Retinitis pigmentosa GTPase regulator b

Overview
NameRetinitis pigmentosa GTPase regulator b
Smed IDSMED30001587
Length (bp)1906
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Retinitis pigmentosa GTPase regulator b (SMED30001587) t-SNE clustered cells

Violin plots show distribution of expression levels for Retinitis pigmentosa GTPase regulator b (SMED30001587) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Retinitis pigmentosa GTPase regulator b (SMED30001587) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Retinitis pigmentosa GTPase regulator b (SMED30001587) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001587

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30001587SMESG000062950.1 dd_Smed_v6_2716_1_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30001587SMESG000062950.1 Contig40801newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30001587SMESG000062950.1 Contig40801uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30001587SMESG000062950.1 Contig34823newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30001587SMESG000062950.1 Contig34823uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
prepharyngeal regionSMED30001587SMESG000062950.1 PL06017A1F03ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
parapharyngeal regionSMED30001587SMESG000062950.1 PL06017A1F03ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
epidermisSMED30001587SMESG000062950.1 dd_Smed_v4_2716_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Human
Match: RPGR (retinitis pigmentosa GTPase regulator [Source:HGNC Symbol;Acc:HGNC:10295])

HSP 1 Score: 253.832 bits (647), Expect = 5.819e-76
Identity = 161/385 (41.82%), Postives = 218/385 (56.62%), Query Frame = 1
Query:   70 ENYIPETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYG--NICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAI-SQGRLYVWGEYTNQKLG--DSFQENQSTPQGILIKIPIK--QVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLV 1200
            E  +P++GA+F FG+    E    K W KND  + LSCGDE   ++T + + + +G N+WGQLGL        P+C+KALK   EK  L ACGR HT++ TE   +Y  G NN+GQLGL D  +       + S+      I QL AG   SAA+ E G+L++WG NSE Q+GL + S+  +  P  ++  K PVS++ CG YH+A + + G LYV+GE  N KLG  +    N  TPQ ++ +IP K  QV+CG  HTV L+EN  VY +G G  GQLGLG     +  PK+  I N+            +    IS GE+HT + T  GL  +FGDGRHGKLG   G  N++N+  P L +N  +   V  V CGGCH VV  
Sbjct:    5 EELMPDSGAVFTFGKSKFAENNPGKFWFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKSAISKPTCVKALK--PEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGD--TEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNVCV--PQQVTIGK-PVSWISCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQ-LVSEIPEKVIQVACGGEHTVVLTENA-VYTFGLGQFGQLGLGTFLFETSEPKV--IENI----------RDQTISYISCGENHTALITDIGLMYTFGDGRHGKLGL--GLENFTNHFIPTLCSNFLR-FIVKLVACGGCHMVVFA 365          

HSP 2 Score: 90.8929 bits (224), Expect = 1.706e-18
Identity = 81/252 (32.14%), Postives = 118/252 (46.83%), Query Frame = 1
Query:  469 WIYGNI-CQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFK-SPVSYVDCGNYHAAAISQG-RLYVWGEYTNQKLGDSFQENQSTPQGILI---KIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRN 1206
            W   ++   L  G E SA +    KLY++GSN+  QLGLG  S   I KPT +   K   V    CG  H    ++G  +Y  G     +LG    E ++T   I     +  IKQ+S G N +  L+E+G +++WG    GQ+GL    +S+     + +P  +  G   S         IS G  H+   TT G    FG+  +GKLG     +   N+  P+L++ + +   V  V CGG HTVVL  N
Sbjct:   31 WFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKS--AISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGL--KNVSN-----VCVPQQVTIGKPVSW--------ISCGYYHSAFVTTDGELYVFGEPENGKLGLPN--QLLGNHRTPQLVSEIPEK--VIQVACGGEHTVVLTEN 261          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Human
Match: RPGR (retinitis pigmentosa GTPase regulator [Source:HGNC Symbol;Acc:HGNC:10295])

HSP 1 Score: 251.521 bits (641), Expect = 1.057e-75
Identity = 159/385 (41.30%), Postives = 216/385 (56.10%), Query Frame = 1
Query:   70 ENYIPETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYG--NICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAI-SQGRLYVWGEYTNQKLG--DSFQENQSTPQGILIKIPIK--QVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLV 1200
            E  +P++GA+F FG+    E    K W KND  + LSCGDE   ++T + + + +G N+WGQLGL        P+C+KALK   EK  L ACGR HT++ TE   +Y  G NN+GQLGL D  +       + S+      I QL AG   SAA+ E G+L++WG NSE Q+GL + S+  + +   +     PVS++ CG YH+A + + G LYV+GE  N KLG  +    N  TPQ ++ +IP K  QV+CG  HTV L+EN  VY +G G  GQLGLG     +  PK+  I N+            +    IS GE+HT + T  GL  +FGDGRHGKLG   G  N++N+  P L +N  +   V  V CGGCH VV  
Sbjct:    5 EELMPDSGAVFTFGKSKFAENNPGKFWFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKSAISKPTCVKALK--PEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGD--TEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNVCVPQQVTIG---KPVSWISCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQ-LVSEIPEKVIQVACGGEHTVVLTENA-VYTFGLGQFGQLGLGTFLFETSEPKV--IENI----------RDQTISYISCGENHTALITDIGLMYTFGDGRHGKLGL--GLENFTNHFIPTLCSNFLR-FIVKLVACGGCHMVVFA 365          

HSP 2 Score: 89.3521 bits (220), Expect = 4.268e-18
Identity = 81/252 (32.14%), Postives = 118/252 (46.83%), Query Frame = 1
Query:  469 WIYGNI-CQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFK-SPVSYVDCGNYHAAAISQG-RLYVWGEYTNQKLGDSFQENQSTPQGILI---KIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRN 1206
            W   ++   L  G E SA +    KLY++GSN+  QLGLG  S   I KPT +   K   V    CG  H    ++G  +Y  G     +LG    E ++T   I     +  IKQ+S G N +  L+E+G +++WG    GQ+GL    +S+     + +P  +  G   S         IS G  H+   TT G    FG+  +GKLG     +   N+  P+L++ + +   V  V CGG HTVVL  N
Sbjct:   31 WFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLG--SKSAISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGL--KNVSN-----VCVPQQVTIGKPVSW--------ISCGYYHSAFVTTDGELYVFGEPENGKLGLPN--QLLGNHRTPQLVSEIPEK--VIQVACGGEHTVVLTEN 261          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Human
Match: RPGR (retinitis pigmentosa GTPase regulator [Source:HGNC Symbol;Acc:HGNC:10295])

HSP 1 Score: 255.373 bits (651), Expect = 1.866e-75
Identity = 161/385 (41.82%), Postives = 218/385 (56.62%), Query Frame = 1
Query:   70 ENYIPETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYG--NICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAI-SQGRLYVWGEYTNQKLG--DSFQENQSTPQGILIKIPIK--QVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLV 1200
            E  +P++GA+F FG+    E    K W KND  + LSCGDE   ++T + + + +G N+WGQLGL        P+C+KALK   EK  L ACGR HT++ TE   +Y  G NN+GQLGL D  +       + S+      I QL AG   SAA+ E G+L++WG NSE Q+GL + S+  +  P  ++  K PVS++ CG YH+A + + G LYV+GE  N KLG  +    N  TPQ ++ +IP K  QV+CG  HTV L+EN  VY +G G  GQLGLG     +  PK+  I N+            +    IS GE+HT + T  GL  +FGDGRHGKLG   G  N++N+  P L +N  +   V  V CGGCH VV  
Sbjct:    5 EELMPDSGAVFTFGKSKFAENNPGKFWFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKSAISKPTCVKALK--PEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGD--TEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNVCV--PQQVTIGK-PVSWISCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQ-LVSEIPEKVIQVACGGEHTVVLTENA-VYTFGLGQFGQLGLGTFLFETSEPKV--IENI----------RDQTISYISCGENHTALITDIGLMYTFGDGRHGKLGL--GLENFTNHFIPTLCSNFLR-FIVKLVACGGCHMVVFA 365          

HSP 2 Score: 91.6633 bits (226), Expect = 1.319e-18
Identity = 81/252 (32.14%), Postives = 118/252 (46.83%), Query Frame = 1
Query:  469 WIYGNI-CQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFK-SPVSYVDCGNYHAAAISQG-RLYVWGEYTNQKLGDSFQENQSTPQGILI---KIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRN 1206
            W   ++   L  G E SA +    KLY++GSN+  QLGLG  S   I KPT +   K   V    CG  H    ++G  +Y  G     +LG    E ++T   I     +  IKQ+S G N +  L+E+G +++WG    GQ+GL    +S+     + +P  +  G   S         IS G  H+   TT G    FG+  +GKLG     +   N+  P+L++ + +   V  V CGG HTVVL  N
Sbjct:   31 WFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKS--AISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGL--KNVSN-----VCVPQQVTIGKPVSW--------ISCGYYHSAFVTTDGELYVFGEPENGKLGLPN--QLLGNHRTPQLVSEIPEK--VIQVACGGEHTVVLTEN 261          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Human
Match: RPGR (retinitis pigmentosa GTPase regulator [Source:HGNC Symbol;Acc:HGNC:10295])

HSP 1 Score: 257.684 bits (657), Expect = 6.144e-75
Identity = 161/385 (41.82%), Postives = 218/385 (56.62%), Query Frame = 1
Query:   70 ENYIPETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYG--NICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAI-SQGRLYVWGEYTNQKLG--DSFQENQSTPQGILIKIPIK--QVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLV 1200
            E  +P++GA+F FG+    E    K W KND  + LSCGDE   ++T + + + +G N+WGQLGL        P+C+KALK   EK  L ACGR HT++ TE   +Y  G NN+GQLGL D  +       + S+      I QL AG   SAA+ E G+L++WG NSE Q+GL + S+  +  P  ++  K PVS++ CG YH+A + + G LYV+GE  N KLG  +    N  TPQ ++ +IP K  QV+CG  HTV L+EN  VY +G G  GQLGLG     +  PK+  I N+            +    IS GE+HT + T  GL  +FGDGRHGKLG   G  N++N+  P L +N  +   V  V CGGCH VV  
Sbjct:    5 EELMPDSGAVFTFGKSKFAENNPGKFWFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKSAISKPTCVKALK--PEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGD--TEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNVCV--PQQVTIGK-PVSWISCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQ-LVSEIPEKVIQVACGGEHTVVLTENA-VYTFGLGQFGQLGLGTFLFETSEPKV--IENI----------RDQTISYISCGENHTALITDIGLMYTFGDGRHGKLG--LGLENFTNHFIPTLCSNFLR-FIVKLVACGGCHMVVFA 365          

HSP 2 Score: 93.9745 bits (232), Expect = 2.621e-19
Identity = 81/252 (32.14%), Postives = 118/252 (46.83%), Query Frame = 1
Query:  469 WIYGNI-CQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFK-SPVSYVDCGNYHAAAISQG-RLYVWGEYTNQKLGDSFQENQSTPQGILI---KIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRN 1206
            W   ++   L  G E SA +    KLY++GSN+  QLGLG  S   I KPT +   K   V    CG  H    ++G  +Y  G     +LG    E ++T   I     +  IKQ+S G N +  L+E+G +++WG    GQ+GL    +S+     + +P  +  G   S         IS G  H+   TT G    FG+  +GKLG     +   N+  P+L++ + +   V  V CGG HTVVL  N
Sbjct:   31 WFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKS--AISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGL--KNVSN-----VCVPQQVTIGKPVSW--------ISCGYYHSAFVTTDGELYVFGEPENGKLGLPN--QLLGNHRTPQLVSEIPEK--VIQVACGGEHTVVLTEN 261          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Human
Match: RPGR (retinitis pigmentosa GTPase regulator [Source:HGNC Symbol;Acc:HGNC:10295])

HSP 1 Score: 254.218 bits (648), Expect = 7.226e-75
Identity = 161/385 (41.82%), Postives = 218/385 (56.62%), Query Frame = 1
Query:   70 ENYIPETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYG--NICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAI-SQGRLYVWGEYTNQKLG--DSFQENQSTPQGILIKIPIK--QVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLV 1200
            E  +P++GA+F FG+    E    K W KND  + LSCGDE   ++T + + + +G N+WGQLGL        P+C+KALK   EK  L ACGR HT++ TE   +Y  G NN+GQLGL D  +       + S+      I QL AG   SAA+ E G+L++WG NSE Q+GL + S+  +  P  ++  K PVS++ CG YH+A + + G LYV+GE  N KLG  +    N  TPQ ++ +IP K  QV+CG  HTV L+EN  VY +G G  GQLGLG     +  PK+  I N+            +    IS GE+HT + T  GL  +FGDGRHGKLG   G  N++N+  P L +N  +   V  V CGGCH VV  
Sbjct:    5 EELMPDSGAVFTFGKSKFAENNPGKFWFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKSAISKPTCVKALK--PEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGD--TEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNVCV--PQQVTIGK-PVSWISCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQ-LVSEIPEKVIQVACGGEHTVVLTENA-VYTFGLGQFGQLGLGTFLFETSEPKV--IENI----------RDQTISYISCGENHTALITDIGLMYTFGDGRHGKLGL--GLENFTNHFIPTLCSNFLR-FIVKLVACGGCHMVVFA 365          

HSP 2 Score: 92.8189 bits (229), Expect = 6.262e-19
Identity = 81/252 (32.14%), Postives = 118/252 (46.83%), Query Frame = 1
Query:  469 WIYGNI-CQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFK-SPVSYVDCGNYHAAAISQG-RLYVWGEYTNQKLGDSFQENQSTPQGILI---KIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRN 1206
            W   ++   L  G E SA +    KLY++GSN+  QLGLG  S   I KPT +   K   V    CG  H    ++G  +Y  G     +LG    E ++T   I     +  IKQ+S G N +  L+E+G +++WG    GQ+GL    +S+     + +P  +  G   S         IS G  H+   TT G    FG+  +GKLG     +   N+  P+L++ + +   V  V CGG HTVVL  N
Sbjct:   31 WFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKS--AISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGL--KNVSN-----VCVPQQVTIGKPVSW--------ISCGYYHSAFVTTDGELYVFGEPENGKLGLPN--QLLGNHRTPQLVSEIPEK--VIQVACGGEHTVVLTEN 261          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Celegans
Match: herc-1 (HECT and RCC domain E3 ubiquitin ligase [Source:UniProtKB/TrEMBL;Acc:W6RY72])

HSP 1 Score: 110.538 bits (275), Expect = 7.563e-25
Identity = 98/363 (27.00%), Postives = 164/363 (45.18%), Query Frame = 1
Query:  163 IISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKS-PVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNRESHELINEII 1239
            + S++CG++  V +T+ G+ +  G N  GQLG    +T  + S        + K I ++ GR HT+  T+  +++ +G N  GQLG++ K +    P+ +      +I Q+ +G     A++E G+++VWG  ++            I++P  +      P+  V  G  H  A+S  G ++ WG+  + +LG      Q++ Q +  +  + + + +CG NHTV L+  G  + +G    GQ G G        P    + +L+  GS            I+AG  HT I   KG    FG    G+LGN G     S    P+    LD    V+     G H    VR+  + E  NEI+
Sbjct:   43 VTSVTCGEQHTVFLTKDGKMWSVGSNMDGQLGRGS-RTEGSFSIYPVSWTSSAKIIQISAGRSHTVSVTDDGRVFAWGSNEHGQLGMESKFTWQGTPRRVQE--INDIVQVASGSNHCIALDEGGRVFVWGEQAD---------GRCIHRPEPVEQLSGVPIVRVLAGARHCLALSASGAVFTWGQNNSGELGIDDLRPQTSVQHVHQMDGLGVVEAACGDNHTVLLTHCGRTFSFGSDALGQCGFGKKVEKRTNPT--AVSDLI--GS--------HVTRIAAGACHT-IAICKGAPYPFGLNSSGQLGN-GKIMTQST---PRKTDELDHVTGVF----AGYHQTFFVRSSGTIEQ-NEIV 371          

HSP 2 Score: 106.686 bits (265), Expect = 1.236e-23
Identity = 87/332 (26.20%), Postives = 150/332 (45.18%), Query Frame = 1
Query:  223 FGYGKNDWGQLGLNDIKTTLT--PSCIKALKNLNEKAIL-VACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFK-SPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVR 1203
             G G    GQLG+   ++T+      I A  +++  A+  V CG  HT+  T+  K++  G N DGQLG   +   +     ++      I Q+ AG   + ++ + G+++ WGSN   QLG+     +  ++ T     + + +  V  G+ H  A+ + GR++VWGE   Q  G      +   Q  L  +PI +V  G  H + LS +G V+ WG+ +SG+LG+      +    + ++  L V             +  + G++HTV+ T  G   SFG      LG  G  +       P  +++L     V  +  G CHT+ + +
Sbjct:    6 LGCGHTGEGQLGVRLSESTIQVPERIIGAPNDMDGTAVTSVTCGEQHTVFLTKDGKMWSVGSNMDGQLGRGSRTEGSFSIYPVSWTSSAKIIQISAGRSHTVSVTDDGRVFAWGSNEHGQLGM---ESKFTWQGTPRRVQEINDIVQVASGSNHCIALDEGGRVFVWGE---QADGRCIHRPEPVEQ--LSGVPIVRVLAGARHCLALSASGAVFTWGQNNSGELGIDDLRPQTSVQHVHQMDGLGV-------------VEAACGDNHTVLLTHCGRTFSFGS---DALGQCGFGKKVEKRTNPTAVSDLIGS-HVTRIAAGACHTIAICK 312          

HSP 3 Score: 76.6406 bits (187), Expect = 3.058e-14
Identity = 69/258 (26.74%), Postives = 121/258 (46.90%), Query Frame = 1
Query:  145 WIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTL-TPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGD----HSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQ-ENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLG 891
            W  + KII +S G    V +T  GR F +G N+ GQLG+    T   TP  ++ + ++    + VA G  H I   E  +++ +G   DG      +     EP E  S +   I ++ AG     A++ +G ++ WG N+  +LG+ D     S + +++   L   ++      CG+ H   ++  GR + +G     + G   + E ++ P  +  LI   + +++ G  HT+ + + G  Y +G   SGQLG G
Sbjct:   90 WTSSAKIIQISAGRSHTVSVTDDGRVFAWGSNEHGQLGMESKFTWQGTPRRVQEINDI----VQVASGSNHCIALDEGGRVFVWGEQADG------RCIHRPEPVEQLSGV--PIVRVLAGARHCLALSASGAVFTWGQNNSGELGIDDLRPQTSVQHVHQMDGLGVVEAA-----CGDNHTVLLTHCGRTFSFGSDALGQCGFGKKVEKRTNPTAVSDLIGSHVTRIAAGACHTIAICK-GAPYPFGLNSSGQLGNG 329          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Celegans
Match: herc-1 (HECT and RCC domain E3 ubiquitin ligase [Source:UniProtKB/TrEMBL;Acc:W6RY72])

HSP 1 Score: 110.538 bits (275), Expect = 7.563e-25
Identity = 98/363 (27.00%), Postives = 164/363 (45.18%), Query Frame = 1
Query:  163 IISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKS-PVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNRESHELINEII 1239
            + S++CG++  V +T+ G+ +  G N  GQLG    +T  + S        + K I ++ GR HT+  T+  +++ +G N  GQLG++ K +    P+ +      +I Q+ +G     A++E G+++VWG  ++            I++P  +      P+  V  G  H  A+S  G ++ WG+  + +LG      Q++ Q +  +  + + + +CG NHTV L+  G  + +G    GQ G G        P    + +L+  GS            I+AG  HT I   KG    FG    G+LGN G     S    P+    LD    V+     G H    VR+  + E  NEI+
Sbjct:   43 VTSVTCGEQHTVFLTKDGKMWSVGSNMDGQLGRGS-RTEGSFSIYPVSWTSSAKIIQISAGRSHTVSVTDDGRVFAWGSNEHGQLGMESKFTWQGTPRRVQE--INDIVQVASGSNHCIALDEGGRVFVWGEQAD---------GRCIHRPEPVEQLSGVPIVRVLAGARHCLALSASGAVFTWGQNNSGELGIDDLRPQTSVQHVHQMDGLGVVEAACGDNHTVLLTHCGRTFSFGSDALGQCGFGKKVEKRTNPT--AVSDLI--GS--------HVTRIAAGACHT-IAICKGAPYPFGLNSSGQLGN-GKIMTQST---PRKTDELDHVTGVF----AGYHQTFFVRSSGTIEQ-NEIV 371          

HSP 2 Score: 106.686 bits (265), Expect = 1.236e-23
Identity = 87/332 (26.20%), Postives = 150/332 (45.18%), Query Frame = 1
Query:  223 FGYGKNDWGQLGLNDIKTTLT--PSCIKALKNLNEKAIL-VACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFK-SPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVR 1203
             G G    GQLG+   ++T+      I A  +++  A+  V CG  HT+  T+  K++  G N DGQLG   +   +     ++      I Q+ AG   + ++ + G+++ WGSN   QLG+     +  ++ T     + + +  V  G+ H  A+ + GR++VWGE   Q  G      +   Q  L  +PI +V  G  H + LS +G V+ WG+ +SG+LG+      +    + ++  L V             +  + G++HTV+ T  G   SFG      LG  G  +       P  +++L     V  +  G CHT+ + +
Sbjct:    6 LGCGHTGEGQLGVRLSESTIQVPERIIGAPNDMDGTAVTSVTCGEQHTVFLTKDGKMWSVGSNMDGQLGRGSRTEGSFSIYPVSWTSSAKIIQISAGRSHTVSVTDDGRVFAWGSNEHGQLGM---ESKFTWQGTPRRVQEINDIVQVASGSNHCIALDEGGRVFVWGE---QADGRCIHRPEPVEQ--LSGVPIVRVLAGARHCLALSASGAVFTWGQNNSGELGIDDLRPQTSVQHVHQMDGLGV-------------VEAACGDNHTVLLTHCGRTFSFGS---DALGQCGFGKKVEKRTNPTAVSDLIGS-HVTRIAAGACHTIAICK 312          

HSP 3 Score: 76.6406 bits (187), Expect = 3.058e-14
Identity = 69/258 (26.74%), Postives = 121/258 (46.90%), Query Frame = 1
Query:  145 WIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTL-TPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGD----HSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQ-ENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLG 891
            W  + KII +S G    V +T  GR F +G N+ GQLG+    T   TP  ++ + ++    + VA G  H I   E  +++ +G   DG      +     EP E  S +   I ++ AG     A++ +G ++ WG N+  +LG+ D     S + +++   L   ++      CG+ H   ++  GR + +G     + G   + E ++ P  +  LI   + +++ G  HT+ + + G  Y +G   SGQLG G
Sbjct:   90 WTSSAKIIQISAGRSHTVSVTDDGRVFAWGSNEHGQLGMESKFTWQGTPRRVQEINDI----VQVASGSNHCIALDEGGRVFVWGEQADG------RCIHRPEPVEQLSGV--PIVRVLAGARHCLALSASGAVFTWGQNNSGELGIDDLRPQTSVQHVHQMDGLGVVEAA-----CGDNHTVLLTHCGRTFSFGSDALGQCGFGKKVEKRTNPTAVSDLIGSHVTRIAAGACHTIAICK-GAPYPFGLNSSGQLGNG 329          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Celegans
Match: glo-4 (X-linked retinitis pigmentosa GTPase regulator homolog [Source:UniProtKB/Swiss-Prot;Acc:Q5DX34])

HSP 1 Score: 87.0409 bits (214), Expect = 1.947e-17
Identity = 82/328 (25.00%), Postives = 131/328 (39.94%), Query Frame = 1
Query:  163 IISLSCGDEFCVLITRSGRAFGYGKNDWGQLGL--NDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKI----SSTSEP------KEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSE------------YQLGLGDHSDEVIYKPT-------------------------LLSFFKSPVSYVDCGNYHAAAI-SQGRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIK--QVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFI 990
            I  ++CG      I   G  + +G   WGQLG    +    L P+ +  L     K   +ACGR HT++ T++ ++   G  + GQ+G+DD I    + T  P      ++I +  Y +IC           I E  +++ WG N +                L +  D     P+                         +  F    +  V CG  H+A I S+G LY WG+  + +LG   +  +  P  +      K   VS G+NHT+  +++G V+ WGK D GQ G                  +L K +G+S + T+KF 
Sbjct:  823 IEKIACGQFHSAFICSDGSLWTFGWGVWGQLGHGGRNNSNQLVPTRVNGLIC---KVTQIACGRAHTVVLTDTGRVLVCGSGSYGQMGVDDDIKKVFAFTPLPLGPLRVRDIATHYYHSIC-----------ITEDNRVFEWGRNPQELKMRMFVMKKIRSAQLKNTEDPSSPSPSTNGSTPRVNLNLPAEIPREDLGLREVKHFLDGNIVSVACGLSHSALITSEGTLYTWGKGLDYQLGHGNKNERMEPHQVFEPNGAKWVNVSLGNNHTIASTDDGSVFAWGKNDFGQCG------------------VLTKKNGNSADVTKKFF 1118          

HSP 2 Score: 82.4185 bits (202), Expect = 6.593e-16
Identity = 85/349 (24.36%), Postives = 149/349 (42.69%), Query Frame = 1
Query:  169 SLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNIC---QLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVI-YKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGE---------YTNQKL------------GDSFQENQSTPQ---GILIKIP----------------IKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLG 1080
            +++CG E  ++++ SG+   +G N +GQ G+           +       EK   +ACG+ H+        L+ FG    GQLG   + +S    + + + + G IC   Q+  G   +  + +TG++ V GS S  Q+G+ D   +V  + P  L   +  V  +    YH+  I++  R++ WG          +  +K+              S   N STP+    +  +IP                I  V+CG +H+  ++  G +Y WGKG   QLG G      E       P+ + + +G       K++N+S G +HT+ +T  G   ++G    G+ G
Sbjct:  774 AIACGAEHILVLSSSGQLSAWGGNRFGQCGVGHSFRIANLHQVDGDWPAIEK---IACGQFHSAFICSDGSLWTFGWGVWGQLGHGGRNNSN---QLVPTRVNGLICKVTQIACGRAHTVVLTDTGRVLVCGSGSYGQMGVDDDIKKVFAFTPLPLGPLR--VRDIATHYYHSICITEDNRVFEWGRNPQELKMRMFVMKKIRSAQLKNTEDPSSPSPSTNGSTPRVNLNLPAEIPREDLGLREVKHFLDGNIVSVACGLSHSALITSEGTLYTWGKGLDYQLGHGNKNERME-------PHQVFEPNG------AKWVNVSLGNNHTIASTDDGSVFAWGKNDFGQCG 1101          

HSP 3 Score: 64.6994 bits (156), Expect = 1.951e-10
Identity = 69/322 (21.43%), Postives = 130/322 (40.37%), Query Frame = 1
Query:  334 VACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGE--YTNQKLGDSFQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDS----------------------------LESTEKF-----INISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTV 1191
            +ACG  H ++ + S +L  +G N  GQ G+       +  +    W    I ++  G   SA I   G L+ +G     QLG G  ++     PT ++     V+ + CG  H   ++  GR+ V G   Y    + D  ++  +     L  + ++ ++  + H++C++E+  V+ WG+         P  L      + +I +  +K + D                             L   + F     ++++ G SH+ + T++G   ++G G   +LG+     N +  M P  +   +   WV NV  G  HT+
Sbjct:  775 IACGAEHILVLSSSGQLSAWGGNRFGQCGVGHSFRIANLHQVDGDW--PAIEKIACGQFHSAFICSDGSLWTFGWGVWGQLGHGGRNNSNQLVPTRVNGLICKVTQIACGRAHTVVLTDTGRVLVCGSGSYGQMGVDDDIKKVFAFTPLPLGPLRVRDIATHYYHSICITEDNRVFEWGR--------NPQELKMRMFVMKKIRSAQLKNTEDPSSPSPSTNGSTPRVNLNLPAEIPREDLGLREVKHFLDGNIVSVACGLSHSALITSEGTLYTWGKGLDYQLGH----GNKNERMEPHQVFEPNGAKWV-NVSLGNNHTI 1081          

HSP 4 Score: 60.8474 bits (146), Expect = 2.514e-9
Identity = 60/209 (28.71%), Postives = 89/209 (42.58%), Query Frame = 1
Query:  661 GNYHAAAISQG-RLYVWGEYTN-------------QKLGDSF------------QENQSTPQGILIKIP---IKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNL-LVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVL 1197
            GN   A I++  RL +WG +TN              K  DS             +  Q  P+  +++ P    + ++CG  H + LS +G +  WG    GQ G+G  +         RI NL  V G   ++E       I+ G+ H+    + G   +FG G  G+LG+  G RN SN + P  +  L     V  + CG  HTVVL
Sbjct:  702 GNNCGATITEDDRLMIWGNFTNAQQRMEMPQMNAKSKRSDSVTNGAPTLPPPAPKPEQHLPR--VLEYPGGRPRAIACGAEHILVLSSSGQLSAWGGNRFGQCGVGHSF---------RIANLHQVDGDWPAIE------KIACGQFHSAFICSDGSLWTFGWGVWGQLGH--GGRNNSNQLVPTRVNGLICK--VTQIACGRAHTVVL 889          

HSP 5 Score: 56.225 bits (134), Expect = 6.910e-8
Identity = 62/249 (24.90%), Postives = 99/249 (39.76%), Query Frame = 1
Query:  415 LGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWG--SNSEYQLGL------GDHSDEVI---------------YKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWG--EYTNQKLGDSFQ-ENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLG 1080
            L L   I   SE K        N   L  G    A I E  +L +WG  +N++ ++ +         SD V                + P +L +       + CG  H   +S  G+L  WG   +    +G SF+  N     G    I  ++++CG  H+  +  +G ++ +G G  GQLG G    S++     R+  L+ K              I+ G +HTV+ T  G  L  G G +G++G
Sbjct:  673 LSLVSSIHILSEKKISNHANLPNFLPLAGGNNCGATITEDDRLMIWGNFTNAQQRMEMPQMNAKSKRSDSVTNGAPTLPPPAPKPEQHLPRVLEYPGGRPRAIACGAEHILVLSSSGQLSAWGGNRFGQCGVGHSFRIANLHQVDGDWPAI--EKIACGQFHSAFICSDGSLWTFGWGVWGQLGHGGRNNSNQLVPT-RVNGLICK-----------VTQIACGRAHTVVLTDTGRVLVCGSGSYGQMG 907          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Celegans
Match: nekl-1 (NEK (NEver in mitosis Kinase) Like [Source:UniProtKB/TrEMBL;Acc:A0A061AD48])

HSP 1 Score: 75.485 bits (184), Expect = 6.758e-14
Identity = 72/259 (27.80%), Postives = 110/259 (42.47%), Query Frame = 1
Query:  148 IKNDKIISLSCGDEFCVLITRSGR--AFGYGKNDWGQLGL-NDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDH----------SDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQST----PQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGD 870
            +K   I S+  G+ F V+    G    FG  KN    LGL  D K +  P  ++ L   N K I   CG  H +   ES +  G+G N  GQLGL   +     P +I       I   KAG + +  +++ G L   GSN   +L L              ++ + KPT+L  F   V     G+YH+  I + G++ ++G   N +LG    +  +     P   L+      V CG   T+  +   ++Y WG+ D
Sbjct:  478 LKGRDIQSVGVGNYFSVICCDRGTLLTFGTAKN----LGLGKDAKDSAKPMLLEQLLRENIKDIY--CGHDHVVAVLESGECLGWGSNQYGQLGL-PTLEHFFAPTKIPMPSNKKIVYGKAGKDATMLLSDDGSLIAMGSNKHNKLNLTQRVGFFTKEKKTPNDYVNKPTILQGFPERVVDFSVGSYHSGVILESGQVMIFGRNDNTELGLGNSQKMAVRCVKPVKSLLHHACTHVLCGDGFTLVSTTEQELYFWGRKD 729          

HSP 2 Score: 69.3218 bits (168), Expect = 6.458e-12
Identity = 69/255 (27.06%), Postives = 108/255 (42.35%), Query Frame = 1
Query:  196 VLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFF---KSP------VSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDS-----FQENQSTPQGILIKIPIKQ--------VSCGHNHTVCLSENGDVYVWGKGDSGQLGLG 891
            +++T     FG+G N  GQLG            +++LK  + ++  V  G   ++I  +   L  FG   +  LG D K   +++P  +   +  NI  +  G +   A+ E+G+   WGSN   QLGL          PTL  FF   K P      + Y   G      +S  G L   G   + KL  +     F + + TP   + K  I Q         S G  H+  + E+G V ++G+ D+ +LGLG
Sbjct:  442 MVLTNDNELFGFGDNSCGQLGFGKFSKMENGRLVESLKGRDIQS--VGVGNYFSVICCDRGTLLTFGTAKNLGLGKDAK--DSAKPMLLEQLLRENIKDIYCGHDHVVAVLESGECLGWGSNQYGQLGL----------PTLEHFFAPTKIPMPSNKKIVYGKAGKDATMLLSDDGSLIAMGSNKHNKLNLTQRVGFFTKEKKTPNDYVNKPTILQGFPERVVDFSVGSYHSGVILESGQVMIFGRNDNTELGLG 682          

HSP 3 Score: 68.9366 bits (167), Expect = 7.870e-12
Identity = 70/254 (27.56%), Postives = 107/254 (42.13%), Query Frame = 1
Query:  334 VACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLG-DHSDEVIYKPTLL-SFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQV--SCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLG 1080
            VA  + HT++ T   +L+GFG N+ GQLG   K S     + + S    +I  +  G  FS    + G L  +G+     LGLG D  D    KP LL    +  +  + CG+ H  A+ + G    WG     +LG    E+   P  I +    K V    G + T+ LS++G +   G     +L L        F K  + PN  V          E+ ++ S G  H+ +    G  + FG   + +LG
Sbjct:  434 VALSKTHTMVLTNDNELFGFGDNSCGQLGF-GKFSKMENGRLVESLKGRDIQSVGVGNYFSVICCDRGTLLTFGTAK--NLGLGKDAKDSA--KPMLLEQLLRENIKDIYCGHDHVVAVLESGECLGWGSNQYGQLGLPTLEHFFAPTKIPMPSNKKIVYGKAGKDATMLLSDDGSLIAMGSNKHNKLNLTQRV--GFFTKEKKTPNDYVNKPTILQGFPERVVDFSVGSYHSGVILESGQVMIFGRNDNTELG 680          

HSP 4 Score: 60.4622 bits (145), Expect = 3.518e-9
Identity = 54/205 (26.34%), Postives = 92/205 (44.88%), Query Frame = 1
Query:  481 NICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFK-SPVSYVDCGNYHAA-AISQGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGP--HYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKL 1077
            +I Q+      +  +    +L+ +G NS  QLG G  S   +    L+   K   +  V  GNY +     +G L  +G   N  LG   +++ + P  +  L++  IK + CGH+H V + E+G+   WG    GQLGL    H+ +       +IP          + S +K +   AG+  T++ +  G  ++ G  +H KL
Sbjct:  430 SIKQVALSKTHTMVLTNDNELFGFGDNSCGQLGFGKFSK--MENGRLVESLKGRDIQSVGVGNYFSVICCDRGTLLTFGTAKNLGLGKDAKDS-AKPMLLEQLLRENIKDIYCGHDHVVAVLESGECLGWGSNQYGQLGLPTLEHFFAPT-----KIP----------MPSNKKIVYGKAGKDATMLLSDDGSLIAMGSNKHNKL 616          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Celegans
Match: nekl-1 (NEK (NEver in mitosis Kinase) Like [Source:UniProtKB/TrEMBL;Acc:A0A061AD48])

HSP 1 Score: 75.485 bits (184), Expect = 7.628e-14
Identity = 72/259 (27.80%), Postives = 110/259 (42.47%), Query Frame = 1
Query:  148 IKNDKIISLSCGDEFCVLITRSGR--AFGYGKNDWGQLGL-NDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDH----------SDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQST----PQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGD 870
            +K   I S+  G+ F V+    G    FG  KN    LGL  D K +  P  ++ L   N K I   CG  H +   ES +  G+G N  GQLGL   +     P +I       I   KAG + +  +++ G L   GSN   +L L              ++ + KPT+L  F   V     G+YH+  I + G++ ++G   N +LG    +  +     P   L+      V CG   T+  +   ++Y WG+ D
Sbjct:  516 LKGRDIQSVGVGNYFSVICCDRGTLLTFGTAKN----LGLGKDAKDSAKPMLLEQLLRENIKDIY--CGHDHVVAVLESGECLGWGSNQYGQLGL-PTLEHFFAPTKIPMPSNKKIVYGKAGKDATMLLSDDGSLIAMGSNKHNKLNLTQRVGFFTKEKKTPNDYVNKPTILQGFPERVVDFSVGSYHSGVILESGQVMIFGRNDNTELGLGNSQKMAVRCVKPVKSLLHHACTHVLCGDGFTLVSTTEQELYFWGRKD 767          

HSP 2 Score: 69.3218 bits (168), Expect = 5.917e-12
Identity = 69/255 (27.06%), Postives = 108/255 (42.35%), Query Frame = 1
Query:  196 VLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFF---KSP------VSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDS-----FQENQSTPQGILIKIPIKQ--------VSCGHNHTVCLSENGDVYVWGKGDSGQLGLG 891
            +++T     FG+G N  GQLG            +++LK  + ++  V  G   ++I  +   L  FG   +  LG D K   +++P  +   +  NI  +  G +   A+ E+G+   WGSN   QLGL          PTL  FF   K P      + Y   G      +S  G L   G   + KL  +     F + + TP   + K  I Q         S G  H+  + E+G V ++G+ D+ +LGLG
Sbjct:  480 MVLTNDNELFGFGDNSCGQLGFGKFSKMENGRLVESLKGRDIQS--VGVGNYFSVICCDRGTLLTFGTAKNLGLGKDAK--DSAKPMLLEQLLRENIKDIYCGHDHVVAVLESGECLGWGSNQYGQLGL----------PTLEHFFAPTKIPMPSNKKIVYGKAGKDATMLLSDDGSLIAMGSNKHNKLNLTQRVGFFTKEKKTPNDYVNKPTILQGFPERVVDFSVGSYHSGVILESGQVMIFGRNDNTELGLG 720          

HSP 3 Score: 68.9366 bits (167), Expect = 7.993e-12
Identity = 70/254 (27.56%), Postives = 107/254 (42.13%), Query Frame = 1
Query:  334 VACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLG-DHSDEVIYKPTLL-SFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQV--SCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLG 1080
            VA  + HT++ T   +L+GFG N+ GQLG   K S     + + S    +I  +  G  FS    + G L  +G+     LGLG D  D    KP LL    +  +  + CG+ H  A+ + G    WG     +LG    E+   P  I +    K V    G + T+ LS++G +   G     +L L        F K  + PN  V          E+ ++ S G  H+ +    G  + FG   + +LG
Sbjct:  472 VALSKTHTMVLTNDNELFGFGDNSCGQLGF-GKFSKMENGRLVESLKGRDIQSVGVGNYFSVICCDRGTLLTFGTAK--NLGLGKDAKDSA--KPMLLEQLLRENIKDIYCGHDHVVAVLESGECLGWGSNQYGQLGLPTLEHFFAPTKIPMPSNKKIVYGKAGKDATMLLSDDGSLIAMGSNKHNKLNLTQRV--GFFTKEKKTPNDYVNKPTILQGFPERVVDFSVGSYHSGVILESGQVMIFGRNDNTELG 718          

HSP 4 Score: 60.4622 bits (145), Expect = 3.442e-9
Identity = 54/205 (26.34%), Postives = 92/205 (44.88%), Query Frame = 1
Query:  481 NICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFK-SPVSYVDCGNYHAA-AISQGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGP--HYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKL 1077
            +I Q+      +  +    +L+ +G NS  QLG G  S   +    L+   K   +  V  GNY +     +G L  +G   N  LG   +++ + P  +  L++  IK + CGH+H V + E+G+   WG    GQLGL    H+ +       +IP          + S +K +   AG+  T++ +  G  ++ G  +H KL
Sbjct:  468 SIKQVALSKTHTMVLTNDNELFGFGDNSCGQLGFGKFSK--MENGRLVESLKGRDIQSVGVGNYFSVICCDRGTLLTFGTAKNLGLGKDAKDS-AKPMLLEQLLRENIKDIYCGHDHVVAVLESGECLGWGSNQYGQLGLPTLEHFFAPT-----KIP----------MPSNKKIVYGKAGKDATMLLSDDGSLIAMGSNKHNKL 654          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Fly
Match: Herc4 (gene:FBgn0035207 transcript:FBtr0072670)

HSP 1 Score: 124.405 bits (311), Expect = 3.915e-29
Identity = 96/351 (27.35%), Postives = 170/351 (48.43%), Query Frame = 1
Query:  115 IGGEELETKL------WIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSD--EVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTV-ITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLI 1131
            +GG E E  L      W  +  +  ++CG    + +T +G+ +  G ND+ QLG +D+ T   P  I  L++     I + CG  H++  ++  ++  +G N+ GQLG          PK +   +   + Q+  G   S A+   G+LY WGSN   QLG+   +D     Y   L +    P++ + CG  H+  IS+ G ++ WG     +LG + + N+S P  +  L  + ++ V+CG   +V L+  G V+  G G  GQLG G  + S+E      +P ++++  G ++        ++ G  HT+ +  ++G   +FG G  G+LG     R+  + M P+++
Sbjct:   20 LGGIEDEQILTPSQIPWTPDTAVQQVACGHRHTLFLTATGKVYACGSNDYSQLG-HDLPTK-RPLLIPELQDY--VIIQICCGSRHSLALSDWGQVLSWGDNDCGQLGHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYPTQLKTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHG--FSSNEM-----LPRMVMELMGSTIT------QVACGNRHTLALVPSRGRVYAFGLGSSGQLGT----RSTKSLMLPQVV 349          

HSP 2 Score: 122.479 bits (306), Expect = 1.672e-28
Identity = 100/337 (29.67%), Postives = 154/337 (45.70%), Query Frame = 1
Query:  223 FGYGKNDWGQLGLNDIK--TTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLG-----DSFQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNR 1209
            + +G    GQLGL  I+    LTPS I    +   +   VACG  HT+  T + K+Y  G N+  QLG D          E+  ++   IC    G   S A+++ G++  WG N   QLG     + V     +       V  + CGN H+ A++  G LY WG     +LG     D    N       L+ IP+  ++CG NH+  +S++G V+ WG+ + GQLGL      S   +L  +  L V+              ++ G+  +V  T +G   + G G +G+LG+ G +   SN M P+++  L     +  V CG  HT+ LV +R
Sbjct:    8 YCWGSTSHGQLGLGGIEDEQILTPSQIPWTPDTAVQQ--VACGHRHTLFLTATGKVYACGSNDYSQLGHDLPTKRPLLIPELQDYVIIQIC---CGSRHSLALSDWGQVLSWGDNDCGQLGHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYPTQLKTLRTLGVRF-------------VACGDEFSVFLTNEGGVFTCGAGAYGQLGH-GFS---SNEMLPRMVMELMGST-ITQVACGNRHTLALVPSR 321          

HSP 3 Score: 83.5741 bits (205), Expect = 2.853e-16
Identity = 64/225 (28.44%), Postives = 107/225 (47.56%), Query Frame = 1
Query:  538 KLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFK-SPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRN 1206
            +LY WGS S  QLGLG   DE I  P+ + +   + V  V CG+ H   ++  G++Y  G     +LG      +      L    I Q+ CG  H++ LS+ G V  WG  D GQLG   H    E  +L ++   LV         T+  + I+ G +H++  T+ G   S+G   +G+LG +    + ++  +P  +  L   + +  + CGG H+ ++ ++
Sbjct:    6 ELYCWGSTSHGQLGLGGIEDEQILTPSQIPWTPDTAVQQVACGHRHTLFLTATGKVYACGSNDYSQLGHDLPTKRPLLIPELQDYVIIQICCGSRHSLALSDWGQVLSWGDNDCGQLG---HATDKEIVQLPKVVRQLV---------TKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLG-VNSPNDLTHCNYPLRLTTL-LGIPLAAIACGGNHSFLISKS 216          

HSP 4 Score: 54.6842 bits (130), Expect = 2.449e-7
Identity = 41/144 (28.47%), Postives = 63/144 (43.75%), Query Frame = 1
Query:   79 IPETGALF-----NFGEIGGEELETKLWIKNDKIIS------LSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESK-KLYGFGCNNDGQLGLDDKISSTSEPKEITSWI 474
            I ++GA+F     N G++G  +   + +    K +       ++CGDEF V +T  G  F  G   +GQLG       + P  +  L  +      VACG  HT+    S+ ++Y FG  + GQLG     S       I  W+
Sbjct:  213 ISKSGAVFGWGRNNCGQLGLNDETNRSYPTQLKTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLPRMVMEL--MGSTITQVACGNRHTLALVPSRGRVYAFGLGSSGQLGTRSTKSLMLPQVVIGPWV 354          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Fly
Match: Herc4 (gene:FBgn0035207 transcript:FBtr0072671)

HSP 1 Score: 124.405 bits (311), Expect = 3.915e-29
Identity = 96/351 (27.35%), Postives = 170/351 (48.43%), Query Frame = 1
Query:  115 IGGEELETKL------WIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSD--EVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTV-ITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLI 1131
            +GG E E  L      W  +  +  ++CG    + +T +G+ +  G ND+ QLG +D+ T   P  I  L++     I + CG  H++  ++  ++  +G N+ GQLG          PK +   +   + Q+  G   S A+   G+LY WGSN   QLG+   +D     Y   L +    P++ + CG  H+  IS+ G ++ WG     +LG + + N+S P  +  L  + ++ V+CG   +V L+  G V+  G G  GQLG G  + S+E      +P ++++  G ++        ++ G  HT+ +  ++G   +FG G  G+LG     R+  + M P+++
Sbjct:   20 LGGIEDEQILTPSQIPWTPDTAVQQVACGHRHTLFLTATGKVYACGSNDYSQLG-HDLPTK-RPLLIPELQDY--VIIQICCGSRHSLALSDWGQVLSWGDNDCGQLGHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYPTQLKTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHG--FSSNEM-----LPRMVMELMGSTIT------QVACGNRHTLALVPSRGRVYAFGLGSSGQLGT----RSTKSLMLPQVV 349          

HSP 2 Score: 122.479 bits (306), Expect = 1.672e-28
Identity = 100/337 (29.67%), Postives = 154/337 (45.70%), Query Frame = 1
Query:  223 FGYGKNDWGQLGLNDIK--TTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLG-----DSFQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNR 1209
            + +G    GQLGL  I+    LTPS I    +   +   VACG  HT+  T + K+Y  G N+  QLG D          E+  ++   IC    G   S A+++ G++  WG N   QLG     + V     +       V  + CGN H+ A++  G LY WG     +LG     D    N       L+ IP+  ++CG NH+  +S++G V+ WG+ + GQLGL      S   +L  +  L V+              ++ G+  +V  T +G   + G G +G+LG+ G +   SN M P+++  L     +  V CG  HT+ LV +R
Sbjct:    8 YCWGSTSHGQLGLGGIEDEQILTPSQIPWTPDTAVQQ--VACGHRHTLFLTATGKVYACGSNDYSQLGHDLPTKRPLLIPELQDYVIIQIC---CGSRHSLALSDWGQVLSWGDNDCGQLGHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYPTQLKTLRTLGVRF-------------VACGDEFSVFLTNEGGVFTCGAGAYGQLGH-GFS---SNEMLPRMVMELMGST-ITQVACGNRHTLALVPSR 321          

HSP 3 Score: 83.5741 bits (205), Expect = 2.853e-16
Identity = 64/225 (28.44%), Postives = 107/225 (47.56%), Query Frame = 1
Query:  538 KLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFK-SPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRN 1206
            +LY WGS S  QLGLG   DE I  P+ + +   + V  V CG+ H   ++  G++Y  G     +LG      +      L    I Q+ CG  H++ LS+ G V  WG  D GQLG   H    E  +L ++   LV         T+  + I+ G +H++  T+ G   S+G   +G+LG +    + ++  +P  +  L   + +  + CGG H+ ++ ++
Sbjct:    6 ELYCWGSTSHGQLGLGGIEDEQILTPSQIPWTPDTAVQQVACGHRHTLFLTATGKVYACGSNDYSQLGHDLPTKRPLLIPELQDYVIIQICCGSRHSLALSDWGQVLSWGDNDCGQLG---HATDKEIVQLPKVVRQLV---------TKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLG-VNSPNDLTHCNYPLRLTTL-LGIPLAAIACGGNHSFLISKS 216          

HSP 4 Score: 54.6842 bits (130), Expect = 2.449e-7
Identity = 41/144 (28.47%), Postives = 63/144 (43.75%), Query Frame = 1
Query:   79 IPETGALF-----NFGEIGGEELETKLWIKNDKIIS------LSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESK-KLYGFGCNNDGQLGLDDKISSTSEPKEITSWI 474
            I ++GA+F     N G++G  +   + +    K +       ++CGDEF V +T  G  F  G   +GQLG       + P  +  L  +      VACG  HT+    S+ ++Y FG  + GQLG     S       I  W+
Sbjct:  213 ISKSGAVFGWGRNNCGQLGLNDETNRSYPTQLKTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLPRMVMEL--MGSTITQVACGNRHTLALVPSRGRVYAFGLGSSGQLGTRSTKSLMLPQVVIGPWV 354          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Fly
Match: Herc4 (gene:FBgn0035207 transcript:FBtr0310555)

HSP 1 Score: 123.25 bits (308), Expect = 1.049e-28
Identity = 94/354 (26.55%), Postives = 171/354 (48.31%), Query Frame = 1
Query:  115 IGGEELETKL------WIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLG--LNDIKTTLTPSCIKALKNLNEKAIL-VACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSD--EVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTV-ITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLI 1131
            +GG E E  L      W  +  +  ++CG    + +T +G+ +  G ND+ QLG  L   +  ++P  +  +  L +  I+ + CG  H++  ++  ++  +G N+ GQLG          PK +   +   + Q+  G   S A+   G+LY WGSN   QLG+   +D     Y   L +    P++ + CG  H+  IS+ G ++ WG     +LG + + N+S P  +  L  + ++ V+CG   +V L+  G V+  G G  GQLG G  + S+E      +P ++++  G ++        ++ G  HT+ +  ++G   +FG G  G+LG     R+  + M P+++
Sbjct:   20 LGGIEDEQILTPSQIPWTPDTAVQQVACGHRHTLFLTATGKVYACGSNDYSQLGHDLPTKRPRMSPFLL--IPELQDYVIIQICCGSRHSLALSDWGQVLSWGDNDCGQLGHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYPTQLKTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHG--FSSNEM-----LPRMVMELMGSTIT------QVACGNRHTLALVPSRGRVYAFGLGSSGQLGT----RSTKSLMLPQVV 354          

HSP 2 Score: 120.939 bits (302), Expect = 5.385e-28
Identity = 101/342 (29.53%), Postives = 157/342 (45.91%), Query Frame = 1
Query:  223 FGYGKNDWGQLGLNDIK--TTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLD-----DKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLG-----DSFQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNR 1209
            + +G    GQLGL  I+    LTPS I    +   +   VACG  HT+  T + K+Y  G N+  QLG D      ++S      E+  ++   IC    G   S A+++ G++  WG N   QLG     + V     +       V  + CGN H+ A++  G LY WG     +LG     D    N       L+ IP+  ++CG NH+  +S++G V+ WG+ + GQLGL      S   +L  +  L V+              ++ G+  +V  T +G   + G G +G+LG+ G +   SN M P+++  L     +  V CG  HT+ LV +R
Sbjct:    8 YCWGSTSHGQLGLGGIEDEQILTPSQIPWTPDTAVQQ--VACGHRHTLFLTATGKVYACGSNDYSQLGHDLPTKRPRMSPFLLIPELQDYVIIQIC---CGSRHSLALSDWGQVLSWGDNDCGQLGHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYPTQLKTLRTLGVRF-------------VACGDEFSVFLTNEGGVFTCGAGAYGQLGH-GFS---SNEMLPRMVMELMGST-ITQVACGNRHTLALVPSR 326          

HSP 3 Score: 83.1889 bits (204), Expect = 3.486e-16
Identity = 66/231 (28.57%), Postives = 110/231 (47.62%), Query Frame = 1
Query:  538 KLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFK-SPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGILIKIP------IKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRN 1206
            +LY WGS S  QLGLG   DE I  P+ + +   + V  V CG+ H   ++  G++Y  G     +LG      +      L+ IP      I Q+ CG  H++ LS+ G V  WG  D GQLG   H    E  +L ++   LV         T+  + I+ G +H++  T+ G   S+G   +G+LG +    + ++  +P  +  L   + +  + CGG H+ ++ ++
Sbjct:    6 ELYCWGSTSHGQLGLGGIEDEQILTPSQIPWTPDTAVQQVACGHRHTLFLTATGKVYACGSNDYSQLGHDLPTKRPRMSPFLL-IPELQDYVIIQICCGSRHSLALSDWGQVLSWGDNDCGQLG---HATDKEIVQLPKVVRQLV---------TKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLG-VNSPNDLTHCNYPLRLTTL-LGIPLAAIACGGNHSFLISKS 221          

HSP 4 Score: 54.6842 bits (130), Expect = 2.369e-7
Identity = 41/144 (28.47%), Postives = 63/144 (43.75%), Query Frame = 1
Query:   79 IPETGALF-----NFGEIGGEELETKLWIKNDKIIS------LSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESK-KLYGFGCNNDGQLGLDDKISSTSEPKEITSWI 474
            I ++GA+F     N G++G  +   + +    K +       ++CGDEF V +T  G  F  G   +GQLG       + P  +  L  +      VACG  HT+    S+ ++Y FG  + GQLG     S       I  W+
Sbjct:  218 ISKSGAVFGWGRNNCGQLGLNDETNRSYPTQLKTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLPRMVMEL--MGSTITQVACGNRHTLALVPSRGRVYAFGLGSSGQLGTRSTKSLMLPQVVIGPWV 359          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Fly
Match: HERC2 (gene:FBgn0031107 transcript:FBtr0301344)

HSP 1 Score: 122.865 bits (307), Expect = 1.743e-28
Identity = 94/348 (27.01%), Postives = 163/348 (46.84%), Query Frame = 1
Query:  166 ISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSP-VSYVDCGNYHAAAIS---QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTV 1191
            I ++ G +   ++++ G+ +  G+   G+LGL        P  +  L+    K + V  G  H +  T   K++ +G   DG+LG  ++ ++  +P+ + +     I  +  G   SAAI+  G+LY WG     +LG GD++ ++  KP L++      V  V CG+  A  ++    G ++ WG+    KLG    E   TP  I  L  I + Q+ CG   ++ L+  G+V+ WGKGD  +LG G         + +R P  +    G       + I+++ G  H +  T  G   ++GD  HG+ G+      + N   P L+  LD  ++V  V CG  H++
Sbjct: 3022 IHIAGGSKSLFIVSQDGKVYACGEGTNGRLGLGVTHNVPLPHQLPVLRQYVVKKVAVHSGGKHALALTLDGKVFSWGEGEDGKLGHGNR-TTLDKPRLVEALRAKKIRDVACGSSHSAAISSQGELYTWGLGEYGRLGHGDNTTQL--KPKLVTALAGRRVVQVACGSRDAQTLALTEDGAVFSWGDGDFGKLGRGGSEGSDTPHEIERLSGIGVVQIECGAQFSLALTRAGEVWTWGKGDYYRLGHGGD-------QHVRKPQPIGGLRG------RRVIHVAVGALHCLAVTDAGQVYAWGDNDHGQQGS---GNTFVNKK-PALVIGLDA-VFVNRVACGSSHSI 3348          

HSP 2 Score: 107.071 bits (266), Expect = 1.983e-23
Identity = 94/359 (26.18%), Postives = 163/359 (45.40%), Query Frame = 1
Query:  166 ISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLL-SFFKSPVSYVDCGNYHAAAI---SQGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNRESHEL 1224
            + L+ G++    +T  G+ F  G    G+LG+    +   P+ + +L+++  K + V  G  H +  T   ++Y +G   DG+LG  +++S    PK +      ++  +  G   SAAI  +G +  WG     +LG GD  D++  +P L+ +        + CG+  A  +       ++ WG+    KLG    +    P  I  L  + + +V CG   +V L+++G VY WGKGD  +LG G           +R P  +    G      +K I+I+ G  H V  +  G   ++GD   G+LG+       +    P+L+A L +   +  V CG  HT+ L  ++ S  L
Sbjct: 4085 VQLAGGEQSLFAVTPDGKLFATGYGSGGRLGVGGSDSWAIPTLLGSLQHVFVKKVAVNSGGKHCLALTTEGEVYAWGEGEDGKLGHGNRMS-YDRPKLVEHLNGMSVADIACGSAHSAAITASGHVLTWGKGRYGRLGHGDSEDQL--RPKLVEALLGYRAIDIACGSGDAQTLCITDDDNVWSWGDGDYGKLGRGGSDGCKLPYKIESLAGLGVVKVECGSQFSVALTKSGAVYTWGKGDFHRLGHGS-------VDHVRRPKKVAALQG------KKIISIATGSLHCVACSDSGEVYTWGDNDEGQLGD----GTVTAIQRPRLVAAL-QGKHIVKVTCGSAHTLALSTSQLSERL 4422          

HSP 3 Score: 90.8929 bits (224), Expect = 2.098e-18
Identity = 65/229 (28.38%), Postives = 108/229 (47.16%), Query Frame = 1
Query:  163 IISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGR--CHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLS 834
            +  ++CG      IT SG    +GK  +G+LG  D +  L P  ++AL  L  +AI +ACG     T+  T+   ++ +G  + G+LG          P +I S     + +++ G +FS A+ ++G +Y WG    ++LG G   D V     + +     +  +  G+ H  A S  G +Y WG+    +LGD        P+ +  L    I +V+CG  HT+ LS
Sbjct: 4190 VADIACGSAHSAAITASGHVLTWGKGRYGRLGHGDSEDQLRPKLVEAL--LGYRAIDIACGSGDAQTLCITDDDNVWSWGDGDYGKLGRGGS-DGCKLPYKIESLAGLGVVKVECGSQFSVALTKSGAVYTWGKGDFHRLGHGS-VDHVRRPKKVAALQGKKIISIATGSLHCVACSDSGEVYTWGDNDEGQLGDGTVTAIQRPRLVAALQGKHIVKVTCGSAHTLALS 4414          

HSP 4 Score: 85.1149 bits (209), Expect = 1.499e-16
Identity = 72/246 (29.27%), Postives = 119/246 (48.37%), Query Frame = 1
Query:  499 AGGEFSAAI-NETGKLYVWGSNSEYQLGLG-DHSDEVIYK-PTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAG--ESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNRE 1212
            AGG  S  I ++ GK+Y  G  +  +LGLG  H+  + ++ P L  +    V+ V  G  HA A++  G+++ WGE  + KLG   +     P+ +  L    I+ V+CG +H+  +S  G++Y WG G+ G+LG G +    +       P L+   +G       + + ++ G  ++ T+  T  G   S+GDG  GKLG  GG+        P  I  L   + V  ++CG   ++ L R  E
Sbjct: 3025 AGGSKSLFIVSQDGKVYACGEGTNGRLGLGVTHNVPLPHQLPVLRQYVVKKVA-VHSGGKHALALTLDGKVFSWGEGEDGKLGHGNRTTLDKPRLVEALRAKKIRDVACGSSHSAAISSQGELYTWGLGEYGRLGHGDNTTQLK-------PKLVTALAG------RRVVQVACGSRDAQTLALTEDGAVFSWGDGDFGKLGR-GGSEGSDT---PHEIERL-SGIGVVQIECGAQFSLALTRAGE 3251          

HSP 5 Score: 83.9593 bits (206), Expect = 2.952e-16
Identity = 90/291 (30.93%), Postives = 134/291 (46.05%), Query Frame = 1
Query:  364 WTESKKLYGFGCNNDGQL-GLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLS----FFKSPVSYVDCGNYHAAAISQGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSE---FPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRN 1206
            W  +  +YG+G N+ GQL GL+     T  P E  S +     QL  G +   A+   GKL+  G  S  +LG+G      I  PTLL      F   V+    G +  A  ++G +Y WGE  + KLG   + +   P+ +  L  + +  ++CG  H+  ++ +G V  WGKG  G+LG G     SE    PKL  +  LL   + D        I   +G++ T+  T      S+GDG +GKLG  GG+        P  I +L   L V  V+CG   +V L ++
Sbjct: 4045 WGGASTIYGWGHNHRGQLGGLEGSRIKTPTPCEALSLL--RPVQLAGGEQSLFAVTPDGKLFATGYGSGGRLGVGGSDSWAI--PTLLGSLQHVFVKKVAVNSGGKHCLALTTEGEVYAWGEGEDGKLGHGNRMSYDRPKLVEHLNGMSVADIACGSAHSAAITASGHVLTWGKGRYGRLGHG----DSEDQLRPKL--VEALLGYRAID--------IACGSGDAQTLCITDDDNVWSWGDGDYGKLGR-GGS---DGCKLPYKIESL-AGLGVVKVECGSQFSVALTKS 4312          

HSP 6 Score: 61.6178 bits (148), Expect = 2.373e-9
Identity = 45/166 (27.11%), Postives = 81/166 (48.80%), Query Frame = 1
Query:  658 CGNYHAAAI-SQGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDK 1146
            C   H  AI S    Y WG   + +LG      ++ P  I  L +  ++ V CG +++  ++  G++  WG+G   +LG G     S       +P L+V  S   +      + + +G++H++  T++GL  ++GDG +GKLGN     N +  + P L+ +L +
Sbjct:  623 CEGRHFLAIDSNHNAYSWGTGEDHRLGHGDTHARAVPTKIAALEQHCVQSVYCGCSYSAAITCGGNLLTWGRGTYARLGHGNSDDRS-------LPTLVVALSDHMVVD----VALGSGDAHSLALTSEGLVFAWGDGDYGKLGN----GNCNGSLQPILVESLPR 773          

HSP 7 Score: 60.077 bits (144), Expect = 6.103e-9
Identity = 66/272 (24.26%), Postives = 117/272 (43.01%), Query Frame = 1
Query:  148 IKNDKIISLS--CGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQGRLYVWGEYT--NQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLL 945
            + +D  IS++  C     + I  +  A+ +G  +  +LG  D      P+ I AL+    +++   C     I    +   +G G       G  D  S  +    ++  +  ++  L +G   S A+   G ++ WG     +LG G+ +  +  +P L+              +  A  S+G+LY WG+ T    +L +   +  S P+ +  L    I  V+    H + LS +G+V+ WG+ DS Q  + P  +SSE   LLR P L+
Sbjct:  611 VAHDVFISIAGHCEGRHFLAIDSNHNAYSWGTGEDHRLGHGDTHARAVPTKIAALEQHCVQSVYCGCSYSAAITCGGNLLTWGRGTYARLGHGNSDDRSLPTLVVALSDHMVVDVA-LGSGDAHSLALTSEGLVFAWGDGDYGKLGNGNCNGSL--QPILVESLPRVQRVFAGSQFSVALSSEGQLYTWGKATCLGHQLVERSVQGCSVPRLVSSLQHKRIVDVAVSVAHCLALSSSGEVFGWGRNDSQQ--ICPASVSSE--PLLRTPILV 875          

HSP 8 Score: 52.373 bits (124), Expect = 1.613e-6
Identity = 36/125 (28.80%), Postives = 64/125 (51.20%), Query Frame = 1
Query:   79 IPETGALF-----NFGEIG---GEELETKLWIKNDK---IISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLG 420
            + E GA+F     +FG++G    E  +T   I+      ++ + CG +F + +TR+G  + +GK D+ +LG    +    P  I  L+    + I VA G  H +  T++ ++Y +G N+ GQ G
Sbjct: 3194 LTEDGAVFSWGDGDFGKLGRGGSEGSDTPHEIERLSGIGVVQIECGAQFSLALTRAGEVWTWGKGDYYRLGHGGDQHVRKPQPIGGLR--GRRVIHVAVGALHCLAVTDAGQVYAWGDNDHGQQG 3316          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Fly
Match: niki (gene:FBgn0045980 transcript:FBtr0084737)

HSP 1 Score: 92.8189 bits (229), Expect = 3.212e-19
Identity = 77/261 (29.50%), Postives = 130/261 (49.81%), Query Frame = 1
Query:  163 IISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKT-TLTPSCIKALKNLNEKAILVAC-GRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIY-KPTLLSFFKSPVSYVDCG-NYHAAAISQGRLYVWGEYTNQKLGDSFQENQSTPQGILIKIP--IKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLL 927
            I+ ++  D   V++   G A+ +G+   GQLGL  ++     PS +++++N +   ++ AC G   TI+ T++  L   G N    LG D++ +  S PK I       + Q+ AG +   A++  G +YVWG+++   LGLG++  +  + +  LLS  K+  S + CG +  A   + G L+V G     KLG  FQ +        +++P  + Q      H+V L E G VY  G+   GQ G+  H  S + P L+
Sbjct:  454 IVDVAMSDSHFVVVNEDGSAYAWGEGTHGQLGLTALEAWKHYPSRMESVRNYH---VVSACAGDGFTILVTQAGSLLSCGSNAHLALGQDEQRNYHS-PKLIARLADVRVEQVAAGLQHVLALSREGAVYVWGTSTCGALGLGNYQQQQKFPQKILLSHVKTKPSKIYCGPDTSAVLFANGELHVCGSNDYNKLG--FQRSAKITAFKKVQLPHKVTQACFSSTHSVFLVEGGYVYTMGRNAEGQRGIR-HCNSVDHPTLV 707          

HSP 2 Score: 65.855 bits (159), Expect = 9.355e-11
Identity = 46/150 (30.67%), Postives = 67/150 (44.67%), Query Frame = 1
Query:  517 AAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGS 957
              +NE G  Y WG  +  QLGL        Y   + S     V     G+     ++Q G L   G   +  LG   Q N  +P+ I  L  + ++QV+ G  H + LS  G VYVWG    G LGLG +    +FP+ + + ++  K S
Sbjct:  465 VVVNEDGSAYAWGEGTHGQLGLTALEAWKHYPSRMESVRNYHVVSACAGDGFTILVTQAGSLLSCGSNAHLALGQDEQRNYHSPKLIARLADVRVEQVAAGLQHVLALSREGAVYVWGTSTCGALGLGNYQQQQKFPQKILLSHVKTKPS 614          

HSP 3 Score: 60.4622 bits (145), Expect = 4.508e-9
Identity = 60/253 (23.72%), Postives = 109/253 (43.08%), Query Frame = 1
Query:  148 IKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEI-TSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQGRLYVWGEYTNQKLGDSFQENQSTPQGILIKIP----IKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLG 891
            ++N  ++S   GD F +L+T++G     G N    LG ++ +   +P  I  L ++  +   VA G  H +  +    +Y +G +  G LGL +       P++I  S +     ++  G + SA +   G+L+V GSN   +LG    +    +K   L      V+     + H+  + +G  YV+    N +     +   S     L+       I + +C    T+  SE+  + VWG  + G  G+G
Sbjct:  502 VRNYHVVSACAGDGFTILVTQAGSLLSCGSNAHLALGQDEQRNYHSPKLIARLADVRVEQ--VAAGLQHVLALSREGAVYVWGTSTCGALGLGNYQQQQKFPQKILLSHVKTKPSKIYCGPDTSAVLFANGELHVCGSNDYNKLGFQRSAKITAFKKVQL---PHKVTQACFSSTHSVFLVEGG-YVYTMGRNAEGQRGIRHCNSVDHPTLVDSVKSRYIVKANCSDQCTIVASEDNIITVWGTRN-GLPGIG 747          

HSP 4 Score: 58.151 bits (139), Expect = 2.263e-8
Identity = 45/143 (31.47%), Postives = 61/143 (42.66%), Query Frame = 1
Query:  781 KIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKF--INISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVR 1203
            K  I  V+   +H V ++E+G  Y WG+G  GQLGL        +P                +ES   +  ++  AG+  T++ T  G  LS G   H  LG         NY  PKLIA L  D+ V  V  G  H + L R
Sbjct:  451 KAVIVDVAMSDSHFVVVNEDGSAYAWGEGTHGQLGLTALEAWKHYP--------------SRMESVRNYHVVSACAGDGFTILVTQAGSLLSCGSNAHLALGQ----DEQRNYHSPKLIARL-ADVRVEQVAAGLQHVLALSR 574          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Zebrafish
Match: rpgrb (retinitis pigmentosa GTPase regulator b [Source:ZFIN;Acc:ZDB-GENE-081015-2])

HSP 1 Score: 263.462 bits (672), Expect = 3.745e-78
Identity = 162/386 (41.97%), Postives = 219/386 (56.74%), Query Frame = 1
Query:   70 ENYIPETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQE--NQSTPQGILIKIP--IKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNR 1209
            E+ IPE+GA+F FG+    +   +K W+KND  + +SCGDE   L+T +G+ F +G N+WGQLGL    T   P+C+KALK  +E+  L ACGR HT+++T    LY  G NN+GQLGL D    TS          G I  L AG   SAA+ + G+LY+WG NSE Q+GLG  S+ +   P  +S  K  V +V CG YH+A ++  G LY +GE  + KLG S ++  N   PQ +   IP  + QV+CG  HTV L+EN +VY +G G  GQLG G     S  P   R+     KG         +  + + GE+HT + T  GL  +FGDGRHGKLG   G  N++N   P L      D  V++V CGGCH +VL + R
Sbjct:    6 EDEIPESGAVFTFGKSKFADNAPSKFWLKNDVPLRISCGDEHTALVTENGKLFMFGSNNWGQLGLGTKTTVNKPTCVKALK--SERVKLTACGRTHTLVFTSRGNLYACGGNNEGQLGLGDCNDRTSFHLVEFFNKQGPIKMLAAGSNTSAALTQDGRLYMWGDNSEGQIGLGKESNALT--PQEVSVGKR-VFWVSCGYYHSAFVTVDGALYTFGEKDSGKLGLSTEKLANHKVPQQV-TDIPDRVVQVACGGGHTVALTEN-EVYSFGLGQFGQLGHGTFIFESRLP---RVVEHFRKG---------RVKHAACGENHTALITDNGLLYTFGDGRHGKLGL--GEENFTNQFKPTLCPRF-LDYHVHSVTCGGCHMLVLAKPR 369          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Zebrafish
Match: rpgrb (retinitis pigmentosa GTPase regulator b [Source:ZFIN;Acc:ZDB-GENE-081015-2])

HSP 1 Score: 267.314 bits (682), Expect = 1.569e-76
Identity = 162/388 (41.75%), Postives = 221/388 (56.96%), Query Frame = 1
Query:   70 ENYIPETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWI--YGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQE--NQSTPQGILIKIP--IKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNR 1209
            E+ IPE+GA+F FG+    +   +K W+KND  + +SCGDE   L+T +G+ F +G N+WGQLGL    T   P+C+KALK  +E+  L ACGR HT+++T    LY  G NN+GQLGL D    TS    +  +    G I  L AG   SAA+ + G+LY+WG NSE Q+GLG  S+ +   P  +S  K  V +V CG YH+A ++  G LY +GE  + KLG S ++  N   PQ +   IP  + QV+CG  HTV L+EN +VY +G G  GQLG G     S  P   R+     KG         +  + + GE+HT + T  GL  +FGDGRHGKLG   G  N++N   P L      D  V++V CGGCH +VL + R
Sbjct:    6 EDEIPESGAVFTFGKSKFADNAPSKFWLKNDVPLRISCGDEHTALVTENGKLFMFGSNNWGQLGLGTKTTVNKPTCVKALK--SERVKLTACGRTHTLVFTSRGNLYACGGNNEGQLGLGDCNDRTS--FHLVEFFNKQGPIKMLAAGSNTSAALTQDGRLYMWGDNSEGQIGLGKESNALT--PQEVSVGKR-VFWVSCGYYHSAFVTVDGALYTFGEKDSGKLGLSTEKLANHKVPQQV-TDIPDRVVQVACGGGHTVALTEN-EVYSFGLGQFGQLGHGTFIFESRLP---RVVEHFRKG---------RVKHAACGENHTALITDNGLLYTFGDGRHGKLGL--GEENFTNQFKPTLCPRF-LDYHVHSVTCGGCHMLVLAKPR 369          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Zebrafish
Match: rpgra (retinitis pigmentosa GTPase regulator a [Source:ZFIN;Acc:ZDB-GENE-070912-423])

HSP 1 Score: 222.246 bits (565), Expect = 4.681e-61
Identity = 141/389 (36.25%), Postives = 210/389 (53.98%), Query Frame = 1
Query:   61 LIDENYIPETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLT-PSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQE--NQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNRE 1212
            +  E  IP+TGA+F FG+      + ++LW+K+D  + +SCG      +T  GR F +G N+ GQLGL  IK  +T P C+K LK   E+A  VACG  HT++ T   ++   G N+DGQLGL     S S  +      Y  I  L AG   SAA+ E G+L++WG NS  QLG G+ S  ++  P  L+  +S + +V CG  H+A ++  G +Y +GE  + +LG S  +  N S PQ +     + QV+CG  HT+ L+E+ ++Y +G G+ GQLGLG     ++ P  +       KG         +  +++ GE H+ + T  GL  +FGDGRHGKLG+  G  N++N   P +      +  V  V CG  H +V  R R+
Sbjct:    1 MTGETEIPDTGAVFTFGKSKIANNVPSRLWLKSDIPVHISCGQSHSAFVTEQGRLFVFGDNNRGQLGLQ-IKGPVTKPVCVKVLK--GERAQSVACGTDHTLVSTSQGEILAAGGNSDGQLGLGHCNDSISFQRLRPFCDYAPIKLLSAGDHTSAALTEDGRLFLWGDNSAGQLGFGNDSHALL--PKELNMGQS-IHWVSCGYRHSALVTDSGDVYSFGESADGRLGLSAHQLANHSYPQRVESLHSVLQVACGGKHTLALTED-ELYCFGGGEFGQLGLGTLVFVADSPVAV---GHFRKG---------RVTHVTCGEQHSALITDSGLLYTFGDGRHGKLGH--GDENFTNQFTPTVCQRF-FEYSVMTVACGSSHMLVFARPRQ 367          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Zebrafish
Match: rpgra (retinitis pigmentosa GTPase regulator a [Source:ZFIN;Acc:ZDB-GENE-070912-423])

HSP 1 Score: 214.927 bits (546), Expect = 1.086e-58
Identity = 138/381 (36.22%), Postives = 206/381 (54.07%), Query Frame = 1
Query:   85 ETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLT-PSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQE--NQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNRE 1212
            +TGA+F FG+      + ++LW+K+D  + +SCG      +T  GR F +G N+ GQLGL  IK  +T P C+K LK   E+A  VACG  HT++ T   ++   G N+DGQLGL     S S  +      Y  I  L AG   SAA+ E G+L++WG NS  QLG G+ S  ++  P  L+  +S + +V CG  H+A ++  G +Y +GE  + +LG S  +  N S PQ +     + QV+CG  HT+ L+E+ ++Y +G G+ GQLGLG     ++ P  +       KG         +  +++ GE H+ + T  GL  +FGDGRHGKLG+  G  N++N   P +      +  V  V CG  H +V  R R+
Sbjct:    2 DTGAVFTFGKSKIANNVPSRLWLKSDIPVHISCGQSHSAFVTEQGRLFVFGDNNRGQLGLQ-IKGPVTKPVCVKVLK--GERAQSVACGTDHTLVSTSQGEILAAGGNSDGQLGLGHCNDSISFQRLRPFCDYAPIKLLSAGDHTSAALTEDGRLFLWGDNSAGQLGFGNDSHALL--PKELNMGQS-IHWVSCGYRHSALVTDSGDVYSFGESADGRLGLSAHQLANHSYPQRVESLHSVLQVACGGKHTLALTED-ELYCFGGGEFGQLGLGTLVFVADSPVAV---GHFRKG---------RVTHVTCGEQHSALITDSGLLYTFGDGRHGKLGH--GDENFTNQFTPTVCQRF-FEYSVMTVACGSSHMLVFARPRQ 360          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Zebrafish
Match: herc3 (HECT and RLD domain containing E3 ubiquitin protein ligase 3 [Source:ZFIN;Acc:ZDB-GENE-090313-139])

HSP 1 Score: 133.265 bits (334), Expect = 7.692e-32
Identity = 87/264 (32.95%), Postives = 134/264 (50.76%), Query Frame = 1
Query:  118 GGEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTL-TPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKS-PVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVC-LSENGDVYVWGKGDSGQLGLG 891
            GG   E    +   KI  +SCG    + +   G+ F +G  D GQLGL   +  +  P  IK L     +   V CG  H I  ++  +L+ +G N+ GQLGL     ST  P+ + S     + Q+ AGG+ S A++ +G ++ WG NS  QLGL D  D  +  P  + F +S  V Y+ CG  H AA++ +G L+ +G  +  +LG     N+  P+ +  L+   + Q++CG NHT+  +   G +Y +G    GQLG G
Sbjct:   71 GGSRPELVGALDAQKISGVSCGQAHSLAVNEQGQVFAWGAGDGGQLGLGTAEEAVRVPRLIKKL--CEHRISQVMCGNHHCIALSKDGQLFVWGENSSGQLGLGKGEPSTLSPQPLKSLCGIPLTQISAGGDHSFALSFSGAVFGWGKNSAGQLGLNDEQDRAV--PCHIKFLRSQKVVYISCGEEHTAALTKEGGLFTFGNGSKGQLGHDSTRNEPLPRRVMELMGTEVSQIACGRNHTLAFVPSTGLIYAFGCNTQGQLGTG 330          

HSP 2 Score: 131.724 bits (330), Expect = 2.540e-31
Identity = 106/335 (31.64%), Postives = 164/335 (48.96%), Query Frame = 1
Query:  229 YGKNDWGQLGLNDIKTTL---TPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLS-FFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQS-TPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFP---KLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLV 1200
            +G +  GQLG+   + ++      C+   + L E    VACG  H++       +Y  G N+ GQLG D      S P+ + +     I  +  G   S A+NE G+++ WG+    QLGLG  ++E +  P L+    +  +S V CGN+H  A+S+ G+L+VWGE ++ +LG    E  + +PQ +  L  IP+ Q+S G +H+  LS +G V+ WGK  +GQLGL         P   K LR               ++K + IS GE HT   T +G   +FG+G  G+LG+     +  N   P+ +  L     V  + CG  HT+  V
Sbjct:    5 WGSSGAGQLGIGASEASVFEPRSCCVFDGRGLKE----VACGNQHSLFLLHDGSVYTCGSNSCGQLGHD---KGGSRPELVGALDAQKISGVSCGQAHSLAVNEQGQVFAWGAGDGGQLGLGT-AEEAVRVPRLIKKLCEHRISQVMCGNHHCIALSKDGQLFVWGENSSGQLGLGKGEPSTLSPQPLKSLCGIPLTQISAGGDHSFALSFSGAVFGWGKNSAGQLGLNDEQ-DRAVPCHIKFLR---------------SQKVVYISCGEEHTAALTKEGGLFTFGNGSKGQLGH----DSTRNEPLPRRVMEL-MGTEVSQIACGRNHTLAFV 310          

HSP 3 Score: 119.783 bits (299), Expect = 1.593e-27
Identity = 88/307 (28.66%), Postives = 149/307 (48.53%), Query Frame = 1
Query:  172 LSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTV-ITTTKGLALSFGDGRHGKLG 1080
            ++CG++  + +   G  +  G N  GQLG +  K    P  + AL    +K   V+CG+ H++   E  +++ +G  + GQLGL     +   P+ I       I Q+  G     A+++ G+L+VWG NS  QLGLG      +    L S    P++ +  G  H+ A+S  G ++ WG+ +  +LG + +++++ P  I  L    +  +SCG  HT  L++ G ++ +G G  GQLG   H  +   P   R+  L+  G+  S         I+ G +HT+    + GL  +FG    G+LG
Sbjct:   39 VACGNQHSLFLLHDGSVYTCGSNSCGQLGHD--KGGSRPELVGALDA--QKISGVSCGQAHSLAVNEQGQVFAWGAGDGGQLGLGTAEEAVRVPRLIKKLCEHRISQVMCGNHHCIALSKDGQLFVWGENSSGQLGLGKGEPSTLSPQPLKSLCGIPLTQISAGGDHSFALSFSGAVFGWGKNSAGQLGLNDEQDRAVPCHIKFLRSQKVVYISCGEEHTAALTKEGGLFTFGNGSKGQLG---HDSTRNEPLPRRVMELM--GTEVS--------QIACGRNHTLAFVPSTGLIYAFGCNTQGQLG 328          

HSP 4 Score: 84.3445 bits (207), Expect = 2.491e-16
Identity = 59/205 (28.78%), Postives = 107/205 (52.20%), Query Frame = 1
Query:  160 KIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIK-TTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAI--SQGRLYVWGEYTNQKLGDSFQENQSTP 765
            +I  + CG+  C+ +++ G+ F +G+N  GQLGL   + +TL+P  +K+L  +    I  + G  H+   + S  ++G+G N+ GQLGL+D+    + P  I       +  +  G E +AA+ + G L+ +G+ S+ QLG     +E + +  ++    + VS + CG  H  A   S G +Y +G  T  +LG   + +  +P
Sbjct:  138 RISQVMCGNHHCIALSKDGQLFVWGENSSGQLGLGKGEPSTLSPQPLKSLCGIPLTQI--SAGGDHSFALSFSGAVFGWGKNSAGQLGLNDE-QDRAVPCHIKFLRSQKVVYISCGEEHTAALTKEGGLFTFGNGSKGQLGHDSTRNEPLPR-RVMELMGTEVSQIACGRNHTLAFVPSTGLIYAFGCNTQGQLGTGIRGSAKSP 338          

HSP 5 Score: 63.929 bits (154), Expect = 5.012e-10
Identity = 33/102 (32.35%), Postives = 56/102 (54.90%), Query Frame = 1
Query:  145 WIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKL-YGFGCNNDGQLGLDDKISSTS 447
            ++++ K++ +SCG+E    +T+ G  F +G    GQLG +  +    P   + ++ +  +   +ACGR HT+ +  S  L Y FGCN  GQLG   + S+ S
Sbjct:  238 FLRSQKVVYISCGEEHTAALTKEGGLFTFGNGSKGQLGHDSTRNEPLPR--RVMELMGTEVSQIACGRNHTLAFVPSTGLIYAFGCNTQGQLGTGIRGSAKS 337          

HSP 6 Score: 52.373 bits (124), Expect = 1.987e-6
Identity = 40/139 (28.78%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  790 IKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRN 1206
            +K+V+CG+ H++ L  +G VY  G    GQLG   H      P+L+        G+ D+    +K   +S G++H++    +G   ++G G  G+LG +G A        P+LI  L +   +  V CG  H + L ++
Sbjct:   36 LKEVACGNQHSLFLLHDGSVYTCGSNSCGQLG---HDKGGSRPELV--------GALDA----QKISGVSCGQAHSLAVNEQGQVFAWGAGDGGQLG-LGTAEEAVRV--PRLIKKLCEH-RISQVMCGNHHCIALSKD 155          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Xenopus
Match: ENSXETT00000039322.1 (HECT and RLD domain containing E3 ubiquitin protein ligase 3 [Source:NCBI gene;Acc:100488790])

HSP 1 Score: 123.635 bits (309), Expect = 1.044e-28
Identity = 106/336 (31.55%), Postives = 168/336 (50.00%), Query Frame = 1
Query:  229 YGKNDWGQLG-LNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLG--DHSDEVIYKPTLLSFF-KSPVSYVDCGNYHAAAI-SQGRLYVWGEYTNQKLG--DSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFP---KLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLV 1200
            +G + +GQLG  +  + +++  C+    +L      VACG  HT+   E  ++Y  G N +GQLG D +    ++P ++T+    +I  +  G   + A++  G+LY WGS ++ QLG    +HS  +   P ++    +  +  V CGN H  A+   G+L+ WG+  + +LG  + F  +QS+PQ +  L  IP+ QV+ G +H+  LS +G V+ WG   +GQLGL    +  E P   K LR               T K I IS GE HT I T  G   +FG G  G+LG+     + +N + P+ +  L     V  + CG  HT+  V
Sbjct:    4 WGHSTFGQLGNGHSFQGSVSDPCVCRF-SLAACVKEVACGGKHTLFLLEDGQVYSCGWNGEGQLGHDHE---GTDPVQVTTLTEEHITHIACGQSHNLALSYQGQLYSWGSGNDGQLGHATVEHSSRI---PRIIKKLNQQKIQQVSCGNDHCMALGDDGQLFTWGQNLHGQLGLGNGFL-SQSSPQRVKSLEGIPLAQVTAGGSHSFALSLSGAVFGWGNNSAGQLGLNDEKVR-ETPCHVKPLR---------------THKVIYISCGEEHTAILTKAGGLFTFGAGGSGQLGH----DSLNNEINPRRVLELMGS-EVSQIACGRQHTLAFV 310          

HSP 2 Score: 112.464 bits (280), Expect = 4.071e-25
Identity = 77/254 (30.31%), Postives = 135/254 (53.15%), Query Frame = 1
Query:  148 IKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIK-TTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKS-PVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVC-LSENGDVYVWGKGDSGQLGLG 891
            +  + I  ++CG    + ++  G+ + +G  + GQLG   ++ ++  P  IK L    +K   V+CG  H +   +  +L+ +G N  GQLGL +   S S P+ + S     + Q+ AGG  S A++ +G ++ WG+NS  QLGL D  ++V   P  +   ++  V Y+ CG  H A +++ G L+ +G   + +LG     N+  P+ +  L+   + Q++CG  HT+  +  +G +Y +G GD GQLG G
Sbjct:   81 LTEEHITHIACGQSHNLALSYQGQLYSWGSGNDGQLGHATVEHSSRIPRIIKKLNQ--QKIQQVSCGNDHCMALGDDGQLFTWGQNLHGQLGLGNGFLSQSSPQRVKSLEGIPLAQVTAGGSHSFALSLSGAVFGWGNNSAGQLGLND--EKVRETPCHVKPLRTHKVIYISCGEEHTAILTKAGGLFTFGAGGSGQLGHDSLNNEINPRRVLELMGSEVSQIACGRQHTLAFVPSSGTLYAFGCGDLGQLGTG 330          

HSP 3 Score: 103.99 bits (258), Expect = 1.824e-22
Identity = 91/308 (29.55%), Postives = 146/308 (47.40%), Query Frame = 1
Query:  172 LSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEF-PKLLRIPNLLVKGSGDSLESTEKFINISAGESHTV-ITTTKGLALSFGDGRHGKLG 1080
            ++CG +  + +   G+ +  G N  GQLG +   T   P  +  L    E    +ACG+ H +  +   +LY +G  NDGQLG      S+  P+ I       I Q+  G +   A+ + G+L+ WG N   QLGLG+          + S    P++ V  G  H+ A+S  G ++ WG  +  +LG + ++ + TP  +  L    +  +SCG  HT  L++ G ++ +G G SGQLG     L++E  P+  R+  L+  GS  S         I+ G  HT+    + G   +FG G  G+LG
Sbjct:   39 VACGGKHTLFLLEDGQVYSCGWNGEGQLGHDHEGT--DPVQVTTLT--EEHITHIACGQSHNLALSYQGQLYSWGSGNDGQLGHATVEHSSRIPRIIKKLNQQKIQQVSCGNDHCMALGDDGQLFTWGQNLHGQLGLGNGFLSQSSPQRVKSLEGIPLAQVTAGGSHSFALSLSGAVFGWGNNSAGQLGLNDEKVRETPCHVKPLRTHKVIYISCGEEHTAILTKAGGLFTFGAGGSGQLGHDS--LNNEINPR--RVLELM--GSEVS--------QIACGRQHTLAFVPSSGTLYAFGCGDLGQLG 328          

HSP 4 Score: 65.0846 bits (157), Expect = 2.756e-10
Identity = 33/96 (34.38%), Postives = 54/96 (56.25%), Query Frame = 1
Query:  148 IKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESK-KLYGFGCNNDGQLGLDDK 432
            ++  K+I +SCG+E   ++T++G  F +G    GQLG + +   + P   + L+ +  +   +ACGR HT+ +  S   LY FGC + GQLG   K
Sbjct:  239 LRTHKVIYISCGEEHTAILTKAGGLFTFGAGGSGQLGHDSLNNEINPR--RVLELMGSEVSQIACGRQHTLAFVPSSGTLYAFGCGDLGQLGTGHK 332          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Xenopus
Match: ENSXETT00000039332.1 (HECT and RLD domain containing E3 ubiquitin protein ligase 3 [Source:NCBI gene;Acc:100488790])

HSP 1 Score: 123.635 bits (309), Expect = 1.337e-28
Identity = 106/336 (31.55%), Postives = 168/336 (50.00%), Query Frame = 1
Query:  229 YGKNDWGQLGL-NDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLG--DHSDEVIYKPTLLSFF-KSPVSYVDCGNYHAAAI-SQGRLYVWGEYTNQKLG--DSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFP---KLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLV 1200
            +G + +GQLG  +  + +++  C+    +L      VACG  HT+   E  ++Y  G N +GQLG D +    ++P ++T+    +I  +  G   + A++  G+LY WGS ++ QLG    +HS  +   P ++    +  +  V CGN H  A+   G+L+ WG+  + +LG  + F  +QS+PQ +  L  IP+ QV+ G +H+  LS +G V+ WG   +GQLGL    +  E P   K LR               T K I IS GE HT I T  G   +FG G  G+LG+     + +N + P+ +  L     V  + CG  HT+  V
Sbjct:    4 WGHSTFGQLGNGHSFQGSVSDPCVCRF-SLAACVKEVACGGKHTLFLLEDGQVYSCGWNGEGQLGHDHE---GTDPVQVTTLTEEHITHIACGQSHNLALSYQGQLYSWGSGNDGQLGHATVEHSSRI---PRIIKKLNQQKIQQVSCGNDHCMALGDDGQLFTWGQNLHGQLGLGNGFL-SQSSPQRVKSLEGIPLAQVTAGGSHSFALSLSGAVFGWGNNSAGQLGLNDEKVR-ETPCHVKPLR---------------THKVIYISCGEEHTAILTKAGGLFTFGAGGSGQLGH----DSLNNEINPRRVLELMGS-EVSQIACGRQHTLAFV 310          

HSP 2 Score: 112.464 bits (280), Expect = 4.777e-25
Identity = 77/254 (30.31%), Postives = 135/254 (53.15%), Query Frame = 1
Query:  148 IKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIK-TTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKS-PVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVC-LSENGDVYVWGKGDSGQLGLG 891
            +  + I  ++CG    + ++  G+ + +G  + GQLG   ++ ++  P  IK L    +K   V+CG  H +   +  +L+ +G N  GQLGL +   S S P+ + S     + Q+ AGG  S A++ +G ++ WG+NS  QLGL D  ++V   P  +   ++  V Y+ CG  H A +++ G L+ +G   + +LG     N+  P+ +  L+   + Q++CG  HT+  +  +G +Y +G GD GQLG G
Sbjct:   81 LTEEHITHIACGQSHNLALSYQGQLYSWGSGNDGQLGHATVEHSSRIPRIIKKLNQ--QKIQQVSCGNDHCMALGDDGQLFTWGQNLHGQLGLGNGFLSQSSPQRVKSLEGIPLAQVTAGGSHSFALSLSGAVFGWGNNSAGQLGLND--EKVRETPCHVKPLRTHKVIYISCGEEHTAILTKAGGLFTFGAGGSGQLGHDSLNNEINPRRVLELMGSEVSQIACGRQHTLAFVPSSGTLYAFGCGDLGQLGTG 330          

HSP 3 Score: 103.99 bits (258), Expect = 2.058e-22
Identity = 105/369 (28.46%), Postives = 167/369 (45.26%), Query Frame = 1
Query:  172 LSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEF-PKLLRIPNLLVKGSGDSLESTEKFINISAGESHTV-ITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLI----------ANLDKDLWVYNVQ----CGGCHTVVLVRNRESHE 1221
            ++CG +  + +   G+ +  G N  GQLG +   T   P  +  L    E    +ACG+ H +  +   +LY +G  NDGQLG      S+  P+ I       I Q+  G +   A+ + G+L+ WG N   QLGLG+          + S    P++ V  G  H+ A+S  G ++ WG  +  +LG + ++ + TP  +  L    +  +SCG  HT  L++ G ++ +G G SGQLG     L++E  P+  R+  L+  GS  S         I+ G  HT+    + G   +FG G  G+LG   G +N  N   P ++           ++  D   YN+      GG  T VL    ES +
Sbjct:   39 VACGGKHTLFLLEDGQVYSCGWNGEGQLGHDHEGT--DPVQVTTLT--EEHITHIACGQSHNLALSYQGQLYSWGSGNDGQLGHATVEHSSRIPRIIKKLNQQKIQQVSCGNDHCMALGDDGQLFTWGQNLHGQLGLGNGFLSQSSPQRVKSLEGIPLAQVTAGGSHSFALSLSGAVFGWGNNSAGQLGLNDEKVRETPCHVKPLRTHKVIYISCGEEHTAILTKAGGLFTFGAGGSGQLGHDS--LNNEINPR--RVLELM--GSEVS--------QIACGRQHTLAFVPSSGTLYAFGCGDLGQLGT--GHKN--NVKCPAVVKGKWAAHSGQISMHADRAAYNIVKQIFSGGNKTFVLCSKLESSQ 385          

HSP 4 Score: 65.4698 bits (158), Expect = 2.443e-10
Identity = 33/96 (34.38%), Postives = 54/96 (56.25%), Query Frame = 1
Query:  148 IKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESK-KLYGFGCNNDGQLGLDDK 432
            ++  K+I +SCG+E   ++T++G  F +G    GQLG + +   + P   + L+ +  +   +ACGR HT+ +  S   LY FGC + GQLG   K
Sbjct:  239 LRTHKVIYISCGEEHTAILTKAGGLFTFGAGGSGQLGHDSLNNEINPR--RVLELMGSEVSQIACGRQHTLAFVPSSGTLYAFGCGDLGQLGTGHK 332          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Xenopus
Match: ENSXETT00000039331.1 (HECT and RLD domain containing E3 ubiquitin protein ligase 3 [Source:NCBI gene;Acc:100488790])

HSP 1 Score: 123.635 bits (309), Expect = 1.356e-28
Identity = 106/336 (31.55%), Postives = 168/336 (50.00%), Query Frame = 1
Query:  229 YGKNDWGQLGL-NDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLG--DHSDEVIYKPTLLSFF-KSPVSYVDCGNYHAAAI-SQGRLYVWGEYTNQKLG--DSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFP---KLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLV 1200
            +G + +GQLG  +  + +++  C+    +L      VACG  HT+   E  ++Y  G N +GQLG D +    ++P ++T+    +I  +  G   + A++  G+LY WGS ++ QLG    +HS  +   P ++    +  +  V CGN H  A+   G+L+ WG+  + +LG  + F  +QS+PQ +  L  IP+ QV+ G +H+  LS +G V+ WG   +GQLGL    +  E P   K LR               T K I IS GE HT I T  G   +FG G  G+LG+     + +N + P+ +  L     V  + CG  HT+  V
Sbjct:    4 WGHSTFGQLGNGHSFQGSVSDPCVCRF-SLAACVKEVACGGKHTLFLLEDGQVYSCGWNGEGQLGHDHE---GTDPVQVTTLTEEHITHIACGQSHNLALSYQGQLYSWGSGNDGQLGHATVEHSSRI---PRIIKKLNQQKIQQVSCGNDHCMALGDDGQLFTWGQNLHGQLGLGNGFL-SQSSPQRVKSLEGIPLAQVTAGGSHSFALSLSGAVFGWGNNSAGQLGLNDEKVR-ETPCHVKPLR---------------THKVIYISCGEEHTAILTKAGGLFTFGAGGSGQLGH----DSLNNEINPRRVLELMGS-EVSQIACGRQHTLAFV 310          

HSP 2 Score: 112.464 bits (280), Expect = 4.761e-25
Identity = 77/254 (30.31%), Postives = 135/254 (53.15%), Query Frame = 1
Query:  148 IKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIK-TTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKS-PVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVC-LSENGDVYVWGKGDSGQLGLG 891
            +  + I  ++CG    + ++  G+ + +G  + GQLG   ++ ++  P  IK L    +K   V+CG  H +   +  +L+ +G N  GQLGL +   S S P+ + S     + Q+ AGG  S A++ +G ++ WG+NS  QLGL D  ++V   P  +   ++  V Y+ CG  H A +++ G L+ +G   + +LG     N+  P+ +  L+   + Q++CG  HT+  +  +G +Y +G GD GQLG G
Sbjct:   81 LTEEHITHIACGQSHNLALSYQGQLYSWGSGNDGQLGHATVEHSSRIPRIIKKLNQ--QKIQQVSCGNDHCMALGDDGQLFTWGQNLHGQLGLGNGFLSQSSPQRVKSLEGIPLAQVTAGGSHSFALSLSGAVFGWGNNSAGQLGLND--EKVRETPCHVKPLRTHKVIYISCGEEHTAILTKAGGLFTFGAGGSGQLGHDSLNNEINPRRVLELMGSEVSQIACGRQHTLAFVPSSGTLYAFGCGDLGQLGTG 330          

HSP 3 Score: 104.375 bits (259), Expect = 1.913e-22
Identity = 91/308 (29.55%), Postives = 146/308 (47.40%), Query Frame = 1
Query:  172 LSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEF-PKLLRIPNLLVKGSGDSLESTEKFINISAGESHTV-ITTTKGLALSFGDGRHGKLG 1080
            ++CG +  + +   G+ +  G N  GQLG +   T   P  +  L    E    +ACG+ H +  +   +LY +G  NDGQLG      S+  P+ I       I Q+  G +   A+ + G+L+ WG N   QLGLG+          + S    P++ V  G  H+ A+S  G ++ WG  +  +LG + ++ + TP  +  L    +  +SCG  HT  L++ G ++ +G G SGQLG     L++E  P+  R+  L+  GS  S         I+ G  HT+    + G   +FG G  G+LG
Sbjct:   39 VACGGKHTLFLLEDGQVYSCGWNGEGQLGHDHEGT--DPVQVTTLT--EEHITHIACGQSHNLALSYQGQLYSWGSGNDGQLGHATVEHSSRIPRIIKKLNQQKIQQVSCGNDHCMALGDDGQLFTWGQNLHGQLGLGNGFLSQSSPQRVKSLEGIPLAQVTAGGSHSFALSLSGAVFGWGNNSAGQLGLNDEKVRETPCHVKPLRTHKVIYISCGEEHTAILTKAGGLFTFGAGGSGQLGHDS--LNNEINPR--RVLELM--GSEVS--------QIACGRQHTLAFVPSSGTLYAFGCGDLGQLG 328          

HSP 4 Score: 65.4698 bits (158), Expect = 2.258e-10
Identity = 33/96 (34.38%), Postives = 54/96 (56.25%), Query Frame = 1
Query:  148 IKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESK-KLYGFGCNNDGQLGLDDK 432
            ++  K+I +SCG+E   ++T++G  F +G    GQLG + +   + P   + L+ +  +   +ACGR HT+ +  S   LY FGC + GQLG   K
Sbjct:  239 LRTHKVIYISCGEEHTAILTKAGGLFTFGAGGSGQLGHDSLNNEINPR--RVLELMGSEVSQIACGRQHTLAFVPSSGTLYAFGCGDLGQLGTGHK 332          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Xenopus
Match: ENSXETT00000027619.1 (HECT and RLD domain containing E3 ubiquitin protein ligase 3 [Source:NCBI gene;Acc:100488790])

HSP 1 Score: 123.635 bits (309), Expect = 1.379e-28
Identity = 106/336 (31.55%), Postives = 168/336 (50.00%), Query Frame = 1
Query:  229 YGKNDWGQLGL-NDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLG--DHSDEVIYKPTLLSFF-KSPVSYVDCGNYHAAAI-SQGRLYVWGEYTNQKLG--DSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFP---KLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLV 1200
            +G + +GQLG  +  + +++  C+    +L      VACG  HT+   E  ++Y  G N +GQLG D +    ++P ++T+    +I  +  G   + A++  G+LY WGS ++ QLG    +HS  +   P ++    +  +  V CGN H  A+   G+L+ WG+  + +LG  + F  +QS+PQ +  L  IP+ QV+ G +H+  LS +G V+ WG   +GQLGL    +  E P   K LR               T K I IS GE HT I T  G   +FG G  G+LG+     + +N + P+ +  L     V  + CG  HT+  V
Sbjct:    4 WGHSTFGQLGNGHSFQGSVSDPCVCRF-SLAACVKEVACGGKHTLFLLEDGQVYSCGWNGEGQLGHDHE---GTDPVQVTTLTEEHITHIACGQSHNLALSYQGQLYSWGSGNDGQLGHATVEHSSRI---PRIIKKLNQQKIQQVSCGNDHCMALGDDGQLFTWGQNLHGQLGLGNGFL-SQSSPQRVKSLEGIPLAQVTAGGSHSFALSLSGAVFGWGNNSAGQLGLNDEKVR-ETPCHVKPLR---------------THKVIYISCGEEHTAILTKAGGLFTFGAGGSGQLGH----DSLNNEINPRRVLELMGS-EVSQIACGRQHTLAFV 310          

HSP 2 Score: 112.464 bits (280), Expect = 4.435e-25
Identity = 77/254 (30.31%), Postives = 135/254 (53.15%), Query Frame = 1
Query:  148 IKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIK-TTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKS-PVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVC-LSENGDVYVWGKGDSGQLGLG 891
            +  + I  ++CG    + ++  G+ + +G  + GQLG   ++ ++  P  IK L    +K   V+CG  H +   +  +L+ +G N  GQLGL +   S S P+ + S     + Q+ AGG  S A++ +G ++ WG+NS  QLGL D  ++V   P  +   ++  V Y+ CG  H A +++ G L+ +G   + +LG     N+  P+ +  L+   + Q++CG  HT+  +  +G +Y +G GD GQLG G
Sbjct:   81 LTEEHITHIACGQSHNLALSYQGQLYSWGSGNDGQLGHATVEHSSRIPRIIKKLNQ--QKIQQVSCGNDHCMALGDDGQLFTWGQNLHGQLGLGNGFLSQSSPQRVKSLEGIPLAQVTAGGSHSFALSLSGAVFGWGNNSAGQLGLND--EKVRETPCHVKPLRTHKVIYISCGEEHTAILTKAGGLFTFGAGGSGQLGHDSLNNEINPRRVLELMGSEVSQIACGRQHTLAFVPSSGTLYAFGCGDLGQLGTG 330          

HSP 3 Score: 103.99 bits (258), Expect = 2.160e-22
Identity = 105/369 (28.46%), Postives = 167/369 (45.26%), Query Frame = 1
Query:  172 LSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEF-PKLLRIPNLLVKGSGDSLESTEKFINISAGESHTV-ITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLI----------ANLDKDLWVYNVQ----CGGCHTVVLVRNRESHE 1221
            ++CG +  + +   G+ +  G N  GQLG +   T   P  +  L    E    +ACG+ H +  +   +LY +G  NDGQLG      S+  P+ I       I Q+  G +   A+ + G+L+ WG N   QLGLG+          + S    P++ V  G  H+ A+S  G ++ WG  +  +LG + ++ + TP  +  L    +  +SCG  HT  L++ G ++ +G G SGQLG     L++E  P+  R+  L+  GS  S         I+ G  HT+    + G   +FG G  G+LG   G +N  N   P ++           ++  D   YN+      GG  T VL    ES +
Sbjct:   39 VACGGKHTLFLLEDGQVYSCGWNGEGQLGHDHEGT--DPVQVTTLT--EEHITHIACGQSHNLALSYQGQLYSWGSGNDGQLGHATVEHSSRIPRIIKKLNQQKIQQVSCGNDHCMALGDDGQLFTWGQNLHGQLGLGNGFLSQSSPQRVKSLEGIPLAQVTAGGSHSFALSLSGAVFGWGNNSAGQLGLNDEKVRETPCHVKPLRTHKVIYISCGEEHTAILTKAGGLFTFGAGGSGQLGHDS--LNNEINPR--RVLELM--GSEVS--------QIACGRQHTLAFVPSSGTLYAFGCGDLGQLGT--GHKN--NVKCPAVVKGKWAAHSGQISMHADRAAYNIVKQIFSGGNKTFVLCSKLESSQ 385          

HSP 4 Score: 65.4698 bits (158), Expect = 2.089e-10
Identity = 33/96 (34.38%), Postives = 54/96 (56.25%), Query Frame = 1
Query:  148 IKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESK-KLYGFGCNNDGQLGLDDK 432
            ++  K+I +SCG+E   ++T++G  F +G    GQLG + +   + P   + L+ +  +   +ACGR HT+ +  S   LY FGC + GQLG   K
Sbjct:  239 LRTHKVIYISCGEEHTAILTKAGGLFTFGAGGSGQLGHDSLNNEINPR--RVLELMGSEVSQIACGRQHTLAFVPSSGTLYAFGCGDLGQLGTGHK 332          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Xenopus
Match: ENSXETT00000027632.1 (HECT and RLD domain containing E3 ubiquitin protein ligase 3 [Source:NCBI gene;Acc:100488790])

HSP 1 Score: 123.635 bits (309), Expect = 1.394e-28
Identity = 106/336 (31.55%), Postives = 168/336 (50.00%), Query Frame = 1
Query:  229 YGKNDWGQLGL-NDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLG--DHSDEVIYKPTLLSFF-KSPVSYVDCGNYHAAAI-SQGRLYVWGEYTNQKLG--DSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFP---KLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLV 1200
            +G + +GQLG  +  + +++  C+    +L      VACG  HT+   E  ++Y  G N +GQLG D +    ++P ++T+    +I  +  G   + A++  G+LY WGS ++ QLG    +HS  +   P ++    +  +  V CGN H  A+   G+L+ WG+  + +LG  + F  +QS+PQ +  L  IP+ QV+ G +H+  LS +G V+ WG   +GQLGL    +  E P   K LR               T K I IS GE HT I T  G   +FG G  G+LG+     + +N + P+ +  L     V  + CG  HT+  V
Sbjct:    4 WGHSTFGQLGNGHSFQGSVSDPCVCRF-SLAACVKEVACGGKHTLFLLEDGQVYSCGWNGEGQLGHDHE---GTDPVQVTTLTEEHITHIACGQSHNLALSYQGQLYSWGSGNDGQLGHATVEHSSRI---PRIIKKLNQQKIQQVSCGNDHCMALGDDGQLFTWGQNLHGQLGLGNGFL-SQSSPQRVKSLEGIPLAQVTAGGSHSFALSLSGAVFGWGNNSAGQLGLNDEKVR-ETPCHVKPLR---------------THKVIYISCGEEHTAILTKAGGLFTFGAGGSGQLGH----DSLNNEINPRRVLELMGS-EVSQIACGRQHTLAFV 310          

HSP 2 Score: 112.464 bits (280), Expect = 5.198e-25
Identity = 77/254 (30.31%), Postives = 135/254 (53.15%), Query Frame = 1
Query:  148 IKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIK-TTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKS-PVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVC-LSENGDVYVWGKGDSGQLGLG 891
            +  + I  ++CG    + ++  G+ + +G  + GQLG   ++ ++  P  IK L    +K   V+CG  H +   +  +L+ +G N  GQLGL +   S S P+ + S     + Q+ AGG  S A++ +G ++ WG+NS  QLGL D  ++V   P  +   ++  V Y+ CG  H A +++ G L+ +G   + +LG     N+  P+ +  L+   + Q++CG  HT+  +  +G +Y +G GD GQLG G
Sbjct:   81 LTEEHITHIACGQSHNLALSYQGQLYSWGSGNDGQLGHATVEHSSRIPRIIKKLNQ--QKIQQVSCGNDHCMALGDDGQLFTWGQNLHGQLGLGNGFLSQSSPQRVKSLEGIPLAQVTAGGSHSFALSLSGAVFGWGNNSAGQLGLND--EKVRETPCHVKPLRTHKVIYISCGEEHTAILTKAGGLFTFGAGGSGQLGHDSLNNEINPRRVLELMGSEVSQIACGRQHTLAFVPSSGTLYAFGCGDLGQLGTG 330          

HSP 3 Score: 103.99 bits (258), Expect = 2.276e-22
Identity = 105/369 (28.46%), Postives = 167/369 (45.26%), Query Frame = 1
Query:  172 LSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEF-PKLLRIPNLLVKGSGDSLESTEKFINISAGESHTV-ITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIA----------NLDKDLWVYNVQ----CGGCHTVVLVRNRESHE 1221
            ++CG +  + +   G+ +  G N  GQLG +   T   P  +  L    E    +ACG+ H +  +   +LY +G  NDGQLG      S+  P+ I       I Q+  G +   A+ + G+L+ WG N   QLGLG+          + S    P++ V  G  H+ A+S  G ++ WG  +  +LG + ++ + TP  +  L    +  +SCG  HT  L++ G ++ +G G SGQLG     L++E  P+  R+  L+  GS  S         I+ G  HT+    + G   +FG G  G+LG   G +N  N   P ++           ++  D   YN+      GG  T VL    ES +
Sbjct:   39 VACGGKHTLFLLEDGQVYSCGWNGEGQLGHDHEGT--DPVQVTTLT--EEHITHIACGQSHNLALSYQGQLYSWGSGNDGQLGHATVEHSSRIPRIIKKLNQQKIQQVSCGNDHCMALGDDGQLFTWGQNLHGQLGLGNGFLSQSSPQRVKSLEGIPLAQVTAGGSHSFALSLSGAVFGWGNNSAGQLGLNDEKVRETPCHVKPLRTHKVIYISCGEEHTAILTKAGGLFTFGAGGSGQLGHDS--LNNEINPR--RVLELM--GSEVS--------QIACGRQHTLAFVPSSGTLYAFGCGDLGQLGT--GHKN--NVKCPAVVKGKWAAHSGQISMHADRAAYNIVKQIFSGGNKTFVLCSKLESSQ 385          

HSP 4 Score: 65.4698 bits (158), Expect = 2.470e-10
Identity = 33/96 (34.38%), Postives = 54/96 (56.25%), Query Frame = 1
Query:  148 IKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESK-KLYGFGCNNDGQLGLDDK 432
            ++  K+I +SCG+E   ++T++G  F +G    GQLG + +   + P   + L+ +  +   +ACGR HT+ +  S   LY FGC + GQLG   K
Sbjct:  239 LRTHKVIYISCGEEHTAILTKAGGLFTFGAGGSGQLGHDSLNNEINPR--RVLELMGSEVSQIACGRQHTLAFVPSSGTLYAFGCGDLGQLGTGHK 332          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Mouse
Match: Rpgr (retinitis pigmentosa GTPase regulator [Source:MGI Symbol;Acc:MGI:1344037])

HSP 1 Score: 267.314 bits (682), Expect = 7.946e-80
Identity = 160/386 (41.45%), Postives = 222/386 (57.51%), Query Frame = 1
Query:   70 ENYIPETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLG--DSFQENQSTPQGIL-IKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLL-RIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNR 1209
            E+ +P+TGA+F FG+    E + +K W KND  I LSCGDE   ++T + + + +G N+WGQLGL      + P+CIKALK   EK  L ACGR HT++ T++  +Y  G NN+GQLGL D     +  + +       I QL AG   SAA+ E GKL++WG NSE Q+GL D S+  I  P  ++  K P+S++ CG YH+A ++  G LY +GE  N KLG  +    N  +PQ +L I   + QV+CG  HTV L+E   VY +G G  GQLGLG     +  PK++ RI +             +K  +IS GE+HT + T  GL  +FGDGRHGKLG   G  N++N  +P L +N  +   V  + CGGCH +V    R
Sbjct:   43 ESLVPDTGAVFTFGKTKFAENIPSKFWFKNDIPICLSCGDEHTAIVTGNNKLYMFGSNNWGQLGLGSKAAIIKPTCIKALK--PEKVKLAACGRNHTLVSTDTGGVYAAGGNNEGQLGLGDTDDRDTFHQIVFFTPADTIKQLSAGANTSAALTEDGKLFMWGDNSEGQIGLEDKSNVCI--PHEVTVGK-PISWISCGYYHSAFVTMDGELYTFGEPENGKLGLPNELLMNHRSPQRVLGIPERVIQVACGGGHTVVLTEK-VVYAFGLGQFGQLGLGTFLFETSEPKIIERIKD-------------QKICHISCGENHTALMTELGLLYTFGDGRHGKLGL--GMENFTNQFFPTLCSNFLR-FAVQLIACGGCHMLVFATPR 406          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Mouse
Match: Rpgr (retinitis pigmentosa GTPase regulator [Source:MGI Symbol;Acc:MGI:1344037])

HSP 1 Score: 268.47 bits (685), Expect = 1.071e-79
Identity = 160/386 (41.45%), Postives = 222/386 (57.51%), Query Frame = 1
Query:   70 ENYIPETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLG--DSFQENQSTPQGIL-IKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLL-RIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNR 1209
            E+ +P+TGA+F FG+    E + +K W KND  I LSCGDE   ++T + + + +G N+WGQLGL      + P+CIKALK   EK  L ACGR HT++ T++  +Y  G NN+GQLGL D     +  + +       I QL AG   SAA+ E GKL++WG NSE Q+GL D S+  I  P  ++  K P+S++ CG YH+A ++  G LY +GE  N KLG  +    N  +PQ +L I   + QV+CG  HTV L+E   VY +G G  GQLGLG     +  PK++ RI +             +K  +IS GE+HT + T  GL  +FGDGRHGKLG   G  N++N  +P L +N  +   V  + CGGCH +V    R
Sbjct:   43 ESLVPDTGAVFTFGKTKFAENIPSKFWFKNDIPICLSCGDEHTAIVTGNNKLYMFGSNNWGQLGLGSKAAIIKPTCIKALK--PEKVKLAACGRNHTLVSTDTGGVYAAGGNNEGQLGLGDTDDRDTFHQIVFFTPADTIKQLSAGANTSAALTEDGKLFMWGDNSEGQIGLEDKSNVCI--PHEVTVGK-PISWISCGYYHSAFVTMDGELYTFGEPENGKLGLPNELLMNHRSPQRVLGIPERVIQVACGGGHTVVLTEK-VVYAFGLGQFGQLGLGTFLFETSEPKIIERIKD-------------QKICHISCGENHTALMTELGLLYTFGDGRHGKLGL--GMENFTNQFFPTLCSNFLR-FAVQLIACGGCHMLVFATPR 406          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Mouse
Match: Rpgr (retinitis pigmentosa GTPase regulator [Source:MGI Symbol;Acc:MGI:1344037])

HSP 1 Score: 266.929 bits (681), Expect = 1.096e-79
Identity = 160/386 (41.45%), Postives = 222/386 (57.51%), Query Frame = 1
Query:   70 ENYIPETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLG--DSFQENQSTPQGIL-IKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLL-RIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNR 1209
            E+ +P+TGA+F FG+    E + +K W KND  I LSCGDE   ++T + + + +G N+WGQLGL      + P+CIKALK   EK  L ACGR HT++ T++  +Y  G NN+GQLGL D     +  + +       I QL AG   SAA+ E GKL++WG NSE Q+GL D S+  I  P  ++  K P+S++ CG YH+A ++  G LY +GE  N KLG  +    N  +PQ +L I   + QV+CG  HTV L+E   VY +G G  GQLGLG     +  PK++ RI +             +K  +IS GE+HT + T  GL  +FGDGRHGKLG   G  N++N  +P L +N  +   V  + CGGCH +V    R
Sbjct:   43 ESLVPDTGAVFTFGKTKFAENIPSKFWFKNDIPICLSCGDEHTAIVTGNNKLYMFGSNNWGQLGLGSKAAIIKPTCIKALK--PEKVKLAACGRNHTLVSTDTGGVYAAGGNNEGQLGLGDTDDRDTFHQIVFFTPADTIKQLSAGANTSAALTEDGKLFMWGDNSEGQIGLEDKSNVCI--PHEVTVGK-PISWISCGYYHSAFVTMDGELYTFGEPENGKLGLPNELLMNHRSPQRVLGIPERVIQVACGGGHTVVLTEK-VVYAFGLGQFGQLGLGTFLFETSEPKIIERIKD-------------QKICHISCGENHTALMTELGLLYTFGDGRHGKLGL--GMENFTNQFFPTLCSNFLR-FAVQLIACGGCHMLVFATPR 406          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Mouse
Match: Rpgr (retinitis pigmentosa GTPase regulator [Source:MGI Symbol;Acc:MGI:1344037])

HSP 1 Score: 269.24 bits (687), Expect = 2.079e-78
Identity = 160/386 (41.45%), Postives = 222/386 (57.51%), Query Frame = 1
Query:   70 ENYIPETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLG--DSFQENQSTPQGIL-IKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLL-RIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNR 1209
            E+ +P+TGA+F FG+    E + +K W KND  I LSCGDE   ++T + + + +G N+WGQLGL      + P+CIKALK   EK  L ACGR HT++ T++  +Y  G NN+GQLGL D     +  + +       I QL AG   SAA+ E GKL++WG NSE Q+GL D S+  I  P  ++  K P+S++ CG YH+A ++  G LY +GE  N KLG  +    N  +PQ +L I   + QV+CG  HTV L+E   VY +G G  GQLGLG     +  PK++ RI +             +K  +IS GE+HT + T  GL  +FGDGRHGKLG   G  N++N  +P L +N  +   V  + CGGCH +V    R
Sbjct:   43 ESLVPDTGAVFTFGKTKFAENIPSKFWFKNDIPICLSCGDEHTAIVTGNNKLYMFGSNNWGQLGLGSKAAIIKPTCIKALK--PEKVKLAACGRNHTLVSTDTGGVYAAGGNNEGQLGLGDTDDRDTFHQIVFFTPADTIKQLSAGANTSAALTEDGKLFMWGDNSEGQIGLEDKSNVCI--PHEVTVGK-PISWISCGYYHSAFVTMDGELYTFGEPENGKLGLPNELLMNHRSPQRVLGIPERVIQVACGGGHTVVLTEKV-VYAFGLGQFGQLGLGTFLFETSEPKIIERIKD-------------QKICHISCGENHTALMTELGLLYTFGDGRHGKLGL--GMENFTNQFFPTLCSNFLR-FAVQLIACGGCHMLVFATPR 406          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Mouse
Match: Rpgr (retinitis pigmentosa GTPase regulator [Source:MGI Symbol;Acc:MGI:1344037])

HSP 1 Score: 270.011 bits (689), Expect = 2.749e-78
Identity = 160/386 (41.45%), Postives = 222/386 (57.51%), Query Frame = 1
Query:   70 ENYIPETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLG--DSFQENQSTPQGIL-IKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLL-RIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNR 1209
            E+ +P+TGA+F FG+    E + +K W KND  I LSCGDE   ++T + + + +G N+WGQLGL      + P+CIKALK   EK  L ACGR HT++ T++  +Y  G NN+GQLGL D     +  + +       I QL AG   SAA+ E GKL++WG NSE Q+GL D S+  I  P  ++  K P+S++ CG YH+A ++  G LY +GE  N KLG  +    N  +PQ +L I   + QV+CG  HTV L+E   VY +G G  GQLGLG     +  PK++ RI +             +K  +IS GE+HT + T  GL  +FGDGRHGKLG   G  N++N  +P L +N  +   V  + CGGCH +V    R
Sbjct:   43 ESLVPDTGAVFTFGKTKFAENIPSKFWFKNDIPICLSCGDEHTAIVTGNNKLYMFGSNNWGQLGLGSKAAIIKPTCIKALK--PEKVKLAACGRNHTLVSTDTGGVYAAGGNNEGQLGLGDTDDRDTFHQIVFFTPADTIKQLSAGANTSAALTEDGKLFMWGDNSEGQIGLEDKSNVCI--PHEVTVGK-PISWISCGYYHSAFVTMDGELYTFGEPENGKLGLPNELLMNHRSPQRVLGIPERVIQVACGGGHTVVLTEKV-VYAFGLGQFGQLGLGTFLFETSEPKIIERIKD-------------QKICHISCGENHTALMTELGLLYTFGDGRHGKLG--LGMENFTNQFFPTLCSNFLR-FAVQLIACGGCHMLVFATPR 406          
BLAST of Retinitis pigmentosa GTPase regulator b vs. UniProt/SwissProt
Match: sp|Q9R0X5|RPGR_MOUSE (X-linked retinitis pigmentosa GTPase regulator OS=Mus musculus OX=10090 GN=Rpgr PE=1 SV=2)

HSP 1 Score: 270.396 bits (690), Expect = 8.320e-78
Identity = 160/386 (41.45%), Postives = 222/386 (57.51%), Query Frame = 1
Query:   70 ENYIPETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLG--DSFQENQSTPQGIL-IKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLL-RIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNR 1209
            E+ +P+TGA+F FG+    E + +K W KND  I LSCGDE   ++T + + + +G N+WGQLGL      + P+CIKALK   EK  L ACGR HT++ T++  +Y  G NN+GQLGL D     +  + +       I QL AG   SAA+ E GKL++WG NSE Q+GL D S+  I  P  ++  K P+S++ CG YH+A ++  G LY +GE  N KLG  +    N  +PQ +L I   + QV+CG  HTV L+E   VY +G G  GQLGLG     +  PK++ RI +             +K  +IS GE+HT + T  GL  +FGDGRHGKLG   G  N++N  +P L +N  +   V  + CGGCH +V    R
Sbjct:    5 ESLVPDTGAVFTFGKTKFAENIPSKFWFKNDIPICLSCGDEHTAIVTGNNKLYMFGSNNWGQLGLGSKAAIIKPTCIKALK--PEKVKLAACGRNHTLVSTDTGGVYAAGGNNEGQLGLGDTDDRDTFHQIVFFTPADTIKQLSAGANTSAALTEDGKLFMWGDNSEGQIGLEDKSNVCI--PHEVTVGK-PISWISCGYYHSAFVTMDGELYTFGEPENGKLGLPNELLMNHRSPQRVLGIPERVIQVACGGGHTVVLTEKV-VYAFGLGQFGQLGLGTFLFETSEPKIIERIKD-------------QKICHISCGENHTALMTELGLLYTFGDGRHGKLG--LGMENFTNQFFPTLCSNFLR-FAVQLIACGGCHMLVFATPR 368          
BLAST of Retinitis pigmentosa GTPase regulator b vs. UniProt/SwissProt
Match: sp|Q92834|RPGR_HUMAN (X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens OX=9606 GN=RPGR PE=1 SV=2)

HSP 1 Score: 258.84 bits (660), Expect = 1.477e-73
Identity = 161/385 (41.82%), Postives = 218/385 (56.62%), Query Frame = 1
Query:   70 ENYIPETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYG--NICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAI-SQGRLYVWGEYTNQKLG--DSFQENQSTPQGILIKIPIK--QVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLV 1200
            E  +P++GA+F FG+    E    K W KND  + LSCGDE   ++T + + + +G N+WGQLGL        P+C+KALK   EK  L ACGR HT++ TE   +Y  G NN+GQLGL D  +       + S+      I QL AG   SAA+ E G+L++WG NSE Q+GL + S+  +  P  ++  K PVS++ CG YH+A + + G LYV+GE  N KLG  +    N  TPQ ++ +IP K  QV+CG  HTV L+EN  VY +G G  GQLGLG     +  PK+  I N+            +    IS GE+HT + T  GL  +FGDGRHGKLG   G  N++N+  P L +N  +   V  V CGGCH VV  
Sbjct:    5 EELMPDSGAVFTFGKSKFAENNPGKFWFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKSAISKPTCVKALK--PEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGD--TEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNVCV--PQQVTIGK-PVSWISCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQ-LVSEIPEKVIQVACGGEHTVVLTENA-VYTFGLGQFGQLGLGTFLFETSEPKV--IENI----------RDQTISYISCGENHTALITDIGLMYTFGDGRHGKLG--LGLENFTNHFIPTLCSNFLR-FIVKLVACGGCHMVVFA 365          

HSP 2 Score: 95.1301 bits (235), Expect = 7.293e-19
Identity = 81/252 (32.14%), Postives = 118/252 (46.83%), Query Frame = 1
Query:  469 WIYGNI-CQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFK-SPVSYVDCGNYHAAAISQG-RLYVWGEYTNQKLGDSFQENQSTPQGILI---KIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRN 1206
            W   ++   L  G E SA +    KLY++GSN+  QLGLG  S   I KPT +   K   V    CG  H    ++G  +Y  G     +LG    E ++T   I     +  IKQ+S G N +  L+E+G +++WG    GQ+GL    +S+     + +P  +  G   S         IS G  H+   TT G    FG+  +GKLG     +   N+  P+L++ + +   V  V CGG HTVVL  N
Sbjct:   31 WFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKS--AISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGL--KNVSN-----VCVPQQVTIGKPVSW--------ISCGYYHSAFVTTDGELYVFGEPENGKLGLPN--QLLGNHRTPQLVSEIPEK--VIQVACGGEHTVVLTEN 261          
BLAST of Retinitis pigmentosa GTPase regulator b vs. UniProt/SwissProt
Match: sp|Q9N1T2|RPGR_CANLF (X-linked retinitis pigmentosa GTPase regulator OS=Canis lupus familiaris OX=9615 GN=RPGR PE=2 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 1.303e-69
Identity = 153/387 (39.53%), Postives = 215/387 (55.56%), Query Frame = 1
Query:   70 ENYIPETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGN--ICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAI-SQGRLYVWGEYTNQKLG--DSFQENQSTPQGIL-IKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNR 1209
            E  +P +GA+F FG+    E + +K W +ND    LSCGDE   ++T + + + +G N+WGQLGL    T   P+C+KALK   EK    ACGR HT++ TE  K+Y  G NN+GQLGL D    ++    + S+      I QL AG   SAA+ E G+L++WG NSE Q+GL + ++  +  P  ++  K P+S++ CG YH+A + ++G+LY +GE    KLG  +    N   PQ +  I   + QV+CG  HTV L+E   VY +G G  GQLGLG     +  PK +      +K         +K   I+ GE+HT + T  GL  +FGDGRHGKLG   G  N +N   P L +N  +   V  V CGGCHT+V    R
Sbjct:    5 EEVMPGSGAVFTFGKTQFAENIPSKFWFRNDVPTFLSCGDEHTAVVTGNNKLYMFGSNNWGQLGLGSKSTVSKPTCVKALK--PEKVKFAACGRNHTLVSTEGGKVYAAGGNNEGQLGLGDTEERST--FHLISFFTSQRKIKQLSAGSNTSAALTEDGELFMWGDNSEGQIGLENVTNVCV--PQQVTVGK-PISWISCGYYHSAFVTTEGQLYTFGEPECGKLGLPNQLLVNHRMPQPVPGIPGKVVQVACGGGHTVVLTEKA-VYTFGLGQFGQLGLGTFLFETSVPKAIE----HIK--------DQKISFIACGENHTALITDMGLMYTFGDGRHGKLGL--GLENSTNQFIPTLCSNFLR-FIVQLVSCGGCHTLVFATPR 368          
BLAST of Retinitis pigmentosa GTPase regulator b vs. UniProt/SwissProt
Match: sp|Q9FN03|UVR8_ARATH (Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana OX=3702 GN=UVR8 PE=1 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 1.070e-34
Identity = 107/315 (33.97%), Postives = 165/315 (52.38%), Query Frame = 1
Query:  103 NFGEIG---GEELETKLWIK---NDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAI-SQGRLYVWGEYTNQKLGDSFQENQSTPQGILIKIP----IKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKG-SGDSLESTEKFINISAGES 1011
            +FG +G     +L T L IK     +I  ++CGD  C+ +T  G    +G+N  GQLGL D + +L P  I+A + +  K  +VA G  HT   TE   LYG+G    G LGL D+      P+ +TS     +  +  G   + +++ +G LY +G +   QLG GD  D +I    L +   S +S +  G  H  A+ S G+LY WG     ++G     +Q +P  + ++ P    + QVSCG  HT+ ++E  +V+ WG+G +GQLG+G   +   FPK+  I  L V G SG  +ES+   I+ S+G+S
Sbjct:   96 DFGRLGHGNSSDLFTPLPIKALHGIRIKQIACGDSHCLAVTMEGEVQSWGRNQNGQLGLGDTEDSLVPQKIQAFEGIRIK--MVAAGAEHTAAVTEDGDLYGWGWGRYGNLGLGDRTDRLV-PERVTSTGGEKMSMVACGWRHTISVSYSGALYTYGWSKYGQLGHGDLEDHLI-PHKLEALSNSFISQISGGWRHTMALTSDGKLYGWGWNKFGQVGVGNNLDQCSP--VQVRFPDDQKVVQVSCGWRHTLAVTERNNVFAWGRGTNGQLGIG-ESVDRNFPKI--IEALSVDGASGQHIESSN--IDPSSGKS 399          

HSP 2 Score: 137.887 bits (346), Expect = 8.718e-34
Identity = 109/340 (32.06%), Postives = 169/340 (49.71%), Query Frame = 1
Query:  148 IKNDKIISLSCGDEFCVLITRSG-RAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGA--RNYSNYMWPKLIANLDKD 1149
            +   +I+S++CG +  V  ++SG   + +G  D+G+LG  +     TP  IKAL  +  K I  ACG  H +  T   ++  +G N +GQLGL D   S   P++I ++    I  + AG E +AA+ E G LY WG      LGLGD +D ++ +  + S     +S V CG  H  ++S  G LY +G     +LG    E+   P  +  L    I Q+S G  HT+ L+ +G +Y WG    GQ+G+G + L    P  +R P+             +K + +S G  HT+  T +    ++G G +G+LG IG +  RN+     PK+I  L  D
Sbjct:   64 LDGHQIVSVTCGADHTVAYSQSGMEVYSWGWGDFGRLGHGNSSDLFTPLPIKALHGIRIKQI--ACGDSHCLAVTMEGEVQSWGRNQNGQLGLGDTEDSLV-PQKIQAFEGIRIKMVAAGAEHTAAVTEDGDLYGWGWGRYGNLGLGDRTDRLVPE-RVTSTGGEKMSMVACGWRHTISVSYSGALYTYGWSKYGQLGHGDLEDHLIPHKLEALSNSFISQISGGWRHTMALTSDGKLYGWGWNKFGQVGVG-NNLDQCSPVQVRFPD------------DQKVVQVSCGWRHTLAVTERNNVFAWGRGTNGQLG-IGESVDRNF-----PKIIEALSVD 380          

HSP 3 Score: 93.2041 bits (230), Expect = 7.564e-19
Identity = 77/300 (25.67%), Postives = 137/300 (45.67%), Query Frame = 1
Query:  319 EKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETG-KLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRN 1206
             K ++++ G  H++       +  +G   DGQLG  D     S P ++++     I  +  G + + A +++G ++Y WG     +LG G+ SD     P + +     +  + CG+ H  A++ +G +  WG   N +LG    E+   PQ I     I IK V+ G  HT  ++E+GD+Y WG G  G LGLG         +L  +P  +    G      EK   ++ G  HT+  +  G   ++G  ++G+LG+     +  +++ P  +  L     +  +  G  HT+ L  +
Sbjct:   15 RKVLIISAGASHSVALLSGDIVCSWGRGEDGQLGHGDAEDRPS-PTQLSALDGHQIVSVTCGADHTVAYSQSGMEVYSWGWGDFGRLGHGNSSDLFTPLP-IKALHGIRIKQIACGDSHCLAVTMEGEVQSWGRNQNGQLGLGDTEDSLVPQKIQAFEGIRIKMVAAGAEHTAAVTEDGDLYGWGWGRYGNLGLG-----DRTDRL--VPERVTSTGG------EKMSMVACGWRHTISVSYSGALYTYGWSKYGQLGH----GDLEDHLIPHKLEALSNSF-ISQISGGWRHTMALTSD 294          
BLAST of Retinitis pigmentosa GTPase regulator b vs. UniProt/SwissProt
Match: sp|Q5PQN1|HERC4_RAT (Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus OX=10116 GN=Herc4 PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 6.644e-33
Identity = 106/329 (32.22%), Postives = 169/329 (51.37%), Query Frame = 1
Query:  229 YGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKP-TLLSFFKSPVSYVDCGNYHAAAISQG-RLYVWGEYTNQKLGDSFQ-ENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLV 1200
            +G   +GQLGL  I   +     K+   +N+K   V CG  HT+   +   +Y  GCN+ GQLG +    S  +P+++ +    NI  +  G   + A+N+ G++Y WG +S+ QLGL   S+E I  P  + S     +  V CG YH+ A+S+   ++ WG+    +LG   + + Q++PQ I  L+ IP  QV+ G  H+  L+ +G ++ WG+   GQLG     L+ E  +   +PNLL      SL S +K + I  GE HT   T +G   +FG G +G+LG+     + S+ + P+ +  L   + V  + CG  HT   V
Sbjct:    4 WGNASYGQLGLGGIDEEIVLEPRKSDFFVNKKVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHE---KSRKKPEQVVALDAQNIVAVSCGEAHTLALNDKGQVYAWGLDSDGQLGL-QGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLGLGIECQKQTSPQLIKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQLG-----LNDENDRY--VPNLL-----KSLRS-QKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLGH----NSTSHEINPRKVFELMGSI-VTQIACGRQHTSAFV 310          

HSP 2 Score: 111.694 bits (278), Expect = 4.482e-24
Identity = 90/316 (28.48%), Postives = 141/316 (44.62%), Query Frame = 1
Query:  145 WIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHT-VITTTKGLALSFGDGRHGKLG 1080
            +  N K+  + CG    V +   G  +  G ND GQLG    K+   P  + AL   N   + V+CG  HT+   +  ++Y +G ++DGQLGL         P+ I S     I Q+  G   S A+++  +++ WG N   QLGLG    +      + S    P   V  G  H+  ++  G ++ WG     +LG + + ++  P  +  L    I  + CG +HT  L++ G V+ +G G  GQLG   H  +S      ++  L+  GS            I+ G  HT     + G   SFG G +G+LG
Sbjct:   30 FFVNKKVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHE--KSRKKPEQVVALDAQN--IVAVSCGEAHTLALNDKGQVYAWGLDSDGQLGLQGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLGLGIECQKQTSPQLIKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQLGLNDENDRYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLG---HNSTSHEINPRKVFELM--GS--------IVTQIACGRQHTSAFVPSSGRIYSFGLGGNGQLG 328          
BLAST of Retinitis pigmentosa GTPase regulator b vs. TrEMBL
Match: A0A288XNL1 (Retinitis pigmentosa GTPase regulator OS=Leptochiton asellus OX=211853 GN=RPGR PE=2 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 3.020e-83
Identity = 172/389 (44.22%), Postives = 223/389 (57.33%), Query Frame = 1
Query:   55 MTLIDENYIPETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLG-DSFQENQSTPQGI-LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNR 1209
            M   D++ IPETGA+F FG     E +  K W++NDK+I   CGDE   L+  SGR F +G NDWGQLGL   K    PSCIK+LK  +E   LVACGR HTI+ TES  LY FG N + QLG+DD   S ++PK + +      C L AG + SAA+   G ++VWGS SE QLGLG  S+    KP  L F K  V+ + CG YH A ++ +G LY +GE    KLG     E  +TPQ +  IK  +K VSCG +HTV ++E G VY +G G +GQLG G   L    P +L+           S+E   + +  S GESHT + T +G   +FGDGRHGKLG   G  +++N   P  +   DK L+V  V CGGCH + L   R
Sbjct:    1 MAPEDDSEIPETGAVFTFGRSRFAENIPNKFWVRNDKVILTGCGDEHTALVAESGRIFTFGSNDWGQLGLGHTKPATKPSCIKSLK--HENITLVACGRAHTIVATESGLLYAFGANGENQLGVDDTPGS-NDPKCLDTLEPMEYCMLSAGADHSAALTGDGSVFVWGSGSEGQLGLG--SETECPKPKELPFDKF-VTCIACGYYHTALVTDEGDLYTFGETDGGKLGLGEDPEEYNTPQHVTAIKERVKWVSCGGSHTVAVTEKGKVYTFGNGANGQLGQGTSMLELSVPHMLK-----------SIEG--RVVLSSCGESHTALVTDRGQLYTFGDGRHGKLGL--GMESFANQFKPCKVKRFDK-LFVEKVACGGCHMLALGHPR 367          
BLAST of Retinitis pigmentosa GTPase regulator b vs. TrEMBL
Match: B3RXM0 (Uncharacterized protein OS=Trichoplax adhaerens OX=10228 GN=TRIADDRAFT_56257 PE=4 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 8.286e-81
Identity = 163/382 (42.67%), Postives = 229/382 (59.95%), Query Frame = 1
Query:   64 IDENYIPETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAI-SQGRLYVWGEYTNQKLG-DSFQENQSTPQGILIKIPIK--QVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVV 1194
            +D+N IPETGA+F FG+   G+    K WI++DK+  ++CGDE  V++T +GR F +G N+WGQLG+   KT   P+ +KALK   EK   VA GR HT+  T+S KLY FG  ++G LG  D+ +  + P  I S    ++  +  GG  SAAI + G+LY+WGSNSE QLGL    ++ I  PT+L   KS +S V CG YH A + + G+LY +GE    KLG    + ++ T   ++  I  K  +V+CG NHTV L+ +G VY +G G +GQLGLG   + S  PKL+           ++L S  K  +I+ GESHT + + KG   +FGDGRHGKLG   G  ++SN   P  +  L K+  V ++ CGGCHT+V
Sbjct:    3 VDDNDIPETGAVFTFGKSRFGDNRTNKFWIRSDKVTDIACGDEHTVVVTENGRLFTFGNNEWGQLGIGSNKTRNKPTTVKALK--PEKITHVAAGRFHTLAVTDSNKLYSFGQGSEGALGHGDE-TDLNMPTSIESLEDKDVNIIACGGYHSAAITKNGELYIWGSNSEGQLGL---KNDTISYPTMLDLGKSVIS-VACGYYHTAVVTADGKLYTFGETEGGKLGLGDIEAHKVTKPKVVKGISGKVVKVACGGNHTVALTASGQVYTFGSGQNGQLGLGSKIMDSNIPKLV-----------EAL-SKRKIKHIACGESHTAVVSDKGELFTFGDGRHGKLGQ--GDESFSNLFKPVKVQRL-KEFIVLHIACGGCHTIV 362          

HSP 2 Score: 102.834 bits (255), Expect = 5.686e-19
Identity = 72/249 (28.92%), Postives = 124/249 (49.80%), Query Frame = 1
Query:  469 WIYGN-ICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFK-SPVSYVDCGNYHAAAISQG-RLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLV 1200
            WI  + +  +  G E +  + E G+L+ +G+N   QLG+G  S++   KPT +   K   +++V  G +H  A++   +LY +G+ +   LG   + + + P  I  L    +  ++CG  H+  +++NG++Y+WG    GQLGL    +S  +P +L +        G S+      I+++ G  HT + T  G   +FG+   GKLG +G    +     PK++  +     V  V CGG HTV L 
Sbjct:   31 WIRSDKVTDIACGDEHTVVVTENGRLFTFGNNEWGQLGIG--SNKTRNKPTTVKALKPEKITHVAAGRFHTLAVTDSNKLYSFGQGSEGALGHGDETDLNMPTSIESLEDKDVNIIACGGYHSAAITKNGELYIWGSNSEGQLGLKNDTIS--YPTMLDL--------GKSV------ISVACGYYHTAVVTADGKLYTFGETEGGKLG-LGDIEAH-KVTKPKVVKGISGK--VVKVACGGNHTVALT 257          

HSP 3 Score: 62.7734 bits (151), Expect = 1.992e-6
Identity = 41/142 (28.87%), Postives = 71/142 (50.00%), Query Frame = 1
Query:  790 IKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANL-DKDLWVYNVQCGGCHTVVLVRNRE 1212
            +  ++CG  HTV ++ENG ++ +G  + GQLG+G +   ++ P  ++                EK  +++AG  HT+  T      SFG G  G LG+     + ++   P  I +L DKD+ +  + CGG H+  + +N E
Sbjct:   37 VTDIACGDEHTVVVTENGRLFTFGNNEWGQLGIGSNKTRNK-PTTVKALK------------PEKITHVAAGRFHTLAVTDSNKLYSFGQGSEGALGH----GDETDLNMPTSIESLEDKDVNI--IACGGYHSAAITKNGE 159          
BLAST of Retinitis pigmentosa GTPase regulator b vs. TrEMBL
Match: T2M8L1 (X-linked retinitis pigmentosa GTPase regulator (Fragment) OS=Hydra vulgaris OX=6087 GN=RPGR PE=2 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 1.837e-80
Identity = 166/395 (42.03%), Postives = 227/395 (57.47%), Query Frame = 1
Query:   67 DENYIPETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQE--NQSTPQGILIKIPIKQ---VSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNRESHELIN 1230
            D++ IP+ GA+F FG+    + +  K WIKND ++ ++CGDE   ++T SGR + +G NDWGQLGL   K+   PS +K LK   EK   VACGR HTI+++ES KL+ FGCN DGQLG  DK +    PKEI S     I Q+  G   S  ++E G +YVWG+N+E QLGLG+  +  +  P  L F K  VS V CG YH A +++ G LY +GE    KLG S  +  N + PQ + +     +   VSCG  HTV +++ G  Y WG G  GQLG G   L    PK ++      K SG      +K I++S GESHT + T  G   +FGDGRHGKLG   G  ++SN   P  ++  +    VY V CGGCHT+VL  ++   + ++
Sbjct:    7 DDDQIPDLGAVFTFGKSKFADNIANKFWIKNDGVVEMACGDEHSAVVTESGRLYVFGSNDWGQLGLGHTKSLNKPSFVKPLK--PEKVRKVACGRNHTIVYSESGKLFSFGCNEDGQLGHVDKENELL-PKEIESIPQMEIKQIACGTYHSIILSEDGDVYVWGNNNEGQLGLGEEVENSL--PKKLKFKKEVVS-VSCGYYHTALVTRDGFLYTFGENELGKLGLSSSQLSNTTVPQSVAMPADNDEYISVSCGARHTVAITKQGHCYAWGDGSQGQLGHGTKLLEVNEPKQIK------KLSG------QKCISVSCGESHTAVVTESGKVFTFGDGRHGKLGQ--GEDSFSNSFDPVYLSRFNYFNVVY-VSCGGCHTLVLAVHKNKDDFVD 380          
BLAST of Retinitis pigmentosa GTPase regulator b vs. TrEMBL
Match: A0A369S3Q9 (X-linked retinitis pigmentosa GTPase regulator OS=Trichoplax sp. H2 OX=287889 GN=TrispH2_007725 PE=4 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 3.459e-80
Identity = 163/382 (42.67%), Postives = 229/382 (59.95%), Query Frame = 1
Query:   64 IDENYIPETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAI-SQGRLYVWGEYTNQKLG-DSFQENQSTPQGILIKIPIK--QVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVV 1194
            +D+N IPETGA+F FG+   G+    K WI++DK+  ++CGDE  V++T +GR F +G N+WGQLG+   KT   P+ +KALK   EK   VA GR HT+  T+S KLY FG  ++G LG  D+ +  + P  I S    ++  +  GG  SAAI + G+LY+WGSNSE QLGL    ++ I  PT+L   KS +S V CG YH A + + G+LY +GE    KLG    + ++ T   ++  I  K  +V+CG NHTV L+ +G VY +G G +GQLGLG   + S  PKL+           ++L S  K  +I+ GESHT + + KG   +FGDGRHGKLG   G  ++SN   P  +  L K+  V ++ CGGCHT+V
Sbjct:    3 VDDNDIPETGAVFTFGKSRFGDNRTNKFWIRSDKVTDIACGDEHTVVVTENGRLFTFGNNEWGQLGIGSNKTRNKPTTVKALK--PEKITHVAAGRFHTLALTDSNKLYSFGQGSEGALGHGDE-TDLNMPTSIESLEDKDVNIIACGGYHSAAITKNGELYIWGSNSEGQLGL---KNDTISYPTMLDLGKSVIS-VACGYYHTAVVTADGKLYTFGETEGGKLGLGDIEAHKVTKPKVVKGISGKVVKVACGGNHTVALTASGQVYTFGSGQNGQLGLGSKIMDSNIPKLV-----------EAL-SKRKIKHIACGESHTAVVSDKGELFTFGDGRHGKLGQ--GDESFSNLFKPVKVQRL-KEFIVLHIACGGCHTIV 362          

HSP 2 Score: 102.449 bits (254), Expect = 8.806e-19
Identity = 72/249 (28.92%), Postives = 124/249 (49.80%), Query Frame = 1
Query:  469 WIYGN-ICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFK-SPVSYVDCGNYHAAAISQG-RLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLV 1200
            WI  + +  +  G E +  + E G+L+ +G+N   QLG+G  S++   KPT +   K   +++V  G +H  A++   +LY +G+ +   LG   + + + P  I  L    +  ++CG  H+  +++NG++Y+WG    GQLGL    +S  +P +L +        G S+      I+++ G  HT + T  G   +FG+   GKLG +G    +     PK++  +     V  V CGG HTV L 
Sbjct:   31 WIRSDKVTDIACGDEHTVVVTENGRLFTFGNNEWGQLGIG--SNKTRNKPTTVKALKPEKITHVAAGRFHTLALTDSNKLYSFGQGSEGALGHGDETDLNMPTSIESLEDKDVNIIACGGYHSAAITKNGELYIWGSNSEGQLGLKNDTIS--YPTMLDL--------GKSV------ISVACGYYHTAVVTADGKLYTFGETEGGKLG-LGDIEAHK-VTKPKVVKGISGK--VVKVACGGNHTVALT 257          

HSP 3 Score: 62.003 bits (149), Expect = 3.614e-6
Identity = 41/142 (28.87%), Postives = 71/142 (50.00%), Query Frame = 1
Query:  790 IKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANL-DKDLWVYNVQCGGCHTVVLVRNRE 1212
            +  ++CG  HTV ++ENG ++ +G  + GQLG+G +   ++ P  ++                EK  +++AG  HT+  T      SFG G  G LG+     + ++   P  I +L DKD+ +  + CGG H+  + +N E
Sbjct:   37 VTDIACGDEHTVVVTENGRLFTFGNNEWGQLGIGSNKTRNK-PTTVKAL------------KPEKITHVAAGRFHTLALTDSNKLYSFGQGSEGALGHG----DETDLNMPTSIESLEDKDVNI--IACGGYHSAAITKNGE 159          
BLAST of Retinitis pigmentosa GTPase regulator b vs. TrEMBL
Match: B7ZR07 (RPGR OS=Xenopus laevis OX=8355 GN=LOC734172 PE=2 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 1.380e-79
Identity = 163/400 (40.75%), Postives = 234/400 (58.50%), Query Frame = 1
Query:   70 ENYIPETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSW-IYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLG---DSFQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLV--RNRESHELINEIISE 1245
            E+ +P++GALF FG+    E + +K W+KNDK   +SCGDE  VL+T +G+ + +G N+WGQLGL        P+C+KALK  +EK +  +CGR HT+++TE  KLY  G N++GQLGL D    TS  +EI+ +     I QL AG   SAA+   GKL++WG NSE QLGL     E IY          P+S++ CG YH+A ++Q G LY +GE  N KLG   D  ++++   +   +   +K VSCG  HT+ ++E  +VY +G G  GQLG G     ++ PK +   ++L K +          + ++ GE+HT + T KGL  +FGDGRHGKLG   G  N++N   P L +N  K   V +V CGGCH +V    R +ES  +IN+ + E
Sbjct:    7 EDQVPDSGALFTFGKSKFAENIPSKFWLKNDKPAHISCGDEHTVLVTGNGKLYVFGSNNWGQLGLEAGSAISKPTCVKALK--SEKVVFASCGRNHTLLYTEQGKLYSSGGNSEGQLGLGDTSGRTSF-QEISFFNTQYKIKQLSAGSNTSAALTVDGKLFMWGDNSEGQLGL---EKEAIYSTPQKIDIGKPISWISCGYYHSAFVTQDGELYTFGEPENGKLGLPSDKLKKHKKPQRVSGLSGKVKIVSCGGEHTIAVTEK-EVYTFGLGQFGQLGHGTFIFETQLPKAV---DVLTKKT---------ILYVTCGENHTAVITDKGLLYTFGDGRHGKLG--LGEENFTNQFVPILCSNFLK-FTVQSVACGGCHMLVFATPRPKESEMMINDELKE 384          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Cavefish
Match: rpgrb (X-linked retinitis pigmentosa GTPase regulator-like [Source:NCBI gene;Acc:103026867])

HSP 1 Score: 253.447 bits (646), Expect = 8.917e-72
Identity = 161/389 (41.39%), Postives = 220/389 (56.56%), Query Frame = 1
Query:   70 ENYIPETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTL-TPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQE--NQSTPQGIL-IKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQ---CGGCHTVVLVRNR 1209
            E+ IPE+GA+F FG+    +   +K W+KND  + ++CGDE   LIT SG+ F +G ++WGQLGL  IKT++  P+C+KALK  +EK  LVACGR HT+++T    LY  G N++GQLGL      TS          G I  L AG   SAA+ + GKLYVWG NSE Q+GLG  +      P  LS  +  V++V CG YH+A ++  G L+ +GE  + KLG S  +  N   PQ +  I   + QV+CG  HTV L+E+  +Y +G G  GQLG G     +  P+ +       KG         +  +I+ GE+HT + T  G+  +FGDGRHGKLG   G  N++N   P L     K    YNVQ   CGGCH +VL + R
Sbjct:    6 EDDIPESGAVFTFGKSKFADNAPSKFWLKNDIPLKVACGDEHTALITESGKLFMFGSSNWGQLGLG-IKTSVNKPTCVKALK--SEKVKLVACGRTHTLVYTSRGNLYAAGGNDEGQLGLGHYEERTSFHLVDFFTKLGPIKMLAAGSNTSAALMQDGKLYVWGDNSEGQIGLGKEAGAAT--PRDLSVGRR-VAWVSCGYYHSAFVTVDGALFTFGERDSGKLGLSPAQLPNHKVPQHVEGISDRVLQVACGGGHTVALTEDY-LYSFGLGQFGQLGHGTFIFEARLPREV---EHFRKG---------RVKHITCGENHTAVITESGVLYTFGDGRHGKLGL--GEENFTNQFRPTLCPRFLK----YNVQSVTCGGCHMLVLAKPR 369          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Cavefish
Match: RPGR (retinitis pigmentosa GTPase regulator [Source:HGNC Symbol;Acc:HGNC:10295])

HSP 1 Score: 200.675 bits (509), Expect = 3.967e-55
Identity = 130/350 (37.14%), Postives = 191/350 (54.57%), Query Frame = 1
Query:   85 ETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQE--NQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWP 1122
            E+GA+F FG+    + + +K W+KNDK + +SCG      +T  GR F +G N  GQLGL        P C+KALK  +E+    ACG  HT++ T   +++  G N++GQLGL      TS  +         + QL AG   SAA+ E G+L++WG NS  QLGLG  S+ ++  P LL   +S V+ + CG  H+A I+  G +Y +GE  + +LG S  +  N   PQ +     + QVSCG  HT+ L+EN ++Y +G G+ GQLGLG     ++ P  +       KG         +  +++ GE+HT + T  GL  +FGDGR+GKLG   G  N++N   P
Sbjct:   38 ESGAVFTFGKSQIADSVPSKFWLKNDKPVLISCGHSHSAFVTEHGRLFVFGSNSSGQLGLESKGPITKPVCVKALK--HERVRFTACGTNHTLVSTSRGEIFAAGRNSEGQLGLGHCEERTSFQQLHPFCDGAPLKQLSAGCNTSAALTEDGRLFMWGDNSVGQLGLG--SENLVLFPKLLKVDRS-VTGISCGLNHSALITDIGDVYTFGEAADGRLGLSADQLANHRQPQRVGSLEGVLQVSCGGTHTLALTEN-ELYAFGHGEFGQLGLGTFDFQADSPAPV---GHFRKG---------RVTHVTCGENHTALITDGGLLYTFGDGRYGKLGL--GDENFTNQFTP 367          

HSP 2 Score: 107.071 bits (266), Expect = 9.732e-24
Identity = 78/243 (32.10%), Postives = 119/243 (48.97%), Query Frame = 1
Query:  493 LKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFK-SPVSYVDCGNYHA-AAISQGRLYVWGEYTNQKLGDSFQENQSTPQGI---LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRN 1206
            +  G   SA + E G+L+V+GSNS  QLGL   S   I KP  +   K   V +  CG  H   + S+G ++  G  +  +LG    E +++ Q +       P+KQ+S G N +  L+E+G +++WG    GQLGLG   L   FPKLL++   +                IS G +H+ + T  G   +FG+   G+LG    A   +N+  P+ + +L+    V  V CGG HT+ L  N
Sbjct:   68 ISCGHSHSAFVTEHGRLFVFGSNSSGQLGL--ESKGPITKPVCVKALKHERVRFTACGTNHTLVSTSRGEIFAAGRNSEGQLGLGHCEERTSFQQLHPFCDGAPLKQLSAGCNTSAALTEDGRLFMWGDNSVGQLGLGSENLVL-FPKLLKVDRSVT--------------GISCGLNHSALITDIGDVYTFGEAADGRLGL--SADQLANHRQPQRVGSLE---GVLQVSCGGTHTLALTEN 288          

HSP 3 Score: 73.1738 bits (178), Expect = 4.998e-13
Identity = 58/196 (29.59%), Postives = 89/196 (45.41%), Query Frame = 1
Query:   79 IPETGALFNFGE-------IGGEELET--KLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGL--NDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFF 633
            + E G LF +G+       +G E L    KL   +  +  +SCG     LIT  G  + +G+   G+LGL  + +     P  + +L    E  + V+CG  HT+  TE++ LY FG    GQLGL         P  +  +  G +  +  G   +A I + G LY +G     +LGLGD +    + PT+   F
Sbjct:  183 LTEDGRLFMWGDNSVGQLGLGSENLVLFPKLLKVDRSVTGISCGLNHSALITDIGDVYTFGEAADGRLGLSADQLANHRQPQRVGSL----EGVLQVSCGGTHTLALTENE-LYAFGHGEFGQLGLGTFDFQADSPAPVGHFRKGRVTHVTCGENHTALITDGGLLYTFGDGRYGKLGLGDENFTNQFTPTVCQRF 373          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Cavefish
Match: herc3 (HECT and RLD domain containing E3 ubiquitin protein ligase 3 [Source:NCBI gene;Acc:103047299])

HSP 1 Score: 132.88 bits (333), Expect = 8.822e-32
Identity = 86/271 (31.73%), Postives = 140/271 (51.66%), Query Frame = 1
Query:  109 GEIG----GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTL-TPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKS-PVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVC-LSENGDVYVWGKGDSGQLGLG 891
            G++G    G + E  + +   KI  ++CGD   + +   G+ F +G  + GQLGL  ++  +  P  IK L     +   V CG  H I   +  +L+ +G N+ GQLGL     S+  P+ + S     + Q+ AGG+ S A++ +G ++ WG NS  QLGL D  D  +  P  + F +S  V Y+ CG+ H AA+++ G L+ +G  +  +LG     N+  P+ +  L+   + Q+ CG +HT+  +   G VY +G    GQLGL 
Sbjct:   63 GQLGHEKPGNKPELVVALDAQKIAGVACGDAHSLAVNEQGQVFAWGTGEKGQLGLGTVEEAVRVPRLIKKL--CEHRISQVMCGNQHCIALAKDGQLFTWGQNSSGQLGLGKGEPSSLSPQPLKSLCGIPLAQISAGGDHSFALSLSGAVFGWGRNSAGQLGLNDEQDRAV--PCHIKFLRSQKVVYISCGDEHTAALTKDGGLFTFGNGSRGQLGHDSTNNEPLPRRVLELMGTEVSQIVCGKHHTLAFVPSTGLVYAFGCNAHGQLGLA 329          

HSP 2 Score: 130.568 bits (327), Expect = 4.922e-31
Identity = 101/333 (30.33%), Postives = 161/333 (48.35%), Query Frame = 1
Query:  229 YGKNDWGQLGLNDIKTTLT-PSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLL-SFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQS-TPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFP---KLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLV 1200
            +G + WGQLGL D +  +  P   +       K   VAC   H++       +Y  G N+ GQLG +      ++P+ + +     I  +  G   S A+NE G+++ WG+  + QLGLG   +E +  P L+    +  +S V CGN H  A+++ G+L+ WG+ ++ +LG    E  S +PQ +  L  IP+ Q+S G +H+  LS +G V+ WG+  +GQLGL         P   K LR               ++K + IS G+ HT   T  G   +FG+G  G+LG+     + +N   P+ +  L     V  + CG  HT+  V
Sbjct:    4 WGSSAWGQLGLGDAEPVVAEPRSCRMFSGRGLKE--VACRGQHSLFLLHDGSVYSCGSNSHGQLGHEKP---GNKPELVVALDAQKIAGVACGDAHSLAVNEQGQVFAWGTGEKGQLGLGT-VEEAVRVPRLIKKLCEHRISQVMCGNQHCIALAKDGQLFTWGQNSSGQLGLGKGEPSSLSPQPLKSLCGIPLAQISAGGDHSFALSLSGAVFGWGRNSAGQLGLNDEQ-DRAVPCHIKFLR---------------SQKVVYISCGDEHTAALTKDGGLFTFGNGSRGQLGH----DSTNNEPLPRRVLEL-MGTEVSQIVCGKHHTLAFV 309          

HSP 3 Score: 118.242 bits (295), Expect = 4.234e-27
Identity = 90/315 (28.57%), Postives = 148/315 (46.98%), Query Frame = 1
Query:  172 LSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTV-ITTTKGLALSFGDGRHGKLG--NIGGAR 1098
            ++C  +  + +   G  +  G N  GQLG    K    P  + AL    +K   VACG  H++   E  +++ +G    GQLGL     +   P+ I       I Q+  G +   A+ + G+L+ WG NS  QLGLG      +    L S    P++ +  G  H+ A+S  G ++ WG  +  +LG + +++++ P  I  L    +  +SCG  HT  L+++G ++ +G G  GQLG   H  ++  P    +P  +++  G  +        I  G+ HT+    + GL  +FG   HG+LG  N G AR
Sbjct:   38 VACRGQHSLFLLHDGSVYSCGSNSHGQLGHE--KPGNKPELVVALDA--QKIAGVACGDAHSLAVNEQGQVFAWGTGEKGQLGLGTVEEAVRVPRLIKKLCEHRISQVMCGNQHCIALAKDGQLFTWGQNSSGQLGLGKGEPSSLSPQPLKSLCGIPLAQISAGGDHSFALSLSGAVFGWGRNSAGQLGLNDEQDRAVPCHIKFLRSQKVVYISCGDEHTAALTKDGGLFTFGNGSRGQLG---HDSTNNEP----LPRRVLELMGTEVS------QIVCGKHHTLAFVPSTGLVYAFGCNAHGQLGLANRGNAR 335          

HSP 4 Score: 85.8853 bits (211), Expect = 6.834e-17
Identity = 60/217 (27.65%), Postives = 113/217 (52.07%), Query Frame = 1
Query:  160 KIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIK-TTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAI--SQGRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQV 801
            +I  + CG++ C+ + + G+ F +G+N  GQLGL   + ++L+P  +K+L  +    I  + G  H+   + S  ++G+G N+ GQLGL+D+    + P  I       +  +  G E +AA+ + G L+ +G+ S  QLG    ++E + +  +L    + VS + CG +H  A   S G +Y +G   + +LG + + N   P      +P++ +
Sbjct:  137 RISQVMCGNQHCIALAKDGQLFTWGQNSSGQLGLGKGEPSSLSPQPLKSLCGIPLAQI--SAGGDHSFALSLSGAVFGWGRNSAGQLGLNDE-QDRAVPCHIKFLRSQKVVYISCGDEHTAALTKDGGLFTFGNGSRGQLGHDSTNNEPLPR-RVLELMGTEVSQIVCGKHHTLAFVPSTGLVYAFGCNAHGQLGLANRGNARIP------LPVRNI 343          

HSP 5 Score: 64.6994 bits (156), Expect = 2.664e-10
Identity = 32/97 (32.99%), Postives = 53/97 (54.64%), Query Frame = 1
Query:  145 WIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKL-YGFGCNNDGQLGLDDK 432
            ++++ K++ +SCGDE    +T+ G  F +G    GQLG +       P   + L+ +  +   + CG+ HT+ +  S  L Y FGCN  GQLGL ++
Sbjct:  237 FLRSQKVVYISCGDEHTAALTKDGGLFTFGNGSRGQLGHDSTNNEPLPR--RVLELMGTEVSQIVCGKHHTLAFVPSTGLVYAFGCNAHGQLGLANR 331          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Cavefish
Match: herc3 (HECT and RLD domain containing E3 ubiquitin protein ligase 3 [Source:NCBI gene;Acc:103047299])

HSP 1 Score: 132.494 bits (332), Expect = 1.153e-31
Identity = 86/271 (31.73%), Postives = 140/271 (51.66%), Query Frame = 1
Query:  109 GEIG----GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTL-TPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKS-PVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVC-LSENGDVYVWGKGDSGQLGLG 891
            G++G    G + E  + +   KI  ++CGD   + +   G+ F +G  + GQLGL  ++  +  P  IK L     +   V CG  H I   +  +L+ +G N+ GQLGL     S+  P+ + S     + Q+ AGG+ S A++ +G ++ WG NS  QLGL D  D  +  P  + F +S  V Y+ CG+ H AA+++ G L+ +G  +  +LG     N+  P+ +  L+   + Q+ CG +HT+  +   G VY +G    GQLGL 
Sbjct:   63 GQLGHEKPGNKPELVVALDAQKIAGVACGDAHSLAVNEQGQVFAWGTGEKGQLGLGTVEEAVRVPRLIKKL--CEHRISQVMCGNQHCIALAKDGQLFTWGQNSSGQLGLGKGEPSSLSPQPLKSLCGIPLAQISAGGDHSFALSLSGAVFGWGRNSAGQLGLNDEQDRAV--PCHIKFLRSQKVVYISCGDEHTAALTKDGGLFTFGNGSRGQLGHDSTNNEPLPRRVLELMGTEVSQIVCGKHHTLAFVPSTGLVYAFGCNAHGQLGLA 329          

HSP 2 Score: 129.798 bits (325), Expect = 7.414e-31
Identity = 101/333 (30.33%), Postives = 161/333 (48.35%), Query Frame = 1
Query:  229 YGKNDWGQLGLNDIKTTLT-PSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLL-SFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQS-TPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFP---KLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLV 1200
            +G + WGQLGL D +  +  P   +       K   VAC   H++       +Y  G N+ GQLG +      ++P+ + +     I  +  G   S A+NE G+++ WG+  + QLGLG   +E +  P L+    +  +S V CGN H  A+++ G+L+ WG+ ++ +LG    E  S +PQ +  L  IP+ Q+S G +H+  LS +G V+ WG+  +GQLGL         P   K LR               ++K + IS G+ HT   T  G   +FG+G  G+LG+     + +N   P+ +  L     V  + CG  HT+  V
Sbjct:    4 WGSSAWGQLGLGDAEPVVAEPRSCRMFSGRGLKE--VACRGQHSLFLLHDGSVYSCGSNSHGQLGHE---KPGNKPELVVALDAQKIAGVACGDAHSLAVNEQGQVFAWGTGEKGQLGLGT-VEEAVRVPRLIKKLCEHRISQVMCGNQHCIALAKDGQLFTWGQNSSGQLGLGKGEPSSLSPQPLKSLCGIPLAQISAGGDHSFALSLSGAVFGWGRNSAGQLGLNDEQ-DRAVPCHIKFLR---------------SQKVVYISCGDEHTAALTKDGGLFTFGNGSRGQLGH----DSTNNEPLPRRVLEL-MGTEVSQIVCGKHHTLAFV 309          

HSP 3 Score: 122.865 bits (307), Expect = 1.576e-28
Identity = 102/355 (28.73%), Postives = 164/355 (46.20%), Query Frame = 1
Query:  172 LSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTV-ITTTKGLALSFGDGRHGKLG--NIGGAR---NYSNYMWPKLIANLDKDLWVY---NVQCGGCHTVVLV 1200
            ++C  +  + +   G  +  G N  GQLG    K    P  + AL    +K   VACG  H++   E  +++ +G    GQLGL     +   P+ I       I Q+  G +   A+ + G+L+ WG NS  QLGLG      +    L S    P++ +  G  H+ A+S  G ++ WG  +  +LG + +++++ P  I  L    +  +SCG  HT  L+++G ++ +G G  GQLG   H  ++  P   R+  L+  G+  S         I  G+ HT+    + GL  +FG   HG+LG  N G AR      N   P L ++   D   Y    + CGG H+ +L+
Sbjct:   38 VACRGQHSLFLLHDGSVYSCGSNSHGQLGHE--KPGNKPELVVALDA--QKIAGVACGDAHSLAVNEQGQVFAWGTGEKGQLGLGTVEEAVRVPRLIKKLCEHRISQVMCGNQHCIALAKDGQLFTWGQNSSGQLGLGKGEPSSLSPQPLKSLCGIPLAQISAGGDHSFALSLSGAVFGWGRNSAGQLGLNDEQDRAVPCHIKFLRSQKVVYISCGDEHTAALTKDGGLFTFGNGSRGQLG---HDSTNNEPLPRRVLELM--GTEVS--------QIVCGKHHTLAFVPSTGLVYAFGCNAHGQLGLANRGNARIPLPVRNIQPPYLSSSQTSDTDHYIPSRIHCGGDHSFLLL 375          

HSP 4 Score: 85.5001 bits (210), Expect = 8.022e-17
Identity = 60/217 (27.65%), Postives = 113/217 (52.07%), Query Frame = 1
Query:  160 KIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIK-TTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAI--SQGRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQV 801
            +I  + CG++ C+ + + G+ F +G+N  GQLGL   + ++L+P  +K+L  +    I  + G  H+   + S  ++G+G N+ GQLGL+D+    + P  I       +  +  G E +AA+ + G L+ +G+ S  QLG    ++E + +  +L    + VS + CG +H  A   S G +Y +G   + +LG + + N   P      +P++ +
Sbjct:  137 RISQVMCGNQHCIALAKDGQLFTWGQNSSGQLGLGKGEPSSLSPQPLKSLCGIPLAQI--SAGGDHSFALSLSGAVFGWGRNSAGQLGLNDE-QDRAVPCHIKFLRSQKVVYISCGDEHTAALTKDGGLFTFGNGSRGQLGHDSTNNEPLPR-RVLELMGTEVSQIVCGKHHTLAFVPSTGLVYAFGCNAHGQLGLANRGNARIP------LPVRNI 343          

HSP 5 Score: 64.3142 bits (155), Expect = 2.912e-10
Identity = 32/97 (32.99%), Postives = 53/97 (54.64%), Query Frame = 1
Query:  145 WIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKL-YGFGCNNDGQLGLDDK 432
            ++++ K++ +SCGDE    +T+ G  F +G    GQLG +       P   + L+ +  +   + CG+ HT+ +  S  L Y FGCN  GQLGL ++
Sbjct:  237 FLRSQKVVYISCGDEHTAALTKDGGLFTFGNGSRGQLGHDSTNNEPLPR--RVLELMGTEVSQIVCGKHHTLAFVPSTGLVYAFGCNAHGQLGLANR 331          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Cavefish
Match: herc3 (HECT and RLD domain containing E3 ubiquitin protein ligase 3 [Source:NCBI gene;Acc:103047299])

HSP 1 Score: 131.724 bits (330), Expect = 1.841e-31
Identity = 86/271 (31.73%), Postives = 140/271 (51.66%), Query Frame = 1
Query:  109 GEIG----GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTL-TPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKS-PVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVC-LSENGDVYVWGKGDSGQLGLG 891
            G++G    G + E  + +   KI  ++CGD   + +   G+ F +G  + GQLGL  ++  +  P  IK L     +   V CG  H I   +  +L+ +G N+ GQLGL     S+  P+ + S     + Q+ AGG+ S A++ +G ++ WG NS  QLGL D  D  +  P  + F +S  V Y+ CG+ H AA+++ G L+ +G  +  +LG     N+  P+ +  L+   + Q+ CG +HT+  +   G VY +G    GQLGL 
Sbjct:   63 GQLGHEKPGNKPELVVALDAQKIAGVACGDAHSLAVNEQGQVFAWGTGEKGQLGLGTVEEAVRVPRLIKKL--CEHRISQVMCGNQHCIALAKDGQLFTWGQNSSGQLGLGKGEPSSLSPQPLKSLCGIPLAQISAGGDHSFALSLSGAVFGWGRNSAGQLGLNDEQDRAV--PCHIKFLRSQKVVYISCGDEHTAALTKDGGLFTFGNGSRGQLGHDSTNNEPLPRRVLELMGTEVSQIVCGKHHTLAFVPSTGLVYAFGCNAHGQLGLA 329          

HSP 2 Score: 129.028 bits (323), Expect = 1.378e-30
Identity = 101/333 (30.33%), Postives = 161/333 (48.35%), Query Frame = 1
Query:  229 YGKNDWGQLGLNDIKTTLT-PSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLL-SFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQS-TPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFP---KLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLV 1200
            +G + WGQLGL D +  +  P   +       K   VAC   H++       +Y  G N+ GQLG +      ++P+ + +     I  +  G   S A+NE G+++ WG+  + QLGLG   +E +  P L+    +  +S V CGN H  A+++ G+L+ WG+ ++ +LG    E  S +PQ +  L  IP+ Q+S G +H+  LS +G V+ WG+  +GQLGL         P   K LR               ++K + IS G+ HT   T  G   +FG+G  G+LG+     + +N   P+ +  L     V  + CG  HT+  V
Sbjct:    4 WGSSAWGQLGLGDAEPVVAEPRSCRMFSGRGLKE--VACRGQHSLFLLHDGSVYSCGSNSHGQLGHE---KPGNKPELVVALDAQKIAGVACGDAHSLAVNEQGQVFAWGTGEKGQLGLGT-VEEAVRVPRLIKKLCEHRISQVMCGNQHCIALAKDGQLFTWGQNSSGQLGLGKGEPSSLSPQPLKSLCGIPLAQISAGGDHSFALSLSGAVFGWGRNSAGQLGLNDEQ-DRAVPCHIKFLR---------------SQKVVYISCGDEHTAALTKDGGLFTFGNGSRGQLGH----DSTNNEPLPRRVLEL-MGTEVSQIVCGKHHTLAFV 309          

HSP 3 Score: 117.087 bits (292), Expect = 1.010e-26
Identity = 92/315 (29.21%), Postives = 148/315 (46.98%), Query Frame = 1
Query:  172 LSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTV-ITTTKGLALSFGDGRHGKLG--NIGGAR 1098
            ++C  +  + +   G  +  G N  GQLG    K    P  + AL    +K   VACG  H++   E  +++ +G    GQLGL     +   P+ I       I Q+  G +   A+ + G+L+ WG NS  QLGLG      +    L S    P++ +  G  H+ A+S  G ++ WG  +  +LG + +++++ P  I  L    +  +SCG  HT  L+++G ++ +G G  GQLG   H  ++  P   R+  L+  G+  S         I  G+ HT+    + GL  +FG   HG+LG  N G AR
Sbjct:   38 VACRGQHSLFLLHDGSVYSCGSNSHGQLGHE--KPGNKPELVVALDA--QKIAGVACGDAHSLAVNEQGQVFAWGTGEKGQLGLGTVEEAVRVPRLIKKLCEHRISQVMCGNQHCIALAKDGQLFTWGQNSSGQLGLGKGEPSSLSPQPLKSLCGIPLAQISAGGDHSFALSLSGAVFGWGRNSAGQLGLNDEQDRAVPCHIKFLRSQKVVYISCGDEHTAALTKDGGLFTFGNGSRGQLG---HDSTNNEPLPRRVLELM--GTEVS--------QIVCGKHHTLAFVPSTGLVYAFGCNAHGQLGLANRGNAR 335          

HSP 4 Score: 85.1149 bits (209), Expect = 1.096e-16
Identity = 60/217 (27.65%), Postives = 113/217 (52.07%), Query Frame = 1
Query:  160 KIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIK-TTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAI--SQGRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQV 801
            +I  + CG++ C+ + + G+ F +G+N  GQLGL   + ++L+P  +K+L  +    I  + G  H+   + S  ++G+G N+ GQLGL+D+    + P  I       +  +  G E +AA+ + G L+ +G+ S  QLG    ++E + +  +L    + VS + CG +H  A   S G +Y +G   + +LG + + N   P      +P++ +
Sbjct:  137 RISQVMCGNQHCIALAKDGQLFTWGQNSSGQLGLGKGEPSSLSPQPLKSLCGIPLAQI--SAGGDHSFALSLSGAVFGWGRNSAGQLGLNDE-QDRAVPCHIKFLRSQKVVYISCGDEHTAALTKDGGLFTFGNGSRGQLGHDSTNNEPLPR-RVLELMGTEVSQIVCGKHHTLAFVPSTGLVYAFGCNAHGQLGLANRGNARIP------LPVRNI 343          

HSP 5 Score: 64.3142 bits (155), Expect = 3.213e-10
Identity = 32/97 (32.99%), Postives = 53/97 (54.64%), Query Frame = 1
Query:  145 WIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKL-YGFGCNNDGQLGLDDK 432
            ++++ K++ +SCGDE    +T+ G  F +G    GQLG +       P   + L+ +  +   + CG+ HT+ +  S  L Y FGCN  GQLGL ++
Sbjct:  237 FLRSQKVVYISCGDEHTAALTKDGGLFTFGNGSRGQLGHDSTNNEPLPR--RVLELMGTEVSQIVCGKHHTLAFVPSTGLVYAFGCNAHGQLGLANR 331          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Sea Lamprey
Match: rcc1l (RCC1 like [Source:ZFIN;Acc:ZDB-GENE-060526-370])

HSP 1 Score: 95.1301 bits (235), Expect = 4.052e-21
Identity = 100/376 (26.60%), Postives = 168/376 (44.68%), Query Frame = 1
Query:  154 NDKIISLSCGDEFCVLITRSG---RAFGYGKNDWGQLGLNDIKTTLT----------PSCIKALKNLNEKAILVACGRCHTIIWTESK-KLYGFGCNNDGQLG---LDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLS--FFKSPVSYVDC-GNYHAAAISQGRLYVWGEYTNQKLG---DSFQENQSTPQGILIKIPIKQVSCGHNHTVC--LSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRN 1206
            +DKIIS +CG  F +L +++    + +G G N   Q+G +  ++  T          P  +  +++   + + VACGR H+++ T+++  ++  G N  GQ G   ++D++   S        I G + ++  G + S    E G+LY  G  ++ Q GLG +  E+   P  L       PV+ V   G++  A    G L+ WG    ++L    D+ Q N   P+ I +K   K        T+C  L+E G+V+VWG    G LG GP    +E P+ +  P+L  +      +   +   +  G  H     T+G   S+G    G LG   G  +   + W   +A       V +V CG  H+V L + 
Sbjct:   68 DDKIISAACGYGFTLLASKTKDLTKLWGAGLNIDSQIGFHRSRSDRTKSYDYILEPSPVPLPLVEHQQTRVLQVACGRAHSLVLTDNEGAVFSMGNNAYGQCGRVIIEDEVYKGSRLIHKIEGIEGKVVEVVCGQDHSLFRTEKGELYACGWGADGQTGLGSY--EMCSTPKRLGGDLSGEPVAQVASYGDFCLAVSESGELFGWGNSEYRQLAAITDAVQIN--VPKHIPLKNVGKVKMAAAGGTICGILNEEGEVFVWG---YGILGKGPRLSETETPEQIP-PSLFGR---TEFDPDIRVKTLRCGLHHFAAVNTRGELFSWGKNMRGCLGI--GRPDDQYFPWRVTVAGE-----VVDVACGVDHSVALAKT 425          

HSP 2 Score: 69.707 bits (169), Expect = 5.744e-13
Identity = 65/249 (26.10%), Postives = 106/249 (42.57%), Query Frame = 1
Query:  121 GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEV----IYKPTLLSFFK-SP---VSYVDCGNYHAAAI-SQGRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQVSCGHNHTVCLSEN 840
            G  L  K+     K++ + CG +  +  T  G  +  G    GQ GL   +   TP  +    +  E    VA      +  +ES +L+G+G +   QL         + PK I     G +    AGG     +NE G+++VWG      LG G    E        P+L    +  P   V  + CG +H AA+ ++G L+ WG+     LG    ++Q  P  + +   +  V+CG +H+V L++ 
Sbjct:  181 GSRLIHKIEGIEGKVVEVVCGQDHSLFRTEKGELYACGWGADGQTGLGSYEMCSTPKRLGGDLS-GEPVAQVASYGDFCLAVSESGELFGWGNSEYRQLAAITDAVQINVPKHIPLKNVGKVKMAAAGGTICGILNEEGEVFVWGYGI---LGKGPRLSETETPEQIPPSLFGRTEFDPDIRVKTLRCGLHHFAAVNTRGELFSWGKNMRGCLGIGRPDDQYFPWRVTVAGEVVDVACGVDHSVALAKT 425          

HSP 3 Score: 56.9954 bits (136), Expect = 6.631e-9
Identity = 92/368 (25.00%), Postives = 145/368 (39.40%), Query Frame = 1
Query:  214 GRAFGYGKNDWGQLGLNDI-----------KTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESK---KLYGFGCNNDGQLGL-----------DDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINET-GKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSF----FKSPVSYVDCGNYHAA-AISQGRLYVWGEYTNQKLGDSFQENQSTPQ---GILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIAN--LDKDLWVYNVQCGGCHTVVLVRNR 1209
            GR F +G    G LG+ +            K   TP  ++     ++K I  ACG   T++ +++K   KL+G G N D Q+G            D  +  +  P  +       + Q+  G   S  + +  G ++  G+N+  Q G     DEV YK + L       +  V  V CG  H+     +G LY  G   + + G    E  STP+   G L   P+ QV+   +  + +SE+G+++ WG  +  QL      +    PK   IP          L++  K    +AG +   I   +G    +G G  GK G           + P L      D D+ V  ++C G H    V  R
Sbjct:   27 GRVFVWGFTFTGALGIPNFVSPVSKRHKPRKIQFTPHRLET----DDKIISAACGYGFTLLASKTKDLTKLWGAGLNIDSQIGFHRSRSDRTKSYDYILEPSPVPLPLVEHQQTRVLQVACGRAHSLVLTDNEGAVFSMGNNAYGQCGRVIIEDEV-YKGSRLIHKIEGIEGKVVEVVCGQDHSLFRTEKGELYACGWGADGQTGLGSYEMCSTPKRLGGDLSGEPVAQVASYGDFCLAVSESGELFGWGNSEYRQLAAITDAVQINVPK--HIP----------LKNVGKVKMAAAGGTICGILNEEGEVFVWGYGILGK-GPRLSETETPEQIPPSLFGRTEFDPDIRVKTLRC-GLHHFAAVNTR 375          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Sea Lamprey
Match: NEK9 (NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC:18591])

HSP 1 Score: 93.9745 bits (232), Expect = 3.271e-20
Identity = 80/275 (29.09%), Postives = 131/275 (47.64%), Query Frame = 1
Query:  151 KNDKIISLS-----CGDEFCVLITRSGRAFGYGKNDWGQLGLN-DIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSD-----------EVIYK--PTL---LSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGD-SFQENQST--PQGILIKIPIKQVSCGHNHTVCLSE-NGDVYVWGKGDSGQLGLGP 894
            + DK++ L+     CGDEF V +T  G  F +G + +G +G N ++   +         N+N     ++CG CH +  T S  +Y +GC   G+LGL+   ++   PK +       I ++  G + +  +   GK+   G+N   +LGL   +            EVI K  PTL   LS +K  +  +  G  H+A I   GRL  +G   + +LG   F+++      +G L+   I  VSCG   T+  +E +  +Y WG  D+G+LG+ P
Sbjct:  400 RVDKLLGLAVRQVACGDEFTVCLTEQGEVFSFGSDYYGCMGCNGELGVEVLEPMPVQFFNIN-PVTQISCGDCHVMALTRSGAVYAWGCGEYGRLGLETD-ATEFYPKRVPLSNRWKITEVCCGTDGTFFLTAQGKVLACGNNEFNKLGLNQCTSGLRNRETSVFHEVIMKLMPTLVKQLSIYK--IRSISGGKTHSAVIDVCGRLLTFGHNKHGQLGTGDFKKHLGIVLHKGPLVGKLITMVSCGDGFTIAATEADNHIYAWGNTDNGRLGVMP 670          

HSP 2 Score: 88.9669 bits (219), Expect = 1.220e-18
Identity = 73/268 (27.24%), Postives = 127/268 (47.39%), Query Frame = 1
Query:  325 AILVACGRCHTIIWTESKKLYGF-----GCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFK-SPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGILI--KIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGP------HYLSSEFPK-LLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLG 1080
            A+ V     H    T  K+LY +     G    GQLG  DK +S  +PK +   +   + Q+  G EF+  + E G+++ +GS+    +G        + +P  + FF  +PV+ + CG+ H  A+++ G +Y WG     +LG      +  P+ + +  +  I +V CG + T  L+  G V   G  +  +LGL        +  +S F + ++++   LVK       S  K  +IS G++H+ +    G  L+FG  +HG+LG
Sbjct:  352 ALRVCASNTHFAAVTVEKELYTWANVQGGTKMVGQLGHKDK-ASYRQPKRVDKLLGLAVRQVACGDEFTVCLTEQGEVFSFGSDYYGCMGCNGELGVEVLEPMPVQFFNINPVTQISCGDCHVMALTRSGAVYAWGCGEYGRLGLETDATEFYPKRVPLSNRWKITEVCCGTDGTFFLTAQGKVLACGNNEFNKLGLNQCTSGLRNRETSVFHEVIMKLMPTLVKQL-----SIYKIRSISGGKTHSAVIDVCGRLLTFGHNKHGQLG 613          

HSP 3 Score: 64.3142 bits (155), Expect = 5.445e-11
Identity = 72/252 (28.57%), Postives = 109/252 (43.25%), Query Frame = 1
Query:  517 AAINETGKLYVW-----GSNSEYQLGLGDHSDEVIYK-PTLL-SFFKSPVSYVDCGNYHAAAIS-QGRLYVWG-EY-----TNQKLGDSFQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEF-PKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLG---NIGGARNYSNYMW----PKLIANLDKDLWVYNVQC---GGCHTVVL 1197
            AA+    +LY W     G+    QLG   H D+  Y+ P  +       V  V CG+     ++ QG ++ +G +Y      N +LG    E    P       P+ Q+SCG  H + L+ +G VY WG G+ G+LGL     ++EF PK  R+P          L +  K   +  G   T   T +G  L+ G+    KLG      G RN    ++     KL+  L K L +Y ++    G  H+ V+
Sbjct:  363 AAVTVEKELYTWANVQGGTKMVGQLG---HKDKASYRQPKRVDKLLGLAVRQVACGDEFTVCLTEQGEVFSFGSDYYGCMGCNGELGVEVLE--PMPVQFFNINPVTQISCGDCHVMALTRSGAVYAWGCGEYGRLGLETD--ATEFYPK--RVP----------LSNRWKITEVCCGTDGTFFLTAQGKVLACGNNEFNKLGLNQCTSGLRNRETSVFHEVIMKLMPTLVKQLSIYKIRSISGGKTHSAVI 595          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Sea Lamprey
Match: rcc2 (regulator of chromosome condensation 2 [Source:NCBI gene;Acc:406455])

HSP 1 Score: 92.4337 bits (228), Expect = 3.329e-20
Identity = 73/256 (28.52%), Postives = 118/256 (46.09%), Query Frame = 1
Query:  193 CVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGN--ICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIY-------------KPTLLSFFKSP-------------VSYVDCGNYHAAAI-SQGRLYVWGEYTNQKLGDSFQENQSTPQGI-LIKIPIK---QVSCGHNHTVCLSENGDVYVWG 861
            C+L+T  G+ + +G+ D GQLG  D+K    P  + AL  L    +  ACGR HT+  TE+  +  FG N+ GQLGL  K ++   PK+I   +Y    + ++  G EFS  ++  G LY +G     QLG   H+ +  +              P  +  F                V+ + CG+ H     SQ R++ WG     +LG S Q+++  P+ + +   P +    V  G++ +  + E G +Y WG
Sbjct:   66 CLLLTDLGQVYTWGRGDKGQLGHGDLKRVEAPRPVDALFKLT--VVAAACGRSHTLCITETGVVMAFGENHLGQLGLGTKSNAMPTPKQI---VYSGQPVVKVACGAEFSMLVDCKGNLYSFGCPEYGQLG---HNTDGRFLACSNRLEFVCELAPRRVLVFTERTRDGKVNTVPAVCVTDIACGSNHTLVRDSQRRVFSWGFGGYGRLGHSEQKDEMLPRLVKMFDFPGRGAASVHAGYSCSFAIIETGALYFWG 313          

HSP 2 Score: 62.3882 bits (150), Expect = 1.243e-10
Identity = 59/221 (26.70%), Postives = 106/221 (47.96%), Query Frame = 1
Query:  523 INETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQEN-QSTPQGILIK-IPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGP--HYLSS----EFPKLLRIPNLLV--KGSGDSLESTEKFI---NISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLD 1143
            + + G++Y WG   + QLG GD       +P + + FK  V    CG  H   I++ G +  +GE    +LG   + N   TP+ I+    P+ +V+CG   ++ +   G++Y +G  + GQLG      +L+     EF   L    +LV  + + D   +T   +   +I+ G +HT++  ++    S+G G +G+LG+        + M P+L+   D
Sbjct:   69 LTDLGQVYTWGRGDKGQLGHGDLKRVEAPRP-VDALFKLTVVAAACGRSHTLCITETGVVMAFGENHLGQLGLGTKSNAMPTPKQIVYSGQPVVKVACGAEFSMLVDCKGNLYSFGCPEYGQLGHNTDGRFLACSNRLEFVCELAPRRVLVFTERTRDGKVNTVPAVCVTDIACGSNHTLVRDSQRRVFSWGFGGYGRLGH----SEQKDEMLPRLVKMFD 284          

HSP 3 Score: 62.3882 bits (150), Expect = 1.346e-10
Identity = 65/294 (22.11%), Postives = 123/294 (41.84%), Query Frame = 1
Query:   79 IPETGALFNFGE--IGGEELETK---------LWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLN-DIKTTLTPSCIKALKNLNEKAILV---------------------ACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYG--NICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQGRLYVWG---EYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSEN 840
            I ETG +  FGE  +G   L TK         +      ++ ++CG EF +L+   G  + +G  ++GQLG N D +     + ++ +  L  + +LV                     ACG  HT++    ++++ +G    G+LG  ++      P+ +  + +       + AG   S AI ETG LY WG++S  +       +  +Y   ++      +  + CG       +      WG    +     GD  Q++ +  + +  L  I I+QV+ G + T+ ++ +
Sbjct:  121 ITETGVVMAFGENHLGQLGLGTKSNAMPTPKQIVYSGQPVVKVACGAEFSMLVDCKGNLYSFGCPEYGQLGHNTDGRFLACSNRLEFVCELAPRRVLVFTERTRDGKVNTVPAVCVTDIACGSNHTLVRDSQRRVFSWGFGGYGRLGHSEQ-KDEMLPRLVKMFDFPGRGAASVHAGYSCSFAIIETGALYFWGTSSTMR-------ESTMYPKPVMDLAGWKIRSLACGKSSVMVAADESTISWGPSPAFGEIGYGDGKQKSSTIAKEVKPLDGIYIEQVAMGLSFTLMVARD 406          

HSP 4 Score: 62.003 bits (149), Expect = 1.947e-10
Identity = 64/273 (23.44%), Postives = 116/273 (42.49%), Query Frame = 1
Query:  163 IISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLG--LDDKISSTS---------EPKEITSW----------IYGNIC--QLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSP---VSYVDCG-NYHAAAISQGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDS-GQLGLG 891
            +++ +CG    + IT +G    +G+N  GQLGL   K+   P+  K +    +  + VACG   +++      LY FGC   GQLG   D +  + S          P+ +  +              +C   +  G   +   +   +++ WG     +LG  +  DE++  P L+  F  P    + V  G +   A I  G LY WG  +      + +E+   P+ +  L    I+ ++CG + +V ++ +     WG   + G++G G
Sbjct:  108 VVAAACGRSHTLCITETGVVMAFGENHLGQLGLG-TKSNAMPT-PKQIVYSGQPVVKVACGAEFSMLVDCKGNLYSFGCPEYGQLGHNTDGRFLACSNRLEFVCELAPRRVLVFTERTRDGKVNTVPAVCVTDIACGSNHTLVRDSQRRVFSWGFGGYGRLGHSEQKDEML--PRLVKMFDFPGRGAASVHAGYSCSFAIIETGALYFWGTSS------TMRESTMYPKPVMDLAGWKIRSLACGKS-SVMVAADESTISWGPSPAFGEIGYG 369          

HSP 5 Score: 48.9062 bits (115), Expect = 2.478e-6
Identity = 34/106 (32.08%), Postives = 51/106 (48.11%), Query Frame = 1
Query:  769 GILIKIPIKQVSCGHN--HTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLG 1080
            G L K+ +  V  G    H + L++ G VY WG+GD GQLG G      E P+ +           D+L      +  + G SHT+  T  G+ ++FG+   G+LG
Sbjct:   47 GCLAKVHVSSVVSGPTACHCLLLTDLGQVYTWGRGDKGQLGHG-DLKRVEAPRPV-----------DALFKLT-VVAAACGRSHTLCITETGVVMAFGENHLGQLG 139          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Sea Lamprey
Match: rcc2 (regulator of chromosome condensation 2 [Source:NCBI gene;Acc:406455])

HSP 1 Score: 91.2781 bits (225), Expect = 7.660e-20
Identity = 105/435 (24.14%), Postives = 187/435 (42.99%), Query Frame = 1
Query:   61 LIDENYIPETGALFNFGEIGGEELETKLW----------IKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILV--ACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVI----------YKPTLLSFFKSP-------------VSYVDCGNYHAAAI-SQGRLYVWGEYTNQKLGDSFQENQSTPQGI-LIKIP---IKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGD-GRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRN--RESHELINEI 1236
            L+    +P+  A F         L   LW          I   ++I+  C     +LI+  G  + +G+ + GQLG  D      P  I  LK    + ++V  ACGR HT+  T++  +Y FG N  GQLGL ++  +   P +I  +    + ++  G EFS  I+  G L+ +G     QLG       ++            P  L+ F                V  V CG  H  A+ ++GR++ WG     +LG + Q+++  P+ + L+  P   +  V  G++ T  ++  G +Y WG  ++                  R P +  K   D   +  +  +++ G+S  +IT+ +   +S+G    +G+LG  G  +  S+ M P+ +  L   + ++ V  G  H+++L R+   E   L+++I
Sbjct:   20 LVGRREVPKQQAAF-------RNLGQNLWAPHRYGSLRDIAVSRVITGPCAAH-SLLISTRGLVYSWGRGEKGQLGHGDTCRVDVPRIIDTLK----ECVIVDGACGRSHTLCLTDTGTVYAFGENRLGQLGLGNQTDAVPSPTQIV-YSGRQVVKVACGAEFSVFIDCDGNLFSFGCPEYGQLGHNTDGRYIVRAQRIEFVCELAPRRLARFIEKTRDGQVLTVRGVVVRDVACGANHTIALDTRGRVFTWGFGGYGRLGHAEQKDELLPRLVKLLDRPAPAVNSVRAGYSCTFAINVVGTLYFWGSTNTS-----------------RDPTMYPKAVHDLCGTHVR--SLACGKSSILITSDES-TMSWGPWPTYGELG-YGEGKQRSSSM-PQELKKLS-GIHIHEVAMGFAHSLLLARDDSEEDKALVHQI 418          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001750.1 (pep scaffold:Pmarinus_7.0:GL481695:1137:12922:1 gene:ENSPMAG00000001576.1 transcript:ENSPMAT00000001750.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.1225 bits (222), Expect = 4.192e-19
Identity = 77/279 (27.60%), Postives = 124/279 (44.44%), Query Frame = 1
Query:  163 IISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEY-QLGL------GDHS--------DEVIYKPTLLSFFK-SPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGL--------GPHYLSSEFP 918
            I  +SCGD F   +T  G    YG    G LG         P  ++AL  L  +   ++CG  H +  +  ++++ +G  ++G+LGL ++      P+ +        C    G + S  +  +GKL   GSN  Y +LGL      GD +        + ++  P   S    + V +V  G  H+AA++  G  Y +G   + +LG   + +   PQ +  L  + + QV+CG   TV ++E G V+ WGK   G+LG         GP  L   FP
Sbjct:  314 IQHVSCGDLFTACLTDRGILMTYGSGSSGCLGHGSYSDVAQPKIVEAL--LGYEITQMSCGMSHVLAVSNEQEVFAWGRGDNGRLGLGNQELHLC-PQPVAVPPPYEPCTAHCGIDCSM-VTSSGKLLACGSNRRYNKLGLDKISHDGDDAACPAEQTEESLVLSPVQSSPLDGARVVHVALGTAHSAAVTDTGTCYTFGSNQHGQLGGGARTSSRAPQPVDGLGGVKVVQVTCGDAFTVAVAEGGQVFTWGKAARGRLGRTDGEACVPGPVQLQERFP 588          

HSP 2 Score: 70.0922 bits (170), Expect = 8.070e-13
Identity = 76/308 (24.68%), Postives = 126/308 (40.91%), Query Frame = 1
Query:  484 ICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVI------YKPTLLSFFKS-----PVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIP---------------------NLLVKGS---------------GD----SLESTE----------------KFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVL 1197
            + Q+  G    A +  +G+L VW ++       G   D  +       +P L+S F        + +V CG+   A ++ +G L  +G  ++  LG     + + P+ +  L+   I Q+SCG +H + +S   +V+ WG+GD+G+LGLG   L    P+ + +P                      LL  GS               GD      E TE                + ++++ G +H+   T  G   +FG  +HG+LG  GGAR  S    P+ +  L   + V  V CG   TV +
Sbjct:  256 VLQVAVGRTQRAGVTRSGRLIVWEASP------GTVGDAALPGSVGSVQPQLVSRFLEGQSGVTIQHVSCGDLFTACLTDRGILMTYGSGSSGCLGHGSYSDVAQPKIVEALLGYEITQMSCGMSHVLAVSNEQEVFAWGRGDNGRLGLGNQELH-LCPQPVAVPPPYEPCTAHCGIDCSMVTSSGKLLACGSNRRYNKLGLDKISHDGDDAACPAEQTEESLVLSPVQSSPLDGARVVHVALGTAHSAAVTDTGTCYTFGSNQHGQLG--GGARTSSRA--PQPVDGLG-GVKVVQVTCGDAFTVAV 551          

HSP 3 Score: 59.6918 bits (143), Expect = 1.406e-9
Identity = 55/209 (26.32%), Postives = 92/209 (44.02%), Query Frame = 1
Query:  160 KIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNND-GQLGLD------DKISSTSE---------PKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLG 735
            +I  +SCG    + ++     F +G+ D G+LGL + +  L P  + A+    E      CG   +++ T S KL   G N    +LGLD      D  +  +E         P + +      +  +  G   SAA+ +TG  Y +GSN   QLG G  +     +P +       V  V CG+    A+++ G+++ WG+    +LG
Sbjct:  365 EITQMSCGMSHVLAVSNEQEVFAWGRGDNGRLGLGNQELHLCPQPV-AVPPPYEPCT-AHCGIDCSMV-TSSGKLLACGSNRRYNKLGLDKISHDGDDAACPAEQTEESLVLSPVQSSPLDGARVVHVALGTAHSAAVTDTGTCYTFGSNQHGQLGGGARTSSRAPQP-VDGLGGVKVVQVTCGDAFTVAVAEGGQVFTWGKAARGRLG 569          

HSP 4 Score: 50.447 bits (119), Expect = 1.015e-6
Identity = 52/197 (26.40%), Postives = 81/197 (41.12%), Query Frame = 1
Query:  541 LYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDS----------------FQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLG 1080
            +Y+WGS +                P  L+   + V  V  G    A +++ GRL VW E +   +GD+                F E QS        + I+ VSCG   T CL++ G +  +G G SG LG G  Y     PK++           ++L   E    +S G SH +  + +    ++G G +G+LG
Sbjct:  236 VYMWGSGT--------------LAPVKLAMPNTEVLQVAVGRTQRAGVTRSGRLIVW-EASPGTVGDAALPGSVGSVQPQLVSRFLEGQS-------GVTIQHVSCGDLFTACLTDRGILMTYGSGSSGCLGHG-SYSDVAQPKIV-----------EALLGYE-ITQMSCGMSHVLAVSNEQEVFAWGRGDNGRLG 397          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Yeast
Match: SRM1 (Nucleotide exchange factor for Gsp1p; localizes to the nucleus, required for nucleocytoplasmic trafficking of macromolecules; suppressor of the pheromone response pathway; potentially phosphorylated by Cdc28p; human homolog of the RAN GEF, RCC1, can complement a temperature sensitive point mutant [Source:SGD;Acc:S000003065])

HSP 1 Score: 78.1814 bits (191), Expect = 9.575e-16
Identity = 86/376 (22.87%), Postives = 157/376 (41.76%), Query Frame = 1
Query:   91 GALFNFGEIGGEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLG-------------------------LNDIKTTLTPSCIKALKNLNE--KAILVACGRCHTIIWTESKKLYGFGCN--NDGQLGL-DDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSP-----VSYVDCGNYHAAAISQ-GRLYVWG--EYTNQKLGDSFQENQSTPQGILIKIP----IKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLG----PHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLG 1080
            G L    E+    L   L     KIIS + G    + +      + +G ND G LG                         LN++++T      ++   L E  K + +A     +     + ++Y +G    N+G LG   DKI     P ++ ++   NI QL  G +    ++E G ++ WG+  + QLG      +V+ +  L +    P     V Y+  G  H  A+++  +L  WG  ++    + +  ++     +   + +P    I+ ++ G +H++ LS++GD+Y  G+ D  ++G+     P Y   +     R   L  K     L +  KF +++AG  H+V     G+A S+G G    +G
Sbjct:   62 GPLAKNKEVKRPRLNPFLPRDEAKIISFAVGGMHTLALDEESNVWSWGCNDVGALGRDTSNAKEQLKDMDADDSSDDEDGDLNELESTPAKIPRESFPPLAEGHKVVQLAATDNMSCALFSNGEVYAWGTFRCNEGILGFYQDKIKIQKTPWKVPTFSKYNIVQLAPGKDHILFLDEEGMVFAWGNGQQNQLG-----RKVMERFRLKTLDPRPFGLRHVKYIASGENHCFALTKDNKLVSWGLNQFGQCGVSEDVEDGALVTKPKRLALPDNVVIRSIAAGEHHSLILSQDGDLYSCGRLDMFEVGIPKDNLPEYTYKDVHGKARAVPLPTK-----LNNVPKFKSVAAGSHHSVAVAQNGIAYSWGFGETYAVG 427          

HSP 2 Score: 68.5514 bits (166), Expect = 1.286e-12
Identity = 67/281 (23.84%), Postives = 124/281 (44.13%), Query Frame = 1
Query:  160 KIISLSCGDEFCVLITRSGRAFGYG--KNDWGQLGL--NDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYG--NICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDE--VIYKPTLLSFFKSPV-SYVDCGNYHAAAISQ-GRLYVWGEYTNQKLG------------DSFQENQSTPQGI-LIKIP-IKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLR 930
            K++ L+  D     +  +G  + +G  + + G LG   + IK   TP  +      N   + +A G+ H +   E   ++ +G     QLG   K+      K +    +G  ++  + +G     A+ +  KL  WG N   Q G+ +  ++  ++ KP  L+   + V   +  G +H+  +SQ G LY  G     ++G            D   + ++ P    L  +P  K V+ G +H+V +++NG  Y WG G++  +GLGP    +E P  ++
Sbjct:  166 KVVQLAATDNMSCALFSNGEVYAWGTFRCNEGILGFYQDKIKIQKTPWKVPTFSKYN--IVQLAPGKDHILFLDEEGMVFAWGNGQQNQLG--RKVMERFRLKTLDPRPFGLRHVKYIASGENHCFALTKDNKLVSWGLNQFGQCGVSEDVEDGALVTKPKRLALPDNVVIRSIAAGEHHSLILSQDGDLYSCGRLDMFEVGIPKDNLPEYTYKDVHGKARAVPLPTKLNNVPKFKSVAAGSHHSVAVAQNGIAYSWGFGETYAVGLGPFEDDTEVPTRIK 442          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Nematostella
Match: EDO44704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV05])

HSP 1 Score: 249.595 bits (636), Expect = 3.751e-77
Identity = 157/381 (41.21%), Postives = 210/381 (55.12%), Query Frame = 1
Query:   67 DENYIPETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQV---SCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVV 1194
            D+  +PE+GA+F FG+    + L  K WI++D +++LSCGDE   ++T +G+ + +G NDWGQLG  + K+   PS +K LK   EK  +VACGR HTI  TES  LY FGC  DGQLG  D    +  PK I          L  G +FSAAI E G+LY WGS  E Q GLG+ ++     PT L      V  V CG YH A +++ G LY+ GE    KLG   ++  +T Q   IK    QV   +CG   T  +++NG VY +G+G+ GQLGLG   + +EFP+  RIP          L    K   +S GES T + T  G   +FGDGRHGKLG   G   +SN   P+ +   + +  V  V CGGCH +V
Sbjct:    4 DDEDVPESGAVFTFGKTRFADNLANKFWIRDDAVVNLSCGDEHSAVVTANGKLYTFGCNDWGQLGHGNTKSYTKPSVVKKLK--PEKVYMVACGRNHTIAATESGHLYSFGCGGDGQLGHGDA-EDSHVPKIIEGLDVQKYKHLACGSDFSAAITENGELYTWGSCGEGQNGLGEDTE----IPTRLH-LHGKVRMVSCGYYHMAVVTEDGSLYMCGEKEGGKLGLDHEQLDNTSQLQKIKSIEDQVVVAACGAEFTAVVTKNGSVYTFGQGNQGQLGLGSSMMETEFPE--RIP----------LFEKVKARTVSCGESFTAVITKHGNLYTFGDGRHGKLGL--GDECFSNTFKPEKVKRFN-NFTVKMVTCGGCHMLV 361          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Nematostella
Match: EDO49099 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI68])

HSP 1 Score: 118.627 bits (296), Expect = 5.382e-28
Identity = 88/308 (28.57%), Postives = 150/308 (48.70%), Query Frame = 1
Query:  163 IISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKK---LYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLS----FFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQ----STPQGILIKIPIK----QVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKG 1038
            I  ++CG    + +++ G  F +G    G+LG   ++   TP  I  L++LN     VAC   H+       K   L+ FG N+ GQLG+ +    TS  + ++S     I ++  G   SAA+ E G L++WG N   QLG G+++   +  P+LL          V  V CG+ H+A I+ +GR++  G+ T  +LG    +NQ    +    + +++P       V+CG +HT  +++ G+++ WG+G  G+LG G + L+   P  + I           +E  +    +S G +HT  T T+ 
Sbjct:  242 IRKVACGATHTLALSKDGEVFSWGSGYGGRLGQGHLRDRFTPIRICGLESLN--LTQVACNEFHSAAVCACSKQGALFSFGENDYGQLGIPEDKLLTSYIQCVSSLSEHKISRVACGSFHSAALAEHGSLWLWGCNESGQLGNGNYTSTSL--PSLLEAGNDLRHDAVMEVACGDQHSAFITKKGRMFCCGDNTYGQLGAHLNDNQDDHVTYNVAVRVRVPTDFRCVHVACGDSHTAVVTDGGEIFTWGRGKGGRLGHGDN-LNRHLPTEIEI----------GMEG-KHVRGVSCGRAHTACTVTRA 533          

HSP 2 Score: 94.3597 bits (233), Expect = 2.611e-20
Identity = 85/343 (24.78%), Postives = 158/343 (46.06%), Query Frame = 1
Query:  223 FGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLG---LDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAI---NETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGI-----LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPH-----YLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLV 1200
            + +G+   G LG  +      P  ++AL  L +    VACG  HT+  ++  +++ +G    G+LG   L D+ +    P  I      N+ Q+      SAA+   ++ G L+ +G N   QLG+ +      Y   + S  +  +S V CG++H+AA+++ G L++WG   + +LG+    + S P  +     L    + +V+CG  H+  +++ G ++  G    GQLG   +     +++      +R+P               + ++++ G+SHT + T  G   ++G G+ G+LG+     N + ++ P  I    +   V  V CG  HT   V
Sbjct:  210 YTWGEGTNGMLGHGEDTQEAHPHVVEAL--LGKDIRKVACGATHTLALSKDGEVFSWGSGYGGRLGQGHLRDRFT----PIRICGLESLNLTQVACNEFHSAAVCACSKQGALFSFGENDYGQLGIPEDKLLTSYIQCVSSLSEHKISRVACGSFHSAALAEHGSLWLWGCNESGQLGNGNYTSTSLPSLLEAGNDLRHDAVMEVACGDQHSAFITKKGRMFCCGDNTYGQLGAHLNDNQDDHVTYNVAVRVRVPTDF------------RCVHVACGDSHTAVVTDGGEIFTWGRGKGGRLGH---GDNLNRHL-PTEIEIGMEGKHVRGVSCGRAHTACTV 530          

HSP 3 Score: 67.0106 bits (162), Expect = 1.212e-11
Identity = 57/215 (26.51%), Postives = 95/215 (44.19%), Query Frame = 1
Query:   91 GALFNFGEIGGEEL---ETKLW---------IKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAIL-VACGRCHTIIWTESKKLYGFGCNNDGQLGL------DDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAA 678
            GALF+FGE    +L   E KL          +   KI  ++CG      +   G  + +G N+ GQLG  +  +T  PS ++A  +L   A++ VACG  H+   T+  +++  G N  GQLG       DD ++     +      +  +  +  G   +A + + G+++ WG     +LG GD+ +  +     +      V  V CG  H A
Sbjct:  314 GALFSFGENDYGQLGIPEDKLLTSYIQCVSSLSEHKISRVACGSFHSAALAEHGSLWLWGCNESGQLGNGNYTSTSLPSLLEAGNDLRHDAVMEVACGDQHSAFITKKGRMFCCGDNTYGQLGAHLNDNQDDHVTYNVAVRVRVPTDFRCV-HVACGDSHTAVVTDGGEIFTWGRGKGGRLGHGDNLNRHLPTEIEIGMEGKHVRGVSCGRAHTA 527          

HSP 4 Score: 65.4698 bits (158), Expect = 3.612e-11
Identity = 52/175 (29.71%), Postives = 90/175 (51.43%), Query Frame = 1
Query:  697 LYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVIT---TTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRN 1206
            +Y WGE TN  LG      ++ P  +  L+   I++V+CG  HT+ LS++G+V+ WG G  G+LG G  +L   F   +RI  L      +SL  T+    ++  E H+      + +G   SFG+  +G+LG I   +  ++Y+  + +++L +   +  V CG  H+  L  +
Sbjct:  209 IYTWGEGTNGMLGHGEDTQEAHPHVVEALLGKDIRKVACGATHTLALSKDGEVFSWGSGYGGRLGQG--HLRDRFTP-IRICGL------ESLNLTQ----VACNEFHSAAVCACSKQGALFSFGENDYGQLG-IPEDKLLTSYI--QCVSSLSEHK-ISRVACGSFHSAALAEH 366          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Nematostella
Match: EDO34592 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNX9])

HSP 1 Score: 117.857 bits (294), Expect = 1.784e-27
Identity = 105/389 (26.99%), Postives = 171/389 (43.96%), Query Frame = 1
Query:  109 GEIGGEELETKLWIKNDKIIS----LSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSE--PKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQ----VSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTV-ITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPK-----------LIANLDKDLWVYNVQ---CGGCHTVVL 1197
            GE   E + T   ++N +  S    +SCG      + + G  +  G N++GQLG    K+   P  + A++        V CG+ HT+  ++   ++ +G N+ GQ+GL  K+    +  PK +      ++ Q+  G   S A+  +G L+ WG NS  QLG+G     +     +LS    P   +  G  H+ A+S  G L+ WG+    +LG    +    P   L+K    Q    VSCG  HT  L+ +G V+ +G G SGQLG   ++      K+  +   +V               I+ G +HT+ +  + G   +FG G  G+LG +G   N ++ M  K           ++   D D  VY V+    GG H   +
Sbjct:   15 GETEQEFISTPRLLENLEFSSNVREVSCGWNHTAFLCKDGTVYTCGSNEFGQLGQE--KSHTNPESVHAIETFTITK--VTCGKAHTVAVSDQGLVFAWGDNSYGQIGLGSKVKEKVQTIPKMLKGLAKMSVVQIACGCNHSMALTISGHLFCWGDNSSGQLGIGKTHSSMSEPAPVLSLNGVPFMLISAGGAHSFALSSSGALFGWGKNEYGQLG--VHDTTDRPLPTLLKSLRSQGVCYVSCGEKHTAVLTSDGGVFTFGCGTSGQLGHNSNHHEYTPRKVFELMGSVVT-------------QIACGRAHTLALVPSSGRVYTFGRGGDGQLG-LGVTNNCNSPMTAKGPWLRSNNIKSMLPEADGDSVVYTVRRIDAGGDHCFAM 383          

HSP 2 Score: 91.6633 bits (226), Expect = 3.934e-19
Identity = 80/282 (28.37%), Postives = 140/282 (49.65%), Query Frame = 1
Query:  382 LYGFGCNNDGQLGL-DDKISSTSEPKEITSWIYG-NICQLKAGGEFSAAINETGKLYVWGSNSEYQLGL-GDHSD-EVIYKPTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGE--YTNQKLGDSFQEN-QSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVL 1197
            ++ +G  ++GQLG+ + +    S P+ + +  +  N+ ++  G   +A + + G +Y  GSN   QLG    H++ E ++     +     ++ V CG  H  A+S QG ++ WG+  Y    LG   +E  Q+ P+ +  L K+ + Q++CG NH++ L+ +G ++ WG   SGQLG+G  + S   P     P L + G          F+ ISAG +H+   ++ G    +G   +G+L    G  + ++   P L+ +L      Y V CG  HT VL
Sbjct:    1 MFCWGKCSEGQLGVGETEQEFISTPRLLENLEFSSNVREVSCGWNHTAFLCKDGTVYTCGSNEFGQLGQEKSHTNPESVHAIETFT-----ITKVTCGKAHTVAVSDQGLVFAWGDNSYGQIGLGSKVKEKVQTIPKMLKGLAKMSVVQIACGCNHSMALTISGHLFCWGDNSSGQLGIGKTHSSMSEPA----PVLSLNGV--------PFMLISAGGAHSFALSSSGALFGWGKNEYGQL----GVHDTTDRPLPTLLKSLRSQGVCY-VSCGEKHTAVL 260          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Nematostella
Match: EDO37196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGI6])

HSP 1 Score: 115.546 bits (288), Expect = 1.753e-26
Identity = 96/351 (27.35%), Postives = 164/351 (46.72%), Query Frame = 1
Query:  160 KIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLT-PSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAIS---QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVV 1194
            K+  ++ G +    ++  G+ F  G++  G+LGL  +   +T P  I+ L +   + + V  G  H +  T   KL+ +G   DG+LG  ++++    PK I ++    +  +  G   SAAI  +G+LY WG     +LG GD+   +  K  + SF    V  + CG+  A  ++    G ++ WG+    KLG    E  S P  +  L    + +V+CG   ++ LS +G V+ WGKGD  +LG G           +R P ++     D L   +K ++++ G  H +  T  G   ++GD  HG+ GN     N      P+L+  L+    +  V CG  H++ 
Sbjct: 2455 KVQQIAGGSKTLFAVSHDGKVFACGESTNGRLGLGPLSANVTVPRQIENLSSFMVRKVSVHSGGRHAMALTIEGKLFSWGEGEDGKLGHGNRMN-CDHPKLIDTFKSSCVRDMSCGSSHSAAILSSGELYTWGLGEYGRLGHGDNYTHLKPK-KVQSFTSHRVIDIACGSRDAQTLALTDDGTVWSWGDGDFGKLGRGGSEGCSVPNPVEKLQGQGVCKVACGAQFSLALSTSGLVWTWGKGDYYRLGHGND-------THVRKPQIV-----DGLRG-KKIVDVAVGALHCLAVTDSGQVFAWGDNDHGQQGNNTTTVNRR----PQLVNGLEGQK-ITRVACGSSHSIA 2785          

HSP 2 Score: 104.375 bits (259), Expect = 6.074e-23
Identity = 96/370 (25.95%), Postives = 167/370 (45.14%), Query Frame = 1
Query:  160 KIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAI---SQGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVV--LVRNRESHELINEIISEY 1248
            + + +  G++    +T  G+ +  G    G+LGL    T  +   +++L+++  + + V  G  H +  +    +Y +G  +DG+LG  ++ +S   P+ I +     +  +  GG  SA I +  +LY WG     +LG GD  D+++ K  + +   + V  V CG+  A  +       ++ WG+    KLG    +    P  +  LI + + +V CG   +V L+ +G VY WGKGD  +LG G           +R P  +    G      +K I I+ G  H V +T  G   ++GD   G+LG+  G  N      P+L+  L     +  V CG  HT+     +   +  L +E+  EY
Sbjct: 3388 RPVQIVGGEQTLFAVTAEGKVYATGYGHGGRLGLGGTDTVTSIKMLESLQHVVVRKVAVHSGGKHAMALSADGDVYSWGEGDDGKLGHGNR-NSCDRPRVIEALRGKGVIDISCGGSHSACITQNHELYTWGKGRYGRLGHGDSEDQLLPK-VVEALRGNRVIDVACGSGDAQTLCLTDDDCVWSWGDGDYGKLGRGGSDGCKIPMKVESLIGLGVSKVECGSQFSVALTRSGAVYTWGKGDYYRLGHG-------VDDHVRRPKRVAALQG------KKVITIATGSLHCVASTDTGEVYTWGDNDEGQLGD--GTTN--AIARPRLVTALQGKK-ISRVACGSAHTIAWSTCKPVNAGRLPDEVPMEY 3737          

HSP 3 Score: 93.9745 bits (232), Expect = 9.143e-20
Identity = 72/269 (26.77%), Postives = 128/269 (47.58%), Query Frame = 1
Query:  148 IKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGR--CHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFK-SPVSYVDCGNYH-AAAISQGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIP 936
            ++   +I +SCG      IT++   + +GK  +G+LG  D +  L P  ++AL+    + I VACG     T+  T+   ++ +G  + G+LG          P ++ S I   + +++ G +FS A+  +G +Y WG    Y+LG G   D+ + +P  ++  +   V  +  G+ H  A+   G +Y WG+    +LGD      + P+ +  L    I +V+CG  HT+  S    V      ++G+L   P  +  E+  L  IP
Sbjct: 3490 LRGKGVIDISCGGSHSACITQNHELYTWGKGRYGRLGHGDSEDQLLPKVVEALR--GNRVIDVACGSGDAQTLCLTDDDCVWSWGDGDYGKLGRGGS-DGCKIPMKVESLIGLGVSKVECGSQFSVALTRSGAVYTWGKGDYYRLGHG--VDDHVRRPKRVAALQGKKVITIATGSLHCVASTDTGEVYTWGDNDEGQLGDGTTNAIARPRLVTALQGKKISRVACGSAHTIAWSTCKPV------NAGRL---PDEVPMEYNHLQHIP 3744          

HSP 4 Score: 90.8929 bits (224), Expect = 7.608e-19
Identity = 70/251 (27.89%), Postives = 116/251 (46.22%), Query Frame = 1
Query:  352 HTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKS-PVSYVDCGNYHA---AAISQGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNI 1086
            H +  T   ++Y +G  + G+LG  D  S   EP  +T      + ++  G   SAA+   G+LY WG  +  +LG G   D+++  P L+S  +   +  V CG+  A   AA   G ++ WG+    KLG    +    P+ I  L  + + +V CG   ++ L+ +G V+ WGKG+  +LG G           +R P L+    G      +  +++S G  H +  T  G    +G    G+LG+I
Sbjct:   28 HFLALTREGEVYSWGSGDGGKLGHGD-TSPREEPTLVTGLAGKQVIRISCGSTHSAAVTSEGELYTWGRGNYGRLGHGSSEDQLV--PVLVSGLRGHHIIDVACGSGDAHTLAAADDGTVWSWGDGDYGKLGRGGSDGCKNPKSIERLQGLGVCKVYCGAQFSLALTRDGSVWTWGKGEGFRLGHGTE-------DHVRHPKLVEALDG------KHVVDVSVGSIHCLALTDAGEVYCWGRNDQGQLGDI 262          

HSP 5 Score: 84.3445 bits (207), Expect = 8.147e-17
Identity = 74/247 (29.96%), Postives = 120/247 (48.58%), Query Frame = 1
Query:  379 KLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYG--NICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYK---PTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAG--ESHTVITTTKGLALSFGDGRHGKLGNIG 1089
            K++ +G N+  QLG   K S    P  + S   G   + Q+  G +   A++  GK++  G ++  +LGLG  S  V        L SF    VS V  G  HA A++ +G+L+ WGE  + KLG   + N   P+ I       ++ +SCG +H+  +  +G++Y WG G+ G+LG G +Y   +  K+                ++ + I+I+ G  ++ T+  T  G   S+GDG  GKLG  G
Sbjct: 2422 KVFVWGLNDKDQLG-GLKGSKIKVP--VLSEFIGALKVQQIAGGSKTLFAVSHDGKVFACGESTNGRLGLGPLSANVTVPRQIENLSSFMVRKVS-VHSGGRHAMALTIEGKLFSWGEGEDGKLGHGNRMNCDHPKLIDTFKSSCVRDMSCGSSHSAAILSSGELYTWGLGEYGRLGHGDNYTHLKPKKVQSF-------------TSHRVIDIACGSRDAQTLALTDDGTVWSWGDGDFGKLGRGG 2651          

HSP 6 Score: 84.3445 bits (207), Expect = 8.577e-17
Identity = 59/237 (24.89%), Postives = 115/237 (48.52%), Query Frame = 1
Query:  148 IKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGR--CHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFK-SPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSEN 840
             K+  +  +SCG      I  SG  + +G  ++G+LG  D  T L P  +++  +   + I +ACG     T+  T+   ++ +G  + G+LG        S P  +       +C++  G +FS A++ +G ++ WG    Y+LG G+  D  + KP ++   +   +  V  G  H  A++  G+++ WG+  + + G++       PQ +  L    I +V+CG +H++  +E+
Sbjct: 2558 FKSSCVRDMSCGSSHSAAILSSGELYTWGLGEYGRLGHGDNYTHLKPKKVQSFTS--HRVIDIACGSRDAQTLALTDDGTVWSWGDGDFGKLGRGGS-EGCSVPNPVEKLQGQGVCKVACGAQFSLALSTSGLVWTWGKGDYYRLGHGN--DTHVRKPQIVDGLRGKKIVDVAVGALHCLAVTDSGQVFAWGDNDHGQQGNNTTTVNRRPQLVNGLEGQKITRVACGSSHSIAWAES 2789          

HSP 7 Score: 82.0333 bits (201), Expect = 4.373e-16
Identity = 84/291 (28.87%), Postives = 133/291 (45.70%), Query Frame = 1
Query:  355 TIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVS--YVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINIS--AGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRN 1206
            T+ W  S  +YG+G N+ GQLG  +  +    P+ I +       Q+  G +   A+   GK+Y               +D V     L S     V    V  G  HA A+S  G +Y WGE  + KLG   + +   P+ I  L    +  +SCG +H+ C+++N ++Y WGKG  G+LG G     SE   L ++   L +G+        + I+++  +G++ T+  T      S+GDG +GKLG  GG+      M  + +  L     V  V+CG   +V L R+
Sbjct: 3347 TMTWGGSGTIYGWGHNHRGQLGSLEG-AKVKLPQTIEALASIRPVQIVGGEQTLFAVTAEGKVYA-TGYGHGGRLGLGGTDTVTSIKMLESLQHVVVRKVAVHSGGKHAMALSADGDVYSWGEGDDGKLGHGNRNSCDRPRVIEALRGKGVIDISCGGSHSACITQNHELYTWGKGRYGRLGHG----DSEDQLLPKVVEAL-RGN--------RVIDVACGSGDAQTLCLTDDDCVWSWGDGDYGKLGR-GGSDGCKIPMKVESLIGLG----VSKVECGSQFSVALTRS 3617          

HSP 8 Score: 81.6481 bits (200), Expect = 6.827e-16
Identity = 67/251 (26.69%), Postives = 118/251 (47.01%), Query Frame = 1
Query:  160 KIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYG----NICQLK--AGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLG 885
            ++++ + G  F  L TR G  + +G  D G+LG  D      P+ +  L    ++ I ++CG  H+   T   +LY +G  N G+LG       +SE + +   + G    +I  +   +G   + A  + G ++ WG     +LG G  SD      ++       V  V CG   + A+++ G ++ WG+    +LG   +++   P+ +  L    +  VS G  H + L++ G+VY WG+ D GQLG
Sbjct:   19 QVVTHTDGKHFLAL-TREGEVYSWGSGDGGKLGHGDTSPREEPTLVTGLAG--KQVIRISCGSTHSAAVTSEGELYTWGRGNYGRLG-----HGSSEDQLVPVLVSGLRGHHIIDVACGSGDAHTLAAADDGTVWSWGDGDYGKLGRGG-SDGCKNPKSIERLQGLGVCKVYCGAQFSLALTRDGSVWTWGKGEGFRLGHGTEDHVRHPKLVEALDGKHVVDVSVGSIHCLALTDAGEVYCWGRNDQGQLG 260          

HSP 9 Score: 71.633 bits (174), Expect = 7.014e-13
Identity = 62/193 (32.12%), Postives = 97/193 (50.26%), Query Frame = 1
Query:  643 VSYVDCGNYHAAAISQGRLYVWGEYTNQKLGD---SFQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINIS--AGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRN 1206
            V++ D G +  A   +G +Y WG     KLG    S +E  +   G+  K  I+ +SCG  H+  ++  G++Y WG+G+ G+LG G    SSE     ++  +LV G           I+++  +G++HT+     G   S+GDG +GKLG  GG+    N   PK I  L + L V  V CG   ++ L R+
Sbjct:   21 VTHTD-GKHFLALTREGEVYSWGSGDGGKLGHGDTSPREEPTLVTGLAGKQVIR-ISCGSTHSAAVTSEGELYTWGRGNYGRLGHG----SSED----QLVPVLVSGL-----RGHHIIDVACGSGDAHTLAAADDGTVWSWGDGDYGKLGR-GGSDGCKN---PKSIERL-QGLGVCKVYCGAQFSLALTRD 193          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Nematostella
Match: EDO47874 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL61])

HSP 1 Score: 102.064 bits (253), Expect = 6.671e-23
Identity = 97/377 (25.73%), Postives = 168/377 (44.56%), Query Frame = 1
Query:  196 VLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGL-DDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQGRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSE--FPKLLRI------PNLLVKGS--------------GDSLESTEKFI------NISAGESHTVITTTKGLALSFGDG--------RHGKLG---NIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRN 1206
            +++   GR   +G+ND GQLG    +    P  I  LK  N   +  +CGR HT+I T++  ++GFG N  GQ+G    K +S   P +I       + ++  G EFS  ++E G ++ +GS    QLG   H+ +                    G Y    +S  ++    E   ++L    + N+      +  + IK V CG+NHT+ L E G V+ WG G  G+LG   H    +   P+LL        P+++  GS              G + +S E  +      ++S  +  +V  +   + ++  D          +G+LG     GG ++ +N   PK++  L+ D++V++V CG  HT+ + ++
Sbjct:  126 IIVCEDGRVMSFGRNDKGQLGHGTTERCDVPKVIDRLKMHN--IVQASCGRGHTLILTDAGLVFGFGDNKLGQIGQGHQKPTSLPCPLQIMHPTDKKVTKVCCGAEFSMLLDENGDIFSFGSPEYGQLG---HNTD--------------------GQY---IVSSNKMGFQCEVLPRRLVVFVERNKDGFVNHIEGVKIKDVVCGNNHTMALDEQGRVFTWGFGGYGRLG---HQQPKDEHVPRLLTFFNTKGNPSVIFAGSTYSMAVCMGQLYFWGQTKQSGEAAMYPKPVQDLSGWQVRSVGCSKSSIVIAADDSVVSWGPSPTYGELGYGLKKGGQKSSTN---PKIVEPLE-DIYVHSVTCGMGHTLFIAKD 467          

HSP 2 Score: 87.0409 bits (214), Expect = 4.171e-18
Identity = 68/274 (24.82%), Postives = 123/274 (44.89%), Query Frame = 1
Query:  148 IKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLD---------DKISSTSE--PKEITSWIYGN------------ICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFF--KSPVSYVDCGNYHAAAISQGRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDS-GQLGLG 891
            +K   I+  SCG    +++T +G  FG+G N  GQ+G    K T  P  ++ +   ++K   V CG   +++  E+  ++ FG    GQLG +         +K+    E  P+ +  ++  N            I  +  G   + A++E G+++ WG     +LG     DE +  P LL+FF  K   S +  G+ ++ A+  G+LY WG+         + +    P   L    ++ V C  + ++ ++ +  V  WG   + G+LG G
Sbjct:  162 LKMHNIVQASCGRGHTLILTDAGLVFGFGDNKLGQIGQGHQKPTSLPCPLQIMHPTDKKVTKVCCGAEFSMLLDENGDIFSFGSPEYGQLGHNTDGQYIVSSNKMGFQCEVLPRRLVVFVERNKDGFVNHIEGVKIKDVVCGNNHTMALDEQGRVFTWGFGGYGRLGHQQPKDEHV--PRLLTFFNTKGNPSVIFAGSTYSMAVCMGQLYFWGQTKQSGEAAMYPK----PVQDLSGWQVRSVGCSKS-SIVIAADDSVVSWGPSPTYGELGYG 428          

HSP 3 Score: 55.4546 bits (132), Expect = 3.929e-8
Identity = 53/210 (25.24%), Postives = 97/210 (46.19%), Query Frame = 1
Query:  514 SAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSP-VSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGILIKIP----IKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGL---GPHYLSSE--------FPKLLRIPNLLVKGSGDSLEST---EKFINISAGESHTVITTTKGLALSFGDGRHGKLGN 1083
            S  + E G++  +G N + QLG G  + E    P ++   K   +    CG  H   ++  G ++ +G+    ++G   Q+  S P  + I  P    + +V CG   ++ L ENGD++ +G  + GQLG    G + +SS          P+ L +    V+ + D   +     K  ++  G +HT+    +G   ++G G +G+LG+
Sbjct:  125 SIIVCEDGRVMSFGRNDKGQLGHG--TTERCDVPKVIDRLKMHNIVQASCGRGHTLILTDAGLVFGFGDNKLGQIGQGHQKPTSLPCPLQIMHPTDKKVTKVCCGAEFSMLLDENGDIFSFGSPEYGQLGHNTDGQYIVSSNKMGFQCEVLPRRLVV---FVERNKDGFVNHIEGVKIKDVVCGNNHTMALDEQGRVFTWGFGGYGRLGH 329          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Medaka
Match: rpgrb (X-linked retinitis pigmentosa GTPase regulator [Source:NCBI gene;Acc:101169422])

HSP 1 Score: 252.292 bits (643), Expect = 5.161e-74
Identity = 158/385 (41.04%), Postives = 215/385 (55.84%), Query Frame = 1
Query:   70 ENYIPETGALFNFGEIG-GEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQE--NQSTPQGIL-IKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNR 1209
            E+ IPE+GA+F FG+    + + +K W+KND    ++CGDE   LIT +GR F +G N+WGQLGL    T   P+C+KALK  +E+  LVACGR HT+I T   ++Y  G N++GQLGL D    TS  +       G I  L AG   SAA+  +GKL++WG NSE Q+GLG  S      P  +   + PVS+V CG YH+A ++  G LY +GE  + KLG   ++      PQ +  IK  +KQV+CG  HTV L+++  V+ +G G  GQLG G     S  P+L+       KG         +   ++ GE+HT + T  GL  +FGDGRHGKL    G  N++N   P L      +  V  V CGGCH VV  R R
Sbjct:    6 EDDIPESGAVFTFGKSKFSDNIPSKFWLKNDVPRKIACGDEHTALITENGRLFMFGSNNWGQLGLGSKLTVNKPTCVKALK--SERIKLVACGRNHTLICTAKGQVYACGGNSEGQLGLGDWEEKTSFQRVEFFDSQGAIQMLAAGSNTSAALTVSGKLFMWGDNSEGQIGLGKESQ--ASSPQEVGVGR-PVSWVSCGYYHSAFVTVDGALYTFGERDSGKLGLGTEQLSGHRVPQRVKSIKEAVKQVACGGGHTVALTDDA-VFTFGLGQFGQLGHGTFIFESRLPRLV---EHFKKG---------RVCQVACGENHTAVITDDGLLYTFGDGRHGKLAL--GEENFTNQFKPTLCPRF-LECNVQAVSCGGCHMVVFARPR 369          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Medaka
Match: herc3 (HECT and RLD domain containing E3 ubiquitin protein ligase 3 [Source:NCBI gene;Acc:101155493])

HSP 1 Score: 132.109 bits (331), Expect = 1.528e-31
Identity = 87/272 (31.99%), Postives = 140/272 (51.47%), Query Frame = 1
Query:  148 IKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAI-LVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSP-VSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVC-LSENGDVYVWGKGDSGQLGLG-------PHYLSSEFPKL 924
            +   KI  +SCG    V +   G+ F +G  D GQLGL   +T +     + LK L + +I  V CG  H I  +   +L+ +G N+ GQLGL    +S   P  + S     + Q+ AGG+   A++ +G ++ WG N   QLGL D  D  +  P  + F +S  V Y+ CG+ H AA+++ G L+ +G+ +  +LG     N+  P+ +  L+   + Q++CG +HT+  +  +G VY +G    GQLG G       PH + ++F  L
Sbjct:   80 LDTQKITMVSCGRAHSVAVNEQGQVFVWGAGDGGQLGLETAETAVRIP--RLLKKLCDHSISQVVCGNQHCIALSRDGQLFTWGQNSSGQLGLGKGETSKLSPSPVKSLAGIPLAQITAGGDHCFALSLSGAVFGWGKNKAGQLGLNDKQDRAV--PCHIKFLRSQRVVYISCGDEHTAALTKSGGLFTFGDGSRGQLGHGSSNNELLPRRVMELMGTEVSQITCGRHHTLAFVPSSGTVYAFGCNSHGQLGTGILADLRSPHPVKNDFLTL 347          

HSP 2 Score: 130.183 bits (326), Expect = 5.368e-31
Identity = 100/360 (27.78%), Postives = 174/360 (48.33%), Query Frame = 1
Query:  172 LSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTV-ITTTKGLALSFGDGRHGKLGN--IGGARNYSNYMWPKLIANLDKDLWVYNV---QCGGCHTVVLVRNRESHEL 1224
            ++CG +  + + + G  +  G N  GQLG +  K   +P  + AL    +K  +V+CGR H++   E  +++ +G  + GQLGL+   ++   P+ +      +I Q+  G +   A++  G+L+ WG NS  QLGLG      +    + S    P++ +  G  H  A+S  G ++ WG+    +LG + +++++ P  I  L    +  +SCG  HT  L+++G ++ +G G  GQLG G     S   +LL  P  +++  G  +        I+ G  HT+    + G   +FG   HG+LG   +   R+        L  NL KDL  Y V    CGG H+ ++  + +  E+
Sbjct:   38 VACGGQHTLFLLQDGSVYTCGSNSCGQLGHD--KAGNSPELVGALDT--QKITMVSCGRAHSVAVNEQGQVFVWGAGDGGQLGLETAETAVRIPRLLKKLCDHSISQVVCGNQHCIALSRDGQLFTWGQNSSGQLGLGKGETSKLSPSPVKSLAGIPLAQITAGGDHCFALSLSGAVFGWGKNKAGQLGLNDKQDRAVPCHIKFLRSQRVVYISCGDEHTAALTKSGGLFTFGDGSRGQLGHG-----SSNNELL--PRRVMELMGTEVS------QITCGRHHTLAFVPSSGTVYAFGCNSHGQLGTGILADLRSPHPVKNDFLTLNLRKDLRKYTVIKIICGGDHSFLMYSSEQCPEV 380          

HSP 3 Score: 102.064 bits (253), Expect = 5.852e-22
Identity = 73/263 (27.76%), Postives = 130/263 (49.43%), Query Frame = 1
Query:  109 GEIGGEELETKLWIK-------NDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTT-LTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAI--SQGRLYVWGEYTNQKLGDSFQENQSTPQGI------------LIKIPIKQVSCGHNHTVCL 831
            G++G E  ET + I        +  I  + CG++ C+ ++R G+ F +G+N  GQLGL   +T+ L+PS +K+L  +    I    G  H    + S  ++G+G N  GQLGL+DK    + P  I       +  +  G E +AA+ ++G L+ +G  S  QLG G  ++E++ +  ++    + VS + CG +H  A   S G +Y +G  ++ +LG     +  +P  +            L K  + ++ CG +H+  +
Sbjct:  113 GQLGLETAETAVRIPRLLKKLCDHSISQVVCGNQHCIALSRDGQLFTWGQNSSGQLGLGKGETSKLSPSPVKSLAGIPLAQI--TAGGDHCFALSLSGAVFGWGKNKAGQLGLNDK-QDRAVPCHIKFLRSQRVVYISCGDEHTAALTKSGGLFTFGDGSRGQLGHGSSNNELLPR-RVMELMGTEVSQITCGRHHTLAFVPSSGTVYAFGCNSHGQLGTGILADLRSPHPVKNDFLTLNLRKDLRKYTVIKIICGGDHSFLM 371          

HSP 4 Score: 100.138 bits (248), Expect = 1.898e-21
Identity = 87/315 (27.62%), Postives = 136/315 (43.17%), Query Frame = 1
Query:  391 FGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKS-PVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGILIKI---PIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFP----KLLRIPNLLVKGSGD------------------------------------SLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLV 1200
            +G   DGQLG+  + +   EP+    +    + ++  GG+ +  + + G +Y  GSNS  QLG     D+    P L+    +  ++ V CG  H+ A++ QG+++VWG     +LG    E       +L K+    I QV CG+ H + LS +G ++ WG+  SGQLGLG    S   P     L  IP   +   GD                                        +++ + IS G+ HT   T  G   +FGDG  G+LG+  G+ N  N + P+ +  L     V  + CG  HT+  V
Sbjct:    4 WGNARDGQLGIGVEGNPVFEPRICHVFSGRGLKEVACGGQHTLFLLQDGSVYTCGSNSCGQLG----HDKAGNSPELVGALDTQKITMVSCGRAHSVAVNEQGQVFVWGAGDGGQLGLETAETAVRIPRLLKKLCDHSISQVVCGNQHCIALSRDGQLFTWGQNSSGQLGLGKGETSKLSPSPVKSLAGIPLAQITAGGDHCFALSLSGAVFGWGKNKAGQLGLNDKQDRAVPCHIKFLRSQRVVYISCGDEHTAALTKSGGLFTFGDGSRGQLGH--GSSN--NELLPRRVMEL-MGTEVSQITCGRHHTLAFV 309          

HSP 5 Score: 51.9878 bits (123), Expect = 1.718e-6
Identity = 43/139 (30.94%), Postives = 66/139 (47.48%), Query Frame = 1
Query:  790 IKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRN 1206
            +K+V+CG  HT+ L ++G VY  G    GQLG   H  +   P+L+        G+ D    T+K   +S G +H+V    +G    +G G  G+LG +  A        P+L+  L  D  +  V CG  H + L R+
Sbjct:   35 LKEVACGGQHTLFLLQDGSVYTCGSNSCGQLG---HDKAGNSPELV--------GALD----TQKITMVSCGRAHSVAVNEQGQVFVWGAGDGGQLG-LETAETAVRI--PRLLKKL-CDHSISQVVCGNQHCIALSRD 154          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Medaka
Match: herc3 (HECT and RLD domain containing E3 ubiquitin protein ligase 3 [Source:NCBI gene;Acc:101155493])

HSP 1 Score: 132.109 bits (331), Expect = 1.581e-31
Identity = 87/272 (31.99%), Postives = 140/272 (51.47%), Query Frame = 1
Query:  148 IKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAI-LVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSP-VSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVC-LSENGDVYVWGKGDSGQLGLG-------PHYLSSEFPKL 924
            +   KI  +SCG    V +   G+ F +G  D GQLGL   +T +     + LK L + +I  V CG  H I  +   +L+ +G N+ GQLGL    +S   P  + S     + Q+ AGG+   A++ +G ++ WG N   QLGL D  D  +  P  + F +S  V Y+ CG+ H AA+++ G L+ +G+ +  +LG     N+  P+ +  L+   + Q++CG +HT+  +  +G VY +G    GQLG G       PH + ++F  L
Sbjct:   80 LDTQKITMVSCGRAHSVAVNEQGQVFVWGAGDGGQLGLETAETAV--RIPRLLKKLCDHSISQVVCGNQHCIALSRDGQLFTWGQNSSGQLGLGKGETSKLSPSPVKSLAGIPLAQITAGGDHCFALSLSGAVFGWGKNKAGQLGLNDKQDRAV--PCHIKFLRSQRVVYISCGDEHTAALTKSGGLFTFGDGSRGQLGHGSSNNELLPRRVMELMGTEVSQITCGRHHTLAFVPSSGTVYAFGCNSHGQLGTGILADLRSPHPVKNDFLTL 347          

HSP 2 Score: 130.568 bits (327), Expect = 4.772e-31
Identity = 100/360 (27.78%), Postives = 174/360 (48.33%), Query Frame = 1
Query:  172 LSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTV-ITTTKGLALSFGDGRHGKLGN--IGGARNYSNYMWPKLIANLDKDLWVYNV---QCGGCHTVVLVRNRESHEL 1224
            ++CG +  + + + G  +  G N  GQLG +  K   +P  + AL    +K  +V+CGR H++   E  +++ +G  + GQLGL+   ++   P+ +      +I Q+  G +   A++  G+L+ WG NS  QLGLG      +    + S    P++ +  G  H  A+S  G ++ WG+    +LG + +++++ P  I  L    +  +SCG  HT  L+++G ++ +G G  GQLG G     S   +LL  P  +++  G  +        I+ G  HT+    + G   +FG   HG+LG   +   R+        L  NL KDL  Y V    CGG H+ ++  + +  E+
Sbjct:   38 VACGGQHTLFLLQDGSVYTCGSNSCGQLGHD--KAGNSPELVGALDT--QKITMVSCGRAHSVAVNEQGQVFVWGAGDGGQLGLETAETAVRIPRLLKKLCDHSISQVVCGNQHCIALSRDGQLFTWGQNSSGQLGLGKGETSKLSPSPVKSLAGIPLAQITAGGDHCFALSLSGAVFGWGKNKAGQLGLNDKQDRAVPCHIKFLRSQRVVYISCGDEHTAALTKSGGLFTFGDGSRGQLGHG-----SSNNELL--PRRVMELMGTEVS------QITCGRHHTLAFVPSSGTVYAFGCNSHGQLGTGILADLRSPHPVKNDFLTLNLRKDLRKYTVIKIICGGDHSFLMYSSEQCPEV 380          

HSP 3 Score: 101.679 bits (252), Expect = 6.177e-22
Identity = 72/263 (27.38%), Postives = 130/263 (49.43%), Query Frame = 1
Query:  109 GEIGGEELETKLWIK-------NDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTT-LTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAI--SQGRLYVWGEYTNQKLGDSFQENQSTPQGI------------LIKIPIKQVSCGHNHTVCL 831
            G++G E  ET + I        +  I  + CG++ C+ ++R G+ F +G+N  GQLGL   +T+ L+PS +K+L  +    I      C  +  + S  ++G+G N  GQLGL+DK    + P  I       +  +  G E +AA+ ++G L+ +G  S  QLG G  ++E++ +  ++    + VS + CG +H  A   S G +Y +G  ++ +LG     +  +P  +            L K  + ++ CG +H+  +
Sbjct:  113 GQLGLETAETAVRIPRLLKKLCDHSISQVVCGNQHCIALSRDGQLFTWGQNSSGQLGLGKGETSKLSPSPVKSLAGIPLAQITAGGDHCFAL--SLSGAVFGWGKNKAGQLGLNDK-QDRAVPCHIKFLRSQRVVYISCGDEHTAALTKSGGLFTFGDGSRGQLGHGSSNNELLPR-RVMELMGTEVSQITCGRHHTLAFVPSSGTVYAFGCNSHGQLGTGILADLRSPHPVKNDFLTLNLRKDLRKYTVIKIICGGDHSFLM 371          

HSP 4 Score: 100.138 bits (248), Expect = 2.203e-21
Identity = 86/315 (27.30%), Postives = 137/315 (43.49%), Query Frame = 1
Query:  391 FGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKS-PVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGILIKI---PIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLR----IPNLLVKGSGD------------------------------------SLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLV 1200
            +G   DGQLG+  + +   EP+    +    + ++  GG+ +  + + G +Y  GSNS  QLG     D+    P L+    +  ++ V CG  H+ A++ QG+++VWG     +LG    E       +L K+    I QV CG+ H + LS +G ++ WG+  SGQLGLG    S   P  ++    IP   +   GD                                        +++ + IS G+ HT   T  G   +FGDG  G+LG+  G+ N  N + P+ +  L     V  + CG  HT+  V
Sbjct:    4 WGNARDGQLGIGVEGNPVFEPRICHVFSGRGLKEVACGGQHTLFLLQDGSVYTCGSNSCGQLG----HDKAGNSPELVGALDTQKITMVSCGRAHSVAVNEQGQVFVWGAGDGGQLGLETAETAVRIPRLLKKLCDHSISQVVCGNQHCIALSRDGQLFTWGQNSSGQLGLGKGETSKLSPSPVKSLAGIPLAQITAGGDHCFALSLSGAVFGWGKNKAGQLGLNDKQDRAVPCHIKFLRSQRVVYISCGDEHTAALTKSGGLFTFGDGSRGQLGH--GSSN--NELLPRRVMEL-MGTEVSQITCGRHHTLAFV 309          

HSP 5 Score: 52.373 bits (124), Expect = 1.617e-6
Identity = 43/139 (30.94%), Postives = 66/139 (47.48%), Query Frame = 1
Query:  790 IKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRN 1206
            +K+V+CG  HT+ L ++G VY  G    GQLG   H  +   P+L+        G+ D    T+K   +S G +H+V    +G    +G G  G+LG +  A        P+L+  L  D  +  V CG  H + L R+
Sbjct:   35 LKEVACGGQHTLFLLQDGSVYTCGSNSCGQLG---HDKAGNSPELV--------GALD----TQKITMVSCGRAHSVAVNEQGQVFVWGAGDGGQLG-LETAETAVRI--PRLLKKL-CDHSISQVVCGNQHCIALSRD 154          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Medaka
Match: herc3 (HECT and RLD domain containing E3 ubiquitin protein ligase 3 [Source:NCBI gene;Acc:101155493])

HSP 1 Score: 130.954 bits (328), Expect = 3.313e-31
Identity = 87/272 (31.99%), Postives = 140/272 (51.47%), Query Frame = 1
Query:  148 IKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAI-LVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSP-VSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVC-LSENGDVYVWGKGDSGQLGLG-------PHYLSSEFPKL 924
            +   KI  +SCG    V +   G+ F +G  D GQLGL   +T +     + LK L + +I  V CG  H I  +   +L+ +G N+ GQLGL    +S   P  + S     + Q+ AGG+   A++ +G ++ WG N   QLGL D  D  +  P  + F +S  V Y+ CG+ H AA+++ G L+ +G+ +  +LG     N+  P+ +  L+   + Q++CG +HT+  +  +G VY +G    GQLG G       PH + ++F  L
Sbjct:   80 LDTQKITMVSCGRAHSVAVNEQGQVFVWGAGDGGQLGLETAETAVRIP--RLLKKLCDHSISQVVCGNQHCIALSRDGQLFTWGQNSSGQLGLGKGETSKLSPSPVKSLAGIPLAQITAGGDHCFALSLSGAVFGWGKNKAGQLGLNDKQDRAV--PCHIKFLRSQRVVYISCGDEHTAALTKSGGLFTFGDGSRGQLGHGSSNNELLPRRVMELMGTEVSQITCGRHHTLAFVPSSGTVYAFGCNSHGQLGTGILADLRSPHPVKNDFLTL 347          

HSP 2 Score: 124.02 bits (310), Expect = 5.236e-29
Identity = 95/297 (31.99%), Postives = 145/297 (48.82%), Query Frame = 1
Query:  334 VACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLS-FFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYTNQKLGDSFQENQS---TPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFP---KLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLV 1200
            VACG  HT+   +   +Y  G N+ GQLG D    + + P+ + +     I  +  G   S A+NE G+++VWG+    QLGL + ++  +  P LL       +S V CGN H  A+S+ G+L+ WG+ ++ +LG    E      +P   L  IP+ Q++ G +H   LS +G V+ WGK  +GQLGL         P   K LR               +++ + IS G+ HT   T  G   +FGDG  G+LG+  G+ N  N + P+ +  L     V  + CG  HT+  V
Sbjct:   38 VACGGQHTLFLLQDGSVYTCGSNSCGQLGHD---KAGNSPELVGALDTQKITMVSCGRAHSVAVNEQGQVFVWGAGDGGQLGL-ETAETAVRIPRLLKKLCDHSISQVVCGNQHCIALSRDGQLFTWGQNSSGQLGLGKGETSKLSPSPVKSLAGIPLAQITAGGDHCFALSLSGAVFGWGKNKAGQLGLNDKQ-DRAVPCHIKFLR---------------SQRVVYISCGDEHTAALTKSGGLFTFGDGSRGQLGH--GSSN--NELLPRRVMEL-MGTEVSQITCGRHHTLAFV 309          

HSP 3 Score: 120.553 bits (301), Expect = 8.346e-28
Identity = 86/307 (28.01%), Postives = 152/307 (49.51%), Query Frame = 1
Query:  172 LSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTV-ITTTKGLALSFGDGRHGKLG 1080
            ++CG +  + + + G  +  G N  GQLG +  K   +P  + AL    +K  +V+CGR H++   E  +++ +G  + GQLGL+   ++   P+ +      +I Q+  G +   A++  G+L+ WG NS  QLGLG      +    + S    P++ +  G  H  A+S  G ++ WG+    +LG + +++++ P  I  L    +  +SCG  HT  L+++G ++ +G G  GQLG G     S   +LL  P  +++  G  +        I+ G  HT+    + G   +FG   HG+LG
Sbjct:   38 VACGGQHTLFLLQDGSVYTCGSNSCGQLGHD--KAGNSPELVGALDT--QKITMVSCGRAHSVAVNEQGQVFVWGAGDGGQLGLETAETAVRIPRLLKKLCDHSISQVVCGNQHCIALSRDGQLFTWGQNSSGQLGLGKGETSKLSPSPVKSLAGIPLAQITAGGDHCFALSLSGAVFGWGKNKAGQLGLNDKQDRAVPCHIKFLRSQRVVYISCGDEHTAALTKSGGLFTFGDGSRGQLGHG-----SSNNELL--PRRVMELMGTEVS------QITCGRHHTLAFVPSSGTVYAFGCNSHGQLG 327          

HSP 4 Score: 98.5969 bits (244), Expect = 6.798e-21
Identity = 68/232 (29.31%), Postives = 119/232 (51.29%), Query Frame = 1
Query:  109 GEIGGEELETKLWIK-------NDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTT-LTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAI--SQGRLYVWGEYTNQKLGDSFQENQSTPQGI 774
            G++G E  ET + I        +  I  + CG++ C+ ++R G+ F +G+N  GQLGL   +T+ L+PS +K+L  +    I    G  H    + S  ++G+G N  GQLGL+DK    + P  I       +  +  G E +AA+ ++G L+ +G  S  QLG G  ++E++ +  ++    + VS + CG +H  A   S G +Y +G  ++ +LG     +  +P  +
Sbjct:  113 GQLGLETAETAVRIPRLLKKLCDHSISQVVCGNQHCIALSRDGQLFTWGQNSSGQLGLGKGETSKLSPSPVKSLAGIPLAQI--TAGGDHCFALSLSGAVFGWGKNKAGQLGLNDK-QDRAVPCHIKFLRSQRVVYISCGDEHTAALTKSGGLFTFGDGSRGQLGHGSSNNELLPR-RVMELMGTEVSQITCGRHHTLAFVPSSGTVYAFGCNSHGQLGTGILADLRSPHPV 340          

HSP 5 Score: 51.6026 bits (122), Expect = 2.324e-6
Identity = 43/139 (30.94%), Postives = 66/139 (47.48%), Query Frame = 1
Query:  790 IKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRN 1206
            +K+V+CG  HT+ L ++G VY  G    GQLG   H  +   P+L+        G+ D    T+K   +S G +H+V    +G    +G G  G+LG +  A        P+L+  L  D  +  V CG  H + L R+
Sbjct:   35 LKEVACGGQHTLFLLQDGSVYTCGSNSCGQLG---HDKAGNSPELV--------GALD----TQKITMVSCGRAHSVAVNEQGQVFVWGAGDGGQLG-LETAETAVRI--PRLLKKL-CDHSISQVVCGNQHCIALSRD 154          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Medaka
Match: herc4 (HECT and RLD domain containing E3 ubiquitin protein ligase 4 [Source:NCBI gene;Acc:101174618])

HSP 1 Score: 130.568 bits (327), Expect = 4.220e-31
Identity = 100/328 (30.49%), Postives = 161/328 (49.09%), Query Frame = 1
Query:  229 YGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQG-RLYVWGEYTNQKLGDSFQ-ENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNY-MWPKLIANLDKDLWVYNVQCGGCHTVVL 1197
            +G   +GQLGL  I   +     K      ++   V CGR HT    E   +Y  GCN+ GQLG +    S  +P+++ +     I  L  G   + A+N+ G+++ WG  S+ QLGL +  + +     + S     V+ V CG +H+ A+S+G  ++ WG+    +LG     ++ S PQ +  L  IP  Q++ G  H+  L+ +G V+ WG+   GQLGL        FP LL+           +L S ++ I IS GE HT   T +G   +FG G +G+LG+     N +N+ + P+ +  L  ++ V  + CG  HT+  
Sbjct:    4 WGNASYGQLGLGGIDEEIVVEPRKCEFFHGKRVRDVGCGRRHTAFLLEDGTVYTCGCNDLGQLGHE---KSRKKPEQVVALDAQIIVALSCGESHTLALNDKGQVFSWGLGSDGQLGLNNFEECIRVPRNIKSLSDVQVAQVACGYWHSLALSKGGHIFSWGQNRYGQLGLGMTGQSISVPQHLQSLQGIPFAQIAAGGAHSFALTLSGAVFGWGRNKFGQLGLNDTN-DRCFPALLK-----------ALRS-QRVIYISCGEDHTAALTKEGGVFTFGAGGYGQLGH-----NSTNHEVNPRKVFELMGNV-VTQIACGRQHTLAF 309          

HSP 2 Score: 105.531 bits (262), Expect = 4.131e-23
Identity = 83/316 (26.27%), Postives = 140/316 (44.30%), Query Frame = 1
Query:  145 WIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTV-ITTTKGLALSFGDGRHGKLG 1080
            +    ++  + CG      +   G  +  G ND GQLG    K+   P  + AL    +  + ++CG  HT+   +  +++ +G  +DGQLGL++       P+ I S     + Q+  G   S A+++ G ++ WG N   QLGLG     +     L S    P + +  G  H+ A++  G ++ WG     +LG +   ++  P  +  L    +  +SCG +HT  L++ G V+ +G G  GQLG           K+  +   +V               I+ G  HT+  T + G   SFG G +G+LG
Sbjct:   30 FFHGKRVRDVGCGRRHTAFLLEDGTVYTCGCNDLGQLGHE--KSRKKPEQVVALDA--QIIVALSCGESHTLALNDKGQVFSWGLGSDGQLGLNNFEECIRVPRNIKSLSDVQVAQVACGYWHSLALSKGGHIFSWGQNRYGQLGLGMTGQSISVPQHLQSLQGIPFAQIAAGGAHSFALTLSGAVFGWGRNKFGQLGLNDTNDRCFPALLKALRSQRVIYISCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTNHEVNPRKVFELMGNVVT-------------QIACGRQHTLAFTPSSGKMDSFGLGGNGQLG 328          

HSP 3 Score: 60.077 bits (144), Expect = 6.407e-9
Identity = 36/123 (29.27%), Postives = 63/123 (51.22%), Query Frame = 1
Query:   88 TGALF-----NFGEIGGEELETKLW------IKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESK-KLYGFGCNNDGQLG 420
            +GA+F      FG++G  +   + +      +++ ++I +SCG++    +T+ G  F +G   +GQLG N     + P   K  + +      +ACGR HT+ +T S  K+  FG   +GQLG
Sbjct:  208 SGAVFGWGRNKFGQLGLNDTNDRCFPALLKALRSQRVIYISCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTNHEVNPR--KVFELMGNVVTQIACGRQHTLAFTPSSGKMDSFGLGGNGQLG 328          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Planmine SMEST
Match: SMESG000062950.1 (SMESG000062950.1)

HSP 1 Score: 1184.86 bits (3064), Expect = 0.000e+0
Identity = 596/606 (98.35%), Postives = 596/606 (98.35%), Query Frame = 1
Query:   55 MTLIDENYIPETGALFNFGEIGGEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQGRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNRESHELINEIISEYALATIESDTFSLLSENTEFXXXXXXXXXXXXEHLKTEDGDLPTLIQLNPIFNGIPENNTRXXXXXXXXXXXXXDNPKTNGDIEERIDVMQTGTLQSAPTEATLNTIDQYDKAQESSDKNSISTVYSNVSPNKKNLTDESEIKPIDTKTEATNPEVAHVGCAANCKRNQKSDPKKTSTEMPQEKDQCSTTSINSENNKSKQESKTCSLL 1872
            MTLIDENYIPETGALFNFGEIGGEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQGRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNRESHELINEIISEYALATIESDTFSLLSENTEFNSSSLRARRNRREHLKTEDGDLPTLIQLNPIFNGIPENNTR         KK KDNPKTNGDIEERIDVMQTGTLQSAPTEATLNTIDQYDKAQESSDKNSISTVYSNVSPNKKNLTDESEIKPIDTKTEATNPEVAHVGCAANCKRNQKSDPKKTSTEMPQEKDQCSTTSINSENNKSKQESKTCSLL
Sbjct:    1 MTLIDENYIPETGALFNFGEIGGEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQGRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNRESHELINEIISEYALATIESDTFSLLSENTEFNSSSLRARRNRREHLKTEDGDLPTLIQLNPIFNGIPENNTR---------KKKKDNPKTNGDIEERIDVMQTGTLQSAPTEATLNTIDQYDKAQESSDKNSISTVYSNVSPNKKNLTDESEIKPIDTKTEATNPEVAHVGCAANCKRNQKSDPKKTSTEMPQEKDQCSTTSINSENNKSKQESKTCSLL 597          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Planmine SMEST
Match: SMESG000062950.1 (SMESG000062950.1)

HSP 1 Score: 961.444 bits (2484), Expect = 0.000e+0
Identity = 493/493 (100.00%), Postives = 493/493 (100.00%), Query Frame = 1
Query:   55 MTLIDENYIPETGALFNFGEIGGEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQGRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNRESHELINEIISEYALATIESDTFSLLSENTEFXXXXXXXXXXXXEHLKTEDGDLPTLIQLNPIFNGIPENNTRXXXXXXXXXXXXXDNPKTNGDIEERIDVMQTGTLQ 1533
            MTLIDENYIPETGALFNFGEIGGEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQGRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNRESHELINEIISEYALATIESDTFSLLSENTEFNSSSLRARRNRREHLKTEDGDLPTLIQLNPIFNGIPENNTRKKKKVSILSKKLKDNPKTNGDIEERIDVMQTGTLQ
Sbjct:    1 MTLIDENYIPETGALFNFGEIGGEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQGRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNRESHELINEIISEYALATIESDTFSLLSENTEFNSSSLRARRNRREHLKTEDGDLPTLIQLNPIFNGIPENNTRKKKKVSILSKKLKDNPKTNGDIEERIDVMQTGTLQ 493          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Planmine SMEST
Match: SMESG000062950.1 (SMESG000062950.1)

HSP 1 Score: 954.896 bits (2467), Expect = 0.000e+0
Identity = 483/493 (97.97%), Postives = 483/493 (97.97%), Query Frame = 1
Query:   55 MTLIDENYIPETGALFNFGEIGGEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQGRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNRESHELINEIISEYALATIESDTFSLLSENTEFXXXXXXXXXXXXEHLKTEDGDLPTLIQLNPIFNGIPENNTRXXXXXXXXXXXXXDNPKTNGDIEERIDVMQTGTLQ 1533
            MTLIDENYIPETGALFNFGEIGGEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQGRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNRESHELINEIISEYALATIESDTFSLLSENTEFNSSSLRARRNRREHLKTEDGDLPTLIQLNPIFNGIPENNTR         KK KDNPKTNGDIEERIDVMQTGTLQ
Sbjct:    1 MTLIDENYIPETGALFNFGEIGGEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQGRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNRESHELINEIISEYALATIESDTFSLLSENTEFNSSSLRARRNRREHLKTEDGDLPTLIQLNPIFNGIPENNTR---------KKKKDNPKTNGDIEERIDVMQTGTLQ 484          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Planmine SMEST
Match: SMESG000062950.1 (SMESG000062950.1)

HSP 1 Score: 919.072 bits (2374), Expect = 0.000e+0
Identity = 458/458 (100.00%), Postives = 458/458 (100.00%), Query Frame = 1
Query:   55 MTLIDENYIPETGALFNFGEIGGEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQGRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNRESHELINEIISEYALATIESDTFSLLSENTEFXXXXXXXXXXXXEHLKTEDGDLPTLIQLNPIFNGIPENNTR 1428
            MTLIDENYIPETGALFNFGEIGGEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQGRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNRESHELINEIISEYALATIESDTFSLLSENTEFNSSSLRARRNRREHLKTEDGDLPTLIQLNPIFNGIPENNTR
Sbjct:    1 MTLIDENYIPETGALFNFGEIGGEELETKLWIKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQGRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNRESHELINEIISEYALATIESDTFSLLSENTEFNSSSLRARRNRREHLKTEDGDLPTLIQLNPIFNGIPENNTR 458          
BLAST of Retinitis pigmentosa GTPase regulator b vs. Planmine SMEST
Match: SMESG000033113.1 (SMESG000033113.1)

HSP 1 Score: 129.798 bits (325), Expect = 6.994e-31
Identity = 87/249 (34.94%), Postives = 133/249 (53.41%), Query Frame = 1
Query:  160 KIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAIL-VACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFF-KSPVSYVDCGNYHAAAIS-QGRLYVWGEYTNQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVC-LSENGDVYVWGKGDSGQLGL 888
            K+I  S G +   ++T  G  F +GKN +G+LG    +  L+   IK +++L    I+ VACG  HT+  T++ +++ +G N  GQLGL D     S P++I +     I  + AG +FS  +  +G LY WGSN+  QLG  D +      P ++    K P+ YV  G  H AA+S  G ++ WG     +LG +  EN+S P  +  L+   + Q+ CG NHT+  +   G VY +G G  GQLG+
Sbjct:  504 KLIDASAGYDHNAVVTDLGLVFTWGKNSFGELG----RDKLSDFSIKLVQSLTGHFIVQVACGHDHTLALTKNSEIFSWGANTCGQLGLGDNFDMVSTPQQIKNLSNLPIKSITAGDKFSFVLTPSGFLYSWGSNNYGQLG-RDLTTSYESLPLMVKHLRKQPIVYVSVGQNHVAALSIDGGVFTWGHGRYGQLGHNNFENKSIPCIVMDLLGSKVSQIECGMNHTLAYMVSTGTVYAFGLGKFGQLGI 747          

HSP 2 Score: 105.531 bits (262), Expect = 4.144e-23
Identity = 93/341 (27.27%), Postives = 162/341 (47.51%), Query Frame = 1
Query:  196 VLITRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAI-LVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYVDCGNYHAAAISQ-GRLYVWGEYT--NQKLGDSFQENQSTPQGI--LIKIPIKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLV 1200
            ++I +    F +G   +GQLG+ D +     S  + +  ++   I  ++CG  HT+   ++ KLY  G N   +LG D    +  +P +I       +    AG + +A + + G ++ WG NS  +LG    SD  I    + S     +  V CG+ H  A+++   ++ WG  T     LGD+F +  STPQ I  L  +PIK ++ G   +  L+ +G +Y WG  + GQLG     L++ +  L     L+VK         +  + +S G++H    +  G   ++G GR+G+LG+     N+ N   P ++ +L     V  ++CG  HT+  +
Sbjct:  412 IIILKMISIFSFGAASYGQLGI-DPRNKDYYSYPQKIDKISSSDIEKISCGFDHTLFLLKNGKLYSCGNNEFKKLGHD---CNKFKPNQIQMLDAHKLIDASAGYDHNAVVTDLGLVFTWGKNSFGELGRDKLSDFSI--KLVQSLTGHFIVQVACGHDHTLALTKNSEIFSWGANTCGQLGLGDNF-DMVSTPQQIKNLSNLPIKSITAGDKFSFVLTPSGFLYSWGSNNYGQLGRD---LTTSYESL----PLMVKHL-----RKQPIVYVSVGQNHVAALSIDGGVFTWGHGRYGQLGH----NNFENKSIPCIVMDLLGSK-VSQIECGMNHTLAYM 728          

HSP 3 Score: 53.9138 bits (128), Expect = 4.025e-7
Identity = 41/150 (27.33%), Postives = 75/150 (50.00%), Query Frame = 1
Query:  148 IKNDKIISLSCGDEFCVLITRSGRAFGYGKNDWGQLGLNDIKTTL--TPSCIKALKNLNEKAILVACGRCHTIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAGGEFSAA-INETGKLYVWGSNSEYQLGLGD 588
            + N  I S++ GD+F  ++T SG  + +G N++GQLG  D+ T+    P  +K L+   +  + V+ G+ H    +    ++ +G    GQLG  +   + S P  +   +   + Q++ G   + A +  TG +Y +G     QLG+ D
Sbjct:  604 LSNLPIKSITAGDKFSFVLTPSGFLYSWGSNNYGQLG-RDLTTSYESLPLMVKHLR--KQPIVYVSVGQNHVAALSIDGGVFTWGHGRYGQLG-HNNFENKSIPCIVMDLLGSKVSQIECGMNHTLAYMVSTGTVYAFGLGKFGQLGICD 749          

HSP 4 Score: 53.5286 bits (127), Expect = 5.471e-7
Identity = 41/141 (29.08%), Postives = 68/141 (48.23%), Query Frame = 1
Query:  790 IKQVSCGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKGSGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNYSNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNRE 1212
            I+++SCG +HT+ L +NG +Y  G  +  +LG    +  ++F      PN +       +    K I+ SAG  H  + T  GL  ++G    G+LG     R+  +    KL+ +L    ++  V CG  HT+ L +N E
Sbjct:  455 IEKISCGFDHTLFLLKNGKLYSCGNNEFKKLG----HDCNKFK-----PNQI------QMLDAHKLIDASAGYDHNAVVTDLGLVFTWGKNSFGELG-----RDKLSDFSIKLVQSLTGH-FIVQVACGHDHTLALTKNSE 574          
The following BLAST results are available for this feature:
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPGR5.819e-7641.82retinitis pigmentosa GTPase regulator [Source:HGNC... [more]
RPGR1.057e-7541.30retinitis pigmentosa GTPase regulator [Source:HGNC... [more]
RPGR1.866e-7541.82retinitis pigmentosa GTPase regulator [Source:HGNC... [more]
RPGR6.144e-7541.82retinitis pigmentosa GTPase regulator [Source:HGNC... [more]
RPGR7.226e-7541.82retinitis pigmentosa GTPase regulator [Source:HGNC... [more]
back to top
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
herc-17.563e-2527.00HECT and RCC domain E3 ubiquitin ligase [Source:U... [more]
herc-17.563e-2527.00HECT and RCC domain E3 ubiquitin ligase [Source:U... [more]
glo-41.947e-1725.00X-linked retinitis pigmentosa GTPase regulator hom... [more]
nekl-16.758e-1427.80NEK (NEver in mitosis Kinase) Like [Source:UniPro... [more]
nekl-17.628e-1427.80NEK (NEver in mitosis Kinase) Like [Source:UniPro... [more]
back to top
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Herc43.915e-2927.35gene:FBgn0035207 transcript:FBtr0072670[more]
Herc43.915e-2927.35gene:FBgn0035207 transcript:FBtr0072671[more]
Herc41.049e-2826.55gene:FBgn0035207 transcript:FBtr0310555[more]
HERC21.743e-2827.01gene:FBgn0031107 transcript:FBtr0301344[more]
niki3.212e-1929.50gene:FBgn0045980 transcript:FBtr0084737[more]
back to top
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpgrb3.745e-7841.97retinitis pigmentosa GTPase regulator b [Source:ZF... [more]
rpgrb1.569e-7641.75retinitis pigmentosa GTPase regulator b [Source:ZF... [more]
rpgra4.681e-6136.25retinitis pigmentosa GTPase regulator a [Source:ZF... [more]
rpgra1.086e-5836.22retinitis pigmentosa GTPase regulator a [Source:ZF... [more]
herc37.692e-3232.95HECT and RLD domain containing E3 ubiquitin protei... [more]
back to top
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000039322.11.044e-2831.55HECT and RLD domain containing E3 ubiquitin protei... [more]
ENSXETT00000039332.11.337e-2831.55HECT and RLD domain containing E3 ubiquitin protei... [more]
ENSXETT00000039331.11.356e-2831.55HECT and RLD domain containing E3 ubiquitin protei... [more]
ENSXETT00000027619.11.379e-2831.55HECT and RLD domain containing E3 ubiquitin protei... [more]
ENSXETT00000027632.11.394e-2831.55HECT and RLD domain containing E3 ubiquitin protei... [more]
back to top
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rpgr7.946e-8041.45retinitis pigmentosa GTPase regulator [Source:MGI ... [more]
Rpgr1.071e-7941.45retinitis pigmentosa GTPase regulator [Source:MGI ... [more]
Rpgr1.096e-7941.45retinitis pigmentosa GTPase regulator [Source:MGI ... [more]
Rpgr2.079e-7841.45retinitis pigmentosa GTPase regulator [Source:MGI ... [more]
Rpgr2.749e-7841.45retinitis pigmentosa GTPase regulator [Source:MGI ... [more]
back to top
BLAST of Retinitis pigmentosa GTPase regulator b vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9R0X5|RPGR_MOUSE8.320e-7841.45X-linked retinitis pigmentosa GTPase regulator OS=... [more]
sp|Q92834|RPGR_HUMAN1.477e-7341.82X-linked retinitis pigmentosa GTPase regulator OS=... [more]
sp|Q9N1T2|RPGR_CANLF1.303e-6939.53X-linked retinitis pigmentosa GTPase regulator OS=... [more]
sp|Q9FN03|UVR8_ARATH1.070e-3433.97Ultraviolet-B receptor UVR8 OS=Arabidopsis thalian... [more]
sp|Q5PQN1|HERC4_RAT6.644e-3332.22Probable E3 ubiquitin-protein ligase HERC4 OS=Ratt... [more]
back to top
BLAST of Retinitis pigmentosa GTPase regulator b vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A288XNL13.020e-8344.22Retinitis pigmentosa GTPase regulator OS=Leptochit... [more]
B3RXM08.286e-8142.67Uncharacterized protein OS=Trichoplax adhaerens OX... [more]
T2M8L11.837e-8042.03X-linked retinitis pigmentosa GTPase regulator (Fr... [more]
A0A369S3Q93.459e-8042.67X-linked retinitis pigmentosa GTPase regulator OS=... [more]
B7ZR071.380e-7940.75RPGR OS=Xenopus laevis OX=8355 GN=LOC734172 PE=2 S... [more]
back to top
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpgrb8.917e-7241.39X-linked retinitis pigmentosa GTPase regulator-lik... [more]
RPGR3.967e-5537.14retinitis pigmentosa GTPase regulator [Source:HGNC... [more]
herc38.822e-3231.73HECT and RLD domain containing E3 ubiquitin protei... [more]
herc31.153e-3131.73HECT and RLD domain containing E3 ubiquitin protei... [more]
herc31.841e-3131.73HECT and RLD domain containing E3 ubiquitin protei... [more]
back to top
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rcc1l4.052e-2126.60RCC1 like [Source:ZFIN;Acc:ZDB-GENE-060526-370][more]
NEK93.271e-2029.09NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC... [more]
rcc23.329e-2028.52regulator of chromosome condensation 2 [Source:NCB... [more]
rcc27.660e-2024.14regulator of chromosome condensation 2 [Source:NCB... [more]
ENSPMAT00000001750.14.192e-1927.60pep scaffold:Pmarinus_7.0:GL481695:1137:12922:1 ge... [more]
back to top
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SRM19.575e-1622.87Nucleotide exchange factor for Gsp1p; localizes to... [more]
back to top
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO447043.751e-7741.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490995.382e-2828.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345921.784e-2726.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371961.753e-2627.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478746.671e-2325.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Retinitis pigmentosa GTPase regulator b vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpgrb5.161e-7441.04X-linked retinitis pigmentosa GTPase regulator [So... [more]
herc31.528e-3131.99HECT and RLD domain containing E3 ubiquitin protei... [more]
herc31.581e-3131.99HECT and RLD domain containing E3 ubiquitin protei... [more]
herc33.313e-3131.99HECT and RLD domain containing E3 ubiquitin protei... [more]
herc44.220e-3130.49HECT and RLD domain containing E3 ubiquitin protei... [more]
back to top
BLAST of Retinitis pigmentosa GTPase regulator b vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062950.10.000e+098.35SMESG000062950.1[more]
SMESG000062950.10.000e+0100.00SMESG000062950.1[more]
SMESG000062950.10.000e+097.97SMESG000062950.1[more]
SMESG000062950.10.000e+0100.00SMESG000062950.1[more]
SMESG000033113.16.994e-3134.94SMESG000033113.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001587 ID=SMED30001587|Name=Retinitis pigmentosa GTPase regulator b|organism=Schmidtea mediterranea sexual|type=transcript|length=1906bp
TTTAGTTTTAATAATCATTAGGCAAATAATTGAAAAAAGATTGACCTAGC
AACAATGACTCTTATTGATGAGAACTATATACCAGAAACTGGAGCATTAT
TTAATTTTGGCGAAATCGGTGGTGAAGAATTAGAAACTAAGCTTTGGATC
AAAAATGATAAAATTATTTCCTTGTCGTGTGGAGACGAATTTTGTGTGCT
CATTACAAGGAGCGGCAGAGCTTTTGGCTATGGTAAAAATGATTGGGGAC
AACTTGGTTTGAATGACATCAAAACAACACTCACCCCGTCATGCATTAAA
GCACTAAAGAATCTGAATGAAAAAGCCATTCTTGTAGCATGTGGAAGATG
CCACACCATCATTTGGACAGAAAGTAAAAAACTTTATGGTTTCGGGTGCA
ATAATGATGGACAACTTGGACTTGATGACAAAATAAGCTCAACTTCTGAA
CCTAAGGAGATCACTTCTTGGATATATGGGAATATTTGTCAATTAAAAGC
AGGTGGGGAATTTTCAGCAGCAATCAATGAAACGGGTAAACTGTACGTTT
GGGGATCCAATTCAGAGTACCAATTAGGTTTGGGAGACCATTCAGATGAA
GTTATCTATAAACCAACATTATTATCCTTTTTTAAAAGTCCCGTTAGTTA
TGTTGATTGTGGCAATTATCACGCTGCAGCTATAAGCCAAGGCAGATTAT
ACGTTTGGGGTGAATATACAAATCAGAAATTAGGGGATAGTTTTCAAGAA
AATCAAAGCACTCCTCAAGGGATTTTAATCAAAATACCTATCAAACAAGT
TTCATGTGGTCACAATCACACCGTCTGTCTTTCAGAAAACGGAGATGTTT
ATGTTTGGGGAAAAGGTGATTCTGGTCAGTTAGGTCTCGGGCCACATTAT
CTCAGTTCGGAATTTCCTAAATTATTACGAATACCGAATTTATTAGTTAA
AGGCAGCGGAGATAGTTTAGAATCAACGGAAAAATTTATTAATATTTCAG
CTGGTGAATCTCACACAGTGATTACCACAACAAAAGGGTTAGCCTTATCT
TTTGGAGATGGCAGACATGGCAAATTAGGTAATATTGGCGGCGCAAGAAA
TTATAGCAACTATATGTGGCCTAAATTGATTGCAAACTTAGACAAAGATT
TGTGGGTATATAACGTTCAATGTGGAGGATGCCATACAGTTGTTCTTGTT
CGGAATCGTGAATCCCACGAACTTATAAATGAGATAATCTCTGAATATGC
TCTTGCTACAATTGAAAGCGATACTTTCTCTCTTTTATCCGAAAATACTG
AATTTAATTCATCATCATTACGAGCCAGGCGAAATCGAAGAGAACATTTG
AAAACAGAAGATGGCGATTTGCCAACGTTAATCCAATTAAATCCAATTTT
TAATGGCATTCCAGAAAATAATACCAGAAAGAAAAAGAAAGTCTCAATAT
TATCAAAGAAATTAAAAGATAATCCAAAGACTAATGGAGATATTGAAGAA
CGTATAGACGTAATGCAAACCGGTACTCTCCAGTCAGCTCCTACGGAGGC
AACGTTGAATACAATTGATCAGTACGATAAAGCTCAGGAATCAAGTGATA
AAAATTCTATAAGCACTGTTTATTCTAATGTATCACCTAATAAAAAAAAT
CTGACAGATGAAAGTGAAATCAAGCCAATTGATACGAAAACCGAAGCCAC
AAATCCCGAAGTAGCGCATGTGGGATGCGCGGCAAATTGCAAAAGAAACC
AAAAATCAGATCCGAAGAAAACCTCAACAGAAATGCCACAGGAAAAAGAC
CAATGCTCCACAACATCCATCAATTCGGAAAACAACAAATCAAAACAGGA
ATCGAAAACTTGTTCTCTACTATGAACTGTCATTTACAAATTCTTTTTAT
ATTTTT
back to top

protein sequence of SMED30001587-orf-1

>SMED30001587-orf-1 ID=SMED30001587-orf-1|Name=SMED30001587-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=607bp
MTLIDENYIPETGALFNFGEIGGEELETKLWIKNDKIISLSCGDEFCVLI
TRSGRAFGYGKNDWGQLGLNDIKTTLTPSCIKALKNLNEKAILVACGRCH
TIIWTESKKLYGFGCNNDGQLGLDDKISSTSEPKEITSWIYGNICQLKAG
GEFSAAINETGKLYVWGSNSEYQLGLGDHSDEVIYKPTLLSFFKSPVSYV
DCGNYHAAAISQGRLYVWGEYTNQKLGDSFQENQSTPQGILIKIPIKQVS
CGHNHTVCLSENGDVYVWGKGDSGQLGLGPHYLSSEFPKLLRIPNLLVKG
SGDSLESTEKFINISAGESHTVITTTKGLALSFGDGRHGKLGNIGGARNY
SNYMWPKLIANLDKDLWVYNVQCGGCHTVVLVRNRESHELINEIISEYAL
ATIESDTFSLLSENTEFNSSSLRARRNRREHLKTEDGDLPTLIQLNPIFN
GIPENNTRKKKKVSILSKKLKDNPKTNGDIEERIDVMQTGTLQSAPTEAT
LNTIDQYDKAQESSDKNSISTVYSNVSPNKKNLTDESEIKPIDTKTEATN
PEVAHVGCAANCKRNQKSDPKKTSTEMPQEKDQCSTTSINSENNKSKQES
KTCSLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
GO:0010842retina layer formation
GO:0046548retinal rod cell development
GO:0060041retina development in camera-type eye
GO:0060287epithelial cilium movement involved in determination of left/right asymmetry
GO:0007601visual perception
GO:0060271cilium morphogenesis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000408Reg_chr_condens
IPR009091RCC1/BLIP-II
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000408Regulator of chromosome condensation, RCC1PRINTSPR00633RCCNDNSATIONcoord: 163..179
score: 35.29
coord: 249..265
score: 36.27
coord: 213..229
score: 22.55
coord: 265..279
score: 46.67
coord: 144..157
score: 30.95
coord: 109..125
score: 32.35
IPR000408Regulator of chromosome condensation, RCC1PFAMPF00415RCC1coord: 328..381
e-value: 3.6E-5
score: 24.3
coord: 213..259
e-value: 8.6E-8
score: 32.7
coord: 262..322
e-value: 5.4E-10
score: 39.7
coord: 161..210
e-value: 4.3E-12
score: 46.5
coord: 110..157
e-value: 3.9E-7
score: 30.6
coord: 53..102
e-value: 9.1E-10
score: 39.0
IPR000408Regulator of chromosome condensation, RCC1PROSITEPS00626RCC1_2coord: 249..259
IPR000408Regulator of chromosome condensation, RCC1PROSITEPS50012RCC1_3coord: 263..327
score: 14.645
IPR000408Regulator of chromosome condensation, RCC1PROSITEPS50012RCC1_3coord: 108..160
score: 11.73
IPR000408Regulator of chromosome condensation, RCC1PROSITEPS50012RCC1_3coord: 328..384
score: 12.092
IPR000408Regulator of chromosome condensation, RCC1PROSITEPS50012RCC1_3coord: 54..107
score: 12.997
IPR000408Regulator of chromosome condensation, RCC1PROSITEPS50012RCC1_3coord: 161..213
score: 15.489
IPR000408Regulator of chromosome condensation, RCC1PROSITEPS50012RCC1_3coord: 213..262
score: 14.042
IPR009091Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein IIGENE3DG3DSA:2.130.10.30coord: 3..386
e-value: 4.3E-95
score: 320.4
IPR009091Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein IISUPERFAMILYSSF50985RCC1/BLIP-IIcoord: 31..384
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 508..532
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 508..606
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 579..606
NoneNo IPR availablePANTHERPTHR45622:SF27X-LINKED RETINITIS PIGMENTOSA GTPASE REGULATORcoord: 6..437
NoneNo IPR availablePANTHERPTHR45622FAMILY NOT NAMEDcoord: 6..437