63/136 (46.32%), Query Frame = 3
Query: 1545 RFFNSNLPIWPCATSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDH--RAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKS 1946
            RFF          T T +KPY  +        +    +    H    K + C+ C ++F     L +HT +    + + CT C   F QR  L+RHSL H G KP+ C +C K ++++ HL RH  ++H G  P +
Sbjct:  262 RFFQRYHLARHSLTHTGVKPYACSMCDMRFFQRYHLARHTLTHT-GVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACTMCDMRFIQRYQLERHSLTHTGVKPYACTMCDKRFFQRYHLARH-SLTHMGVKPYA 395          

HSP 2 Score: 70.4774 bits (171), Expect = 3.791e-12
Identity = 40/123 (32.52%), Postives = 59/123 (47.97%), Query Frame = 3
Query: 1584 TSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKS 1946
            T T +KPY  T        +    +    H    K + C  C ++F     L +H  T +  + + CT C   F QR +L RHSL H+G KPF C +C   + ++ HLVRH  ++H G  P +
Sbjct:  359 THTGVKPYACTMCDKRFFQRYHLARHSLTHM-GVKPYACTMCDMKFFQRYHLARHSLTHTGVKPYACTMCDKRFFQRYHLARHSLTHMGVKPFACTMCDMRFVQRYHLVRH-SLTHTGVKPYA 479          

HSP 3 Score: 70.4774 bits (171), Expect = 4.171e-12
Identity = 41/134 (30.60%), Postives = 62/134 (46.27%), Query Frame = 3
Query: 1545 RFFNSNLPIWPCATSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDH--RAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            RFF          T T +KPY  T      + + +  +    H    K + C  C  +F     L +H+ +    + + CT C   F QR +L RHSL H G KP+ C +C K ++++ HL RH  ++H G  P
Sbjct:  318 RFFQRYHLARHTLTHTGVKPYACTMCDMRFIQRYQLERHSLTHT-GVKPYACTMCDKRFFQRYHLARHSLTHMGVKPYACTMCDMKFFQRYHLARHSLTHTGVKPYACTMCDKRFFQRYHLARH-SLTHMGVKP 449          

HSP 4 Score: 66.6254 bits (161), Expect = 5.924e-11
Identity = 36/121 (29.75%), Postives = 59/121 (48.76%), Query Frame = 3
Query: 1590 TDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDH--RAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKS 1946
            T +KPY  T        +    +    H    K + C+ C ++F     L +HT +    + + C+ C   F QR +L RHSL H G KP+ C++C   ++++ HL RH  ++H G  P +
Sbjct:  193 TGVKPYACTMCDMRFFQRYHLERHKLTHT-GVKPYACSLCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHSLTHTGVKPYACSMCDMRFFQRYHLARHT-LTHTGVKPYA 311          

HSP 5 Score: 65.0846 bits (157), Expect = 1.704e-10
Identity = 46/150 (30.67%), Postives = 69/150 (46.00%), Query Frame = 3
Query: 1542 ERFFNSNLPIWPCATSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSS---KVFNCNQCKLQFNSLNALCKHTFSDH--RAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSH------PGSDPKSNITV 1958
            +RFF          T   +KPY  T       MK  +   +A H  +    K + C  C  +F     L +H+ +    + F CT C   F QR +L RHSL H G KP+ C++C   + +++HL RH  ++H      PG+ P  + TV
Sbjct:  373 KRFFQRYHLARHSLTHMGVKPYACTMCD----MKFFQRYHLARHSLTHTGVKPYACTMCDKRFFQRYHLARHSLTHMGVKPFACTMCDMRFVQRYHLVRHSLTHTGVKPYACSMCDMRFIQRNHLERH-SLTHTGMRSSPGALPARSGTV 517          

HSP 6 Score: 61.6178 bits (148), Expect = 2.167e-9
Identity = 29/89 (32.58%), Postives = 49/89 (55.06%), Query Frame = 3
Query: 1686 KVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKS 1946
            K + C  C ++F     L +H+   +  + + CT C   F QR +L+RH L H G KP+ C++C   ++++ HL RH  ++H G  P +
Sbjct:  168 KPYACAVCDMRFIQRYHLERHSLIHTGVKPYACTMCDMRFFQRYHLERHKLTHTGVKPYACSLCDMRFFQRYHLARHT-LTHTGVKPYA 255          
BLAST of Zinc finger-like protein vs. Ensembl Medaka
Match: ENSORLT00000027777.1 (gastrula zinc finger protein XlCGF57.1 [Source:NCBI gene;Acc:101163567])

HSP 1 Score: 73.559 bits (179), Expect = 3.661e-13
Identity = 41/136 (30.15%), Postives = 63/136 (46.32%), Query Frame = 3
Query: 1545 RFFNSNLPIWPCATSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDH--RAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKS 1946
            RFF          T T +KPY  +        +    +    H    K + C+ C ++F     L +HT +    + + CT C   F QR  L+RHSL H G KP+ C +C K ++++ HL RH  ++H G  P +
Sbjct:  262 RFFQRYHLARHSLTHTGVKPYACSMCDMRFFQRYHLARHTLTHT-GVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACTMCDMRFIQRYQLERHSLTHTGVKPYACTMCDKRFFQRYHLARH-SLTHMGVKPYA 395          

HSP 2 Score: 70.0922 bits (170), Expect = 4.471e-12
Identity = 41/134 (30.60%), Postives = 62/134 (46.27%), Query Frame = 3
Query: 1545 RFFNSNLPIWPCATSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDH--RAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            RFF          T T +KPY  T      + + +  +    H    K + C  C  +F     L +H+ +    + + CT C   F QR +L RHSL H G KP+ C +C K ++++ HL RH  ++H G  P
Sbjct:  318 RFFQRYHLARHTLTHTGVKPYACTMCDMRFIQRYQLERHSLTHT-GVKPYACTMCDKRFFQRYHLARHSLTHMGVKPYACTMCDMKFFQRYHLARHSLTHTGVKPYACTMCDKRFFQRYHLARH-SLTHMGVKP 449          

HSP 3 Score: 66.6254 bits (161), Expect = 6.240e-11
Identity = 36/121 (29.75%), Postives = 59/121 (48.76%), Query Frame = 3
Query: 1590 TDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDH--RAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKS 1946
            T +KPY  T        +    +    H    K + C+ C ++F     L +HT +    + + C+ C   F QR +L RHSL H G KP+ C++C   ++++ HL RH  ++H G  P +
Sbjct:  193 TGVKPYACTMCDMRFFQRYHLERHKLTHT-GVKPYACSLCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHSLTHTGVKPYACSMCDMRFFQRYHLARHT-LTHTGVKPYA 311          

HSP 4 Score: 65.855 bits (159), Expect = 1.144e-10
Identity = 46/150 (30.67%), Postives = 69/150 (46.00%), Query Frame = 3
Query: 1542 ERFFNSNLPIWPCATSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSS---KVFNCNQCKLQFNSLNALCKHTFSDH--RAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSH------PGSDPKSNITV 1958
            +RFF          T   +KPY  T       MK  +   +A H  +    K + C  C  +F     L +H+ +    + F CT C   F QR +L RHSL H G KP+ C++C   + +++HL RH  ++H      PG+ P  + TV
Sbjct:  373 KRFFQRYHLARHSLTHMGVKPYACTMCD----MKFFQRYHLARHSLTHTGVKPYACTMCDKRFFQRYHLARHSLTHMGVKPFACTMCDMRFVQRYHLARHSLTHTGVKPYACSMCDMRFIQRNHLERH-SLTHTGMRSSPGALPARSGTV 517          

HSP 5 Score: 61.6178 bits (148), Expect = 2.243e-9
Identity = 29/89 (32.58%), Postives = 49/89 (55.06%), Query Frame = 3
Query: 1686 KVFNCNQCKLQFNSLNALCKHTF--SDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKS 1946
            K + C  C ++F     L +H+   +  + + CT C   F QR +L+RH L H G KP+ C++C   ++++ HL RH  ++H G  P +
Sbjct:  168 KPYACAVCDMRFIQRYHLERHSLIHTGVKPYACTMCDMRFFQRYHLERHKLTHTGVKPYACSLCDMRFFQRYHLARHT-LTHTGVKPYA 255          
BLAST of Zinc finger-like protein vs. Planmine SMEST
Match: SMESG000026829.1 (SMESG000026829.1)

HSP 1 Score: 947.962 bits (2449), Expect = 0.000e+0
Identity = 491/494 (99.39%), Postives = 492/494 (99.60%), Query Frame = 3
Query:  888 MFPFTINNTFKLLSHNSDNMEDDAIKERINQTILQSIGMKKNVKINAIVVIECDNEPKRTLVINESSSGNSMNPNIQXXXXXXXXXXXXXXTNSVANHTGVILQQPSLFSTTIEDLQALFNITPNLQQNITRHNISMQDHSNPTSFLFNSNHNSSPESVLKPDKPSETNESGFSSRKRKSEKPTKIPQENSPNELNGLDLTLTVKQEHINYTDTDNKIERFFNSNLPIWPCATSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKSNITVKLSSSECLEYLERMQXXXXXXXXXXXXXKAVMNSMCLEPLEKSSPFGIHVADIDSNNAMNEDCVNGDGNEQSECSKFISYVKDDVESPGNLQISIDDKPFNGSMMMNCIKVEDIIPVNLTGNIYLENCQEQALKNCI 2369
            MFPFTINNTFKLLSHNSDNMEDDAIKERINQTILQSIGMKKNVKINAIVVIECDNEPKRTLVINESSSGNSMNPNI ISSSLSNNAFSSISTNSVANHTGVILQQPSLFSTTIEDLQALFNITPNLQQNITRHNISMQDHSNPTSFLFNSNHNSSPESVLKPDKPSETNESGFSSRKRKSEKPTKIPQENSPNELNGLDLTLTVKQEHIN+TDTDNKIERFFNSNLPIWPCATSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKSNITVKLSSSECLEYLERMQNNRLLELENAEENKAVMNSMCLEPLEKSSPFGIHVADIDSNNAMNEDCV GDGNEQSECSKFISYVKDDVESPGNLQISIDDKPFNGSMMMNCIKVEDIIPVNLTGNIYLENCQEQALKNCI
Sbjct:    1 MFPFTINNTFKLLSHNSDNMEDDAIKERINQTILQSIGMKKNVKINAIVVIECDNEPKRTLVINESSSGNSMNPNIHISSSLSNNAFSSISTNSVANHTGVILQQPSLFSTTIEDLQALFNITPNLQQNITRHNISMQDHSNPTSFLFNSNHNSSPESVLKPDKPSETNESGFSSRKRKSEKPTKIPQENSPNELNGLDLTLTVKQEHINFTDTDNKIERFFNSNLPIWPCATSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKSNITVKLSSSECLEYLERMQNNRLLELENAEENKAVMNSMCLEPLEKSSPFGIHVADIDSNNAMNEDCVTGDGNEQSECSKFISYVKDDVESPGNLQISIDDKPFNGSMMMNCIKVEDIIPVNLTGNIYLENCQEQALKNCI 494          
BLAST of Zinc finger-like protein vs. Planmine SMEST
Match: SMESG000066384.1 (SMESG000066384.1)

HSP 1 Score: 136.346 bits (342), Expect = 4.372e-35
Identity = 67/144 (46.53%), Postives = 89/144 (61.81%), Query Frame = 3
Query: 1566 PIWP-CATSTDIKPYISTQQPTTMLMKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKSNITVKLSSSECLEYLE 1994
            PI P    S  +  +   Q  T      +K ++     K S+ F CNQC+  F  LN L +HT   H +++C  C+ +FTQRSNLQRH+L+HVGFKP+ C VCSK YYRKDHL+RHI  +HP   PK NI  +LSSSE L +++
Sbjct:  107 PILPNIPKSHSMSGFFPLQMTTMNDCNKQKRKSTPVKLKKSRCFKCNQCRQIFPCLNNLTEHTLQVHGSYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSPKENIIQRLSSSESLNFID 250          
BLAST of Zinc finger-like protein vs. Planmine SMEST
Match: SMESG000000959.1 (SMESG000000959.1)

HSP 1 Score: 60.8474 bits (146), Expect = 3.626e-10
Identity = 29/82 (35.37%), Postives = 41/82 (50.00%), Query Frame = 3
Query: 1686 KVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSH 1925
            + F CN CK  F   + L +H    +  R   C FC   F +  +L  H+  H G KP+ CNVCS+ + R D  +RH   +H
Sbjct:  115 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNH 196          

HSP 2 Score: 55.0694 bits (131), Expect = 2.873e-8
Identity = 26/68 (38.24%), Postives = 34/68 (50.00%), Query Frame = 3
Query: 1764 RAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP-KSNITVKL 1964
            R F C  C   F +R  L+RH   H G +P  CN C K + R DHL  H  + H G  P + N+  +L
Sbjct:  115 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRI-HTGEKPYRCNVCSRL 181          
BLAST of Zinc finger-like protein vs. Planmine SMEST
Match: SMESG000005384.1 (SMESG000005384.1)

HSP 1 Score: 62.7734 bits (151), Expect = 4.638e-10
Identity = 32/111 (28.83%), Postives = 58/111 (52.25%), Query Frame = 3
Query: 1641 KPKKTQAIAGHKKSSKVFNCNQ--CKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKSNITVK 1961
            K +K++++ G   ++KV+ CN+  C   F+  + L +H    S  + F+C+ C   F++  +L  H   H G KP+ C++C K + R D   RH+++   G +      VK
Sbjct:  229 KSRKSRSVKG---ANKVYQCNEKNCSKTFSRSDELTRHKRIHSGEKPFKCSKCERCFSRSDHLATHIRTHTGEKPYFCSICDKRFARSDERKRHLKIHSKGQNSNETTNVK 336          
BLAST of Zinc finger-like protein vs. Planmine SMEST
Match: SMESG000042630.1 (SMESG000042630.1)

HSP 1 Score: 62.3882 bits (150), Expect = 5.125e-10
Identity = 35/102 (34.31%), Postives = 54/102 (52.94%), Query Frame = 3
Query: 1647 KKTQAIAGH---KKSSKVFNCNQCKLQFNSLNALCKHTFS--DHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSD 1937
            K++  ++ H      ++ F C  C   F+  + + KHT++    + ++C  C   F+Q SNL  HS KH G KPF C+ CS+ + R   L RHI+  H G D
Sbjct:  201 KRSSTLSTHLLIHTGNRPFPCPYCSKSFHQKSDMKKHTYTHTGEKPYKCVVCGKAFSQSSNLITHSRKHSGEKPFWCHKCSRGFQRNVDLRRHIQSQH-GDD 301          

HSP 2 Score: 50.447 bits (119), Expect = 3.837e-6
Identity = 27/87 (31.03%), Postives = 44/87 (50.57%), Query Frame = 3
Query: 1686 KVFNCNQCKLQFNSLNALCKH--TFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDP 1940
            + + C+ C   F    +L +H  T +  + F+C  C   F + S L  H L H G +PF C  CSK++++K  + +H   +H G  P
Sbjct:  161 RPYECDICPKSFGHSVSLSQHRVTHTQEKQFQCPQCGKRFKRSSTLSTHLLIHTGNRPFPCPYCSKSFHQKSDMKKHT-YTHTGEKP 246          
The following BLAST results are available for this feature:
BLAST of Zinc finger-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IKZF34.820e-1229.14IKAROS family zinc finger 3 [Source:HGNC Symbol;Ac... [more]
IKZF38.154e-1229.14IKAROS family zinc finger 3 [Source:HGNC Symbol;Ac... [more]
ZNF7461.112e-1137.50zinc finger protein 746 [Source:HGNC Symbol;Acc:HG... [more]
ZNF7461.149e-1137.50zinc finger protein 746 [Source:HGNC Symbol;Acc:HG... [more]
GFI11.173e-1139.76growth factor independent 1 transcriptional repres... [more]
back to top
BLAST of Zinc finger-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pag-32.045e-1338.82Zinc finger protein PAG-3 [Source:UniProtKB/TrEMB... [more]
K11D2.49.622e-1032.88pep chromosome:WBcel235:I:12518787:12527906:1 gene... [more]
K11D2.41.040e-932.88pep chromosome:WBcel235:I:12523505:12527906:1 gene... [more]
K11D2.41.190e-932.88pep chromosome:WBcel235:I:12523211:12527906:1 gene... [more]
klu-11.330e-930.95KLUmpfuss related [Source:UniProtKB/TrEMBL;Acc:O4... [more]
back to top
BLAST of Zinc finger-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sens-22.843e-1239.76gene:FBgn0051632 transcript:FBtr0079341[more]
sens-22.843e-1239.76gene:FBgn0051632 transcript:FBtr0345446[more]
sens8.222e-1233.65gene:FBgn0002573 transcript:FBtr0075862[more]
Cf25.670e-1133.33gene:FBgn0000286 transcript:FBtr0089649[more]
prg6.262e-1136.05gene:FBgn0285971 transcript:FBtr0079674[more]
back to top
BLAST of Zinc finger-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
znf740a1.163e-1335.63zinc finger protein 740a [Source:ZFIN;Acc:ZDB-GENE... [more]
gfi1b1.132e-1139.76growth factor independent 1B transcription repress... [more]
gfi1b1.132e-1139.76growth factor independent 1B transcription repress... [more]
gfi1aa1.273e-1139.76growth factor independent 1A transcription repress... [more]
gfi1aa1.273e-1139.76growth factor independent 1A transcription repress... [more]
back to top
BLAST of Zinc finger-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fzd11.029e-1128.87frizzled class receptor 1 [Source:Xenbase;Acc:XB-G... [more]
wdr371.032e-1139.76WD repeat domain 37 [Source:Xenbase;Acc:XB-GENE-57... [more]
IKZF31.337e-1145.95IKAROS family zinc finger 3 [Source:NCBI gene;Acc:... [more]
ttc82.068e-1136.89tetratricopeptide repeat domain 8 [Source:Xenbase;... [more]
ttc82.332e-1136.89tetratricopeptide repeat domain 8 [Source:Xenbase;... [more]
back to top
BLAST of Zinc finger-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zfp9364.544e-1342.70zinc finger protein 936 [Source:MGI Symbol;Acc:MGI... [more]
Zfp9364.603e-1342.70zinc finger protein 936 [Source:MGI Symbol;Acc:MGI... [more]
Zfp7462.910e-1238.37zinc finger protein 746 [Source:MGI Symbol;Acc:MGI... [more]
Zfp7462.932e-1238.37zinc finger protein 746 [Source:MGI Symbol;Acc:MGI... [more]
Gfi15.151e-1239.76growth factor independent 1 transcription represso... [more]
back to top
BLAST of Zinc finger-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3B7M4|ZN746_BOVIN2.652e-1231.71Zinc finger protein 746 OS=Bos taurus OX=9913 GN=Z... [more]
sp|Q3U133|ZN746_MOUSE2.036e-1138.37Zinc finger protein 746 OS=Mus musculus OX=10090 G... [more]
sp|Q6NUN9|ZN746_HUMAN5.520e-1137.50Zinc finger protein 746 OS=Homo sapiens OX=9606 GN... [more]
sp|Q99684|GFI1_HUMAN5.635e-1139.76Zinc finger protein Gfi-1 OS=Homo sapiens OX=9606 ... [more]
sp|Q5DWN0|GFI1_CANLF5.942e-1139.76Zinc finger protein Gfi-1 OS=Canis lupus familiari... [more]
back to top
BLAST of Zinc finger-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P7P2083.872e-5270.43Uncharacterized protein (Fragment) OS=Dibothriocep... [more]
A0A5J4NLS55.560e-4961.87Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A0X3NK251.065e-4869.57Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A0X3P1372.023e-4869.57Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A0R3TLZ22.086e-4869.30Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
back to top
BLAST of Zinc finger-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000039062.11.033e-1236.14pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000039663.14.191e-1236.71pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
gfi1ab7.490e-1239.76zinc finger protein Gfi-1-like [Source:NCBI gene;A... [more]
GFI1B8.925e-1239.76growth factor independent 1B transcriptional repre... [more]
GFI11.312e-1140.96growth factor independent 1 transcriptional repres... [more]
back to top
BLAST of Zinc finger-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005004.12.620e-1133.72pep scaffold:Pmarinus_7.0:GL484587:30140:35096:1 g... [more]
ENSPMAT00000007831.11.205e-1036.47pep scaffold:Pmarinus_7.0:GL477655:47469:47963:1 g... [more]
ikzf49.292e-1036.17IKAROS family zinc finger 4 [Source:ZFIN;Acc:ZDB-G... [more]
ENSPMAT00000008916.11.101e-937.50pep scaffold:Pmarinus_7.0:GL476670:39536:47416:-1 ... [more]
ENSPMAT00000003937.11.114e-936.05pep scaffold:Pmarinus_7.0:GL485487:1616:4240:1 gen... [more]
back to top
BLAST of Zinc finger-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AZF12.415e-1032.11Zinc-finger transcription factor; involved in diau... [more]
ADR11.048e-735.71Carbon source-responsive zinc-finger transcription... [more]
PZF11.185e-736.36Transcription factor IIIA (TFIIIA); essential DNA ... [more]
MET322.519e-738.18Zinc-finger DNA-binding transcription factor; invo... [more]
YGR067C_mRNA3.641e-736.84Putative protein of unknown function; contains a z... [more]
back to top
BLAST of Zinc finger-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO388693.387e-1243.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346371.489e-1133.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286061.489e-1133.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443023.082e-1142.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363544.431e-1132.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zinc finger-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000046979.12.709e-1330.15gastrula zinc finger protein XlCGF57.1 [Source:NCB... [more]
ENSORLT00000038558.12.982e-1330.15gastrula zinc finger protein XlCGF57.1 [Source:NCB... [more]
ENSORLT00000033968.13.356e-1330.15gastrula zinc finger protein XlCGF57.1 [Source:NCB... [more]
ENSORLT00000047040.13.356e-1330.15gastrula zinc finger protein XlCGF57.1 [Source:NCB... [more]
ENSORLT00000027777.13.661e-1330.15gastrula zinc finger protein XlCGF57.1 [Source:NCB... [more]
back to top
BLAST of Zinc finger-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026829.10.000e+099.39SMESG000026829.1[more]
SMESG000066384.14.372e-3546.53SMESG000066384.1[more]
SMESG000000959.13.626e-1035.37SMESG000000959.1[more]
SMESG000005384.14.638e-1028.83SMESG000005384.1[more]
SMESG000042630.15.125e-1034.31SMESG000042630.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001601 ID=SMED30001601|Name=Zinc finger-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2482bp
TTGGTTTGACTGTTGAATGGATTGTTGGACCTTGATCATGAAGGAAAATA
TTGAATAATGAGGCATCCACAGTATGCGGGCCAGGGGTCAATGCAACGGA
TCGCGAGTAATTTGAACGCACTGTTGAAGGATAGATGAATAATAATTACA
ATCAAAACCGATGGGTTTCCGATGTAAACTTGTCGAGATCGATGCATAAT
TTAGAATTGGTTTAATCAATTCAAAATGGCGGCATTTGTAAACCGATATA
ATAGAGTCGCAACTCATTAAGAACTAGATCTGAGTGCAACTTGGAAATGT
CGAGAAGTTTTGGTGTTTTTTTTTTATTATCCATGCATTCAGAATACATG
CACGCACTGGCACGCATGCACACTCGCACACCAACACGAACATTGCACCA
TGCAATTGTCGACGTCACGAGCGAGCGAGAGAGAGAGAGAGAAAGTTTTG
ACAACAATTTCTATTCGATACGACCTCAACAGGTATTCGTTAGATTGTAG
GATTGAATTTGGGCATGCAAGCTTGACCAGAATGTGACGTTTCGTCGGCA
ATTGTTTTAGCGAATTGTGCGATATTGTTATTGATTCGTGGTAGCATAAT
GAGATATTAGGACAATAAAGATTAAATCCTAATCAACCACGTTAAGGTAG
TCAGATTAAGATCGTGTGTGTGTGTGTATTTTTGATAAAGTTTGTACCCA
ATTTTATCAGTGTCGGCATGTATTTTGGTTTGAATGTCGAGTGTGCACAA
TGGCTTATTAGTAAGGCATATATGTATTGTCTTCATCATTCGGTCAATCC
ACTTTTGTAATTATCACTACTACCTCCATTTTCCTTATTTATTATTCATT
TGTTTTCGGTATTATTGAATGATCTATGCAAATTTAGATGTTTCCATTTA
CGATTAACAATACCTTCAAGTTGCTTTCCCACAACAGTGACAACATGGAG
GACGATGCGATCAAAGAAAGAATTAATCAAACAATTCTCCAGTCTATCGG
AATGAAAAAGAATGTGAAAATCAACGCGATTGTTGTGATTGAATGTGATA
ATGAACCGAAACGAACATTAGTTATAAATGAATCTTCAAGTGGGAATTCC
ATGAATCCGAATATTCAAATCTCCAGTTCTTTGTCGAATAATGCATTTTC
ATCGATTTCGACGAATTCTGTTGCCAATCATACCGGAGTGATTCTACAGC
AGCCGTCATTGTTTTCCACAACGATTGAAGATCTTCAAGCGTTGTTTAAC
ATCACACCGAACCTCCAACAAAACATTACTAGACACAATATTTCAATGCA
AGACCACTCAAACCCGACGAGTTTCTTATTCAATTCCAACCATAACTCAA
GTCCAGAATCGGTTTTGAAACCCGACAAACCATCGGAAACAAATGAATCC
GGGTTTTCATCTCGGAAACGAAAATCAGAAAAACCAACGAAAATTCCCCA
GGAAAATTCTCCCAATGAATTGAACGGATTGGATCTGACATTGACTGTCA
AACAAGAGCATATCAATTACACAGATACCGATAATAAAATTGAGAGATTT
TTCAACTCGAATCTCCCGATTTGGCCGTGTGCAACGTCGACAGACATAAA
ACCGTATATCTCCACCCAACAGCCTACAACTATGTTGATGAAACCGAAAA
AAACTCAGGCTATTGCTGGACACAAAAAATCCAGTAAAGTTTTTAATTGT
AACCAATGTAAGCTTCAGTTCAACTCGTTGAATGCTCTATGTAAGCACAC
GTTTTCCGATCATCGAGCGTTCCGATGCACCTTCTGTAGTGCCAATTTCA
CCCAAAGGTCGAATCTTCAGCGGCATTCGTTGAAACATGTCGGATTCAAG
CCGTTCATTTGTAATGTGTGCAGTAAAGCATATTATCGAAAAGACCATCT
CGTGCGACATATCGAAGTCAGTCATCCAGGTTCTGATCCCAAATCGAATA
TTACTGTCAAATTGTCATCGTCTGAATGTCTAGAATACCTCGAAAGAATG
CAAAACAACAGACTATTGGAATTGGAAAACGCGGAAGAAAACAAAGCCGT
CATGAATTCAATGTGTCTAGAACCTTTAGAGAAATCTTCTCCGTTTGGAA
TACATGTTGCCGACATTGACAGCAACAATGCAATGAATGAGGACTGTGTT
AATGGTGACGGCAATGAACAGTCAGAATGTAGTAAATTCATATCATATGT
AAAAGACGATGTAGAATCTCCTGGAAATTTGCAGATATCTATTGACGATA
AACCCTTCAATGGAAGCATGATGATGAATTGCATCAAAGTAGAAGATATT
ATTCCTGTCAACCTTACTGGCAACATATATTTGGAAAATTGTCAAGAACA
AGCCTTGAAGAACTGCATTTGATGGAGCAAAGACATATTTTGTTGAGTTG
TGATTACGTTTGTATTTGTATTATTTAGCGCACTTTATTTATGGTTTCTA
ATTTCAATAAAATTATTTATGATTTAAAAAAA
back to top

protein sequence of SMED30001601-orf-1

>SMED30001601-orf-1 ID=SMED30001601-orf-1|Name=SMED30001601-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=495bp
MFPFTINNTFKLLSHNSDNMEDDAIKERINQTILQSIGMKKNVKINAIVV
IECDNEPKRTLVINESSSGNSMNPNIQISSSLSNNAFSSISTNSVANHTG
VILQQPSLFSTTIEDLQALFNITPNLQQNITRHNISMQDHSNPTSFLFNS
NHNSSPESVLKPDKPSETNESGFSSRKRKSEKPTKIPQENSPNELNGLDL
TLTVKQEHINYTDTDNKIERFFNSNLPIWPCATSTDIKPYISTQQPTTML
MKPKKTQAIAGHKKSSKVFNCNQCKLQFNSLNALCKHTFSDHRAFRCTFC
SANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSD
PKSNITVKLSSSECLEYLERMQNNRLLELENAEENKAVMNSMCLEPLEKS
SPFGIHVADIDSNNAMNEDCVNGDGNEQSECSKFISYVKDDVESPGNLQI
SIDDKPFNGSMMMNCIKVEDIIPVNLTGNIYLENCQEQALKNCI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000011protonephridial progenitor cell
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 365..385
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 244..317
e-value: 2.9E-7
score: 32.4
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 319..348
e-value: 3.6E-9
score: 38.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 170..185
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 152..196
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 152..169
NoneNo IPR availablePANTHERPTHR24377FAMILY NOT NAMEDcoord: 262..349
coord: 262..343
NoneNo IPR availablePANTHERPTHR24377:SF807coord: 262..349
NoneNo IPR availablePANTHERPTHR24377:SF807coord: 262..343
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 269..292
e-value: 0.81
score: 18.7
coord: 323..346
e-value: 0.014
score: 24.5
coord: 295..317
e-value: 0.0078
score: 25.4
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 323..346
e-value: 3.1E-4
score: 21.1
coord: 295..317
e-value: 0.0062
score: 16.9
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 325..346
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 297..317
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 295..322
score: 13.152
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 323..351
score: 12.528
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 293..342