Spectrin alpha chain

Overview
NameSpectrin alpha chain
Smed IDSMED30001586
Length (bp)899
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Spectrin alpha chain (SMED30001586) t-SNE clustered cells

Violin plots show distribution of expression levels for Spectrin alpha chain (SMED30001586) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001586

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30001586SMESG000005289.1 dd_Smed_v4_919_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30001586SMESG000005289.1 dd_Smed_v4_919_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30001586SMESG000005289.1 dd_Smed_v4_919_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001586SMESG000005289.1 dd_Smed_v4_919_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30001586SMESG000005289.1 dd_Smed_v4_919_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30001586SMESG000005289.1 dd_Smed_v4_919_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001586SMESG000005289.1 dd_Smed_v4_919_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001586SMESG000005289.1 dd_Smed_v4_919_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30001586SMESG000005289.1 dd_Smed_v4_919_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001586SMESG000005289.1 Contig37746newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001586SMESG000005289.1 Contig37746uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30001586SMESG000005289.1 dd_Smed_v6_919_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001586SMESG000005289.1 dd_Smed_v6_919_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30001586SMESG000005289.1 dd_Smed_v6_919_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30001586SMESG000005289.1 dd_Smed_v6_919_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30001586SMESG000005289.1 dd_Smed_v6_919_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30001586SMESG000005289.1 dd_Smed_v6_919_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001586SMESG000005289.1 dd_Smed_v6_919_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30001586SMESG000005289.1 dd_Smed_v6_919_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001586SMESG000005289.1 dd_Smed_v4_919_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Spectrin alpha chain vs. Ensembl Human
Match: SPTAN1 (spectrin alpha, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11273])

HSP 1 Score: 85.5001 bits (210), Expect = 7.383e-20
Identity = 39/63 (61.90%), Postives = 52/63 (82.54%), Query Frame = 2
Query:   53 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q
Sbjct:   15 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQ 77          
BLAST of Spectrin alpha chain vs. Ensembl Human
Match: SPTAN1 (spectrin alpha, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11273])

HSP 1 Score: 86.2705 bits (212), Expect = 5.128e-18
Identity = 39/63 (61.90%), Postives = 52/63 (82.54%), Query Frame = 2
Query:   53 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQ 65          

HSP 2 Score: 51.6026 bits (122), Expect = 1.379e-6
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 2
Query:   86 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            DI  RR +VL+R+   K    E+R KL +++  Q F RD DE+E+WI EK+QT
Sbjct: 1521 DISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQT 1573          
BLAST of Spectrin alpha chain vs. Ensembl Human
Match: SPTAN1 (spectrin alpha, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11273])

HSP 1 Score: 86.2705 bits (212), Expect = 5.129e-18
Identity = 39/63 (61.90%), Postives = 52/63 (82.54%), Query Frame = 2
Query:   53 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQ 65          

HSP 2 Score: 51.6026 bits (122), Expect = 1.319e-6
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 2
Query:   86 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            DI  RR +VL+R+   K    E+R KL +++  Q F RD DE+E+WI EK+QT
Sbjct: 1521 DISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQT 1573          

HSP 3 Score: 48.9062 bits (115), Expect = 9.667e-6
Identity = 24/54 (44.44%), Postives = 36/54 (66.67%), Query Frame = 2
Query:   83 EDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            ED+  RR+ +L+R +A  E    RR +L D+   Q F RD+DEL+SW+ EK++T
Sbjct:  542 EDVATRRDALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKT 595          
BLAST of Spectrin alpha chain vs. Ensembl Human
Match: SPTAN1 (spectrin alpha, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11273])

HSP 1 Score: 86.2705 bits (212), Expect = 5.173e-18
Identity = 39/63 (61.90%), Postives = 52/63 (82.54%), Query Frame = 2
Query:   53 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQ 65          

HSP 2 Score: 51.6026 bits (122), Expect = 1.354e-6
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 2
Query:   86 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            DI  RR +VL+R+   K    E+R KL +++  Q F RD DE+E+WI EK+QT
Sbjct: 1501 DISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQT 1553          

HSP 3 Score: 48.9062 bits (115), Expect = 9.748e-6
Identity = 24/54 (44.44%), Postives = 36/54 (66.67%), Query Frame = 2
Query:   83 EDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            ED+  RR+ +L+R +A  E    RR +L D+   Q F RD+DEL+SW+ EK++T
Sbjct:  542 EDVATRRDALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKT 595          
BLAST of Spectrin alpha chain vs. Ensembl Human
Match: SPTAN1 (spectrin alpha, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11273])

HSP 1 Score: 86.2705 bits (212), Expect = 5.181e-18
Identity = 39/63 (61.90%), Postives = 52/63 (82.54%), Query Frame = 2
Query:   53 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQ 65          

HSP 2 Score: 51.6026 bits (122), Expect = 1.344e-6
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 2
Query:   86 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            DI  RR +VL+R+   K    E+R KL +++  Q F RD DE+E+WI EK+QT
Sbjct: 1521 DISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQT 1573          

HSP 3 Score: 48.9062 bits (115), Expect = 9.587e-6
Identity = 24/54 (44.44%), Postives = 36/54 (66.67%), Query Frame = 2
Query:   83 EDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            ED+  RR+ +L+R +A  E    RR +L D+   Q F RD+DEL+SW+ EK++T
Sbjct:  542 EDVATRRDALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKT 595          
BLAST of Spectrin alpha chain vs. Ensembl Celegans
Match: spc-1 (SPeCtrin [Source:UniProtKB/TrEMBL;Acc:G4S034])

HSP 1 Score: 83.5741 bits (205), Expect = 1.329e-17
Identity = 37/63 (58.73%), Postives = 53/63 (84.13%), Query Frame = 2
Query:   56 KEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            +EI+ILET +DI +RR++VL  YS FK+ ++ +R +LE+A+++QYFKRDADEL  WILEK+QT
Sbjct:   21 QEIRILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQT 83          

HSP 2 Score: 50.0618 bits (118), Expect = 1.447e-6
Identity = 22/51 (43.14%), Postives = 37/51 (72.55%), Query Frame = 2
Query:   89 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            +  +R+Q+L+R++  KEA  ++R KL +++  Q F RDADE+E+W+ EK Q
Sbjct: 1479 VTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQ 1529          
BLAST of Spectrin alpha chain vs. Ensembl Celegans
Match: spc-1 (SPeCtrin [Source:UniProtKB/TrEMBL;Acc:G4S034])

HSP 1 Score: 83.5741 bits (205), Expect = 1.329e-17
Identity = 37/63 (58.73%), Postives = 53/63 (84.13%), Query Frame = 2
Query:   56 KEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            +EI+ILET +DI +RR++VL  YS FK+ ++ +R +LE+A+++QYFKRDADEL  WILEK+QT
Sbjct:   21 QEIRILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQT 83          

HSP 2 Score: 50.0618 bits (118), Expect = 1.460e-6
Identity = 22/51 (43.14%), Postives = 37/51 (72.55%), Query Frame = 2
Query:   89 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            +  +R+Q+L+R++  KEA  ++R KL +++  Q F RDADE+E+W+ EK Q
Sbjct: 1484 VTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQ 1534          
BLAST of Spectrin alpha chain vs. Ensembl Fly
Match: alpha-Spec (gene:FBgn0250789 transcript:FBtr0332879)

HSP 1 Score: 97.8265 bits (242), Expect = 2.734e-22
Identity = 46/64 (71.88%), Postives = 57/64 (89.06%), Query Frame = 2
Query:   53 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            PKE+KILET EDIQERREQVL+RY+ FK  T ++R+KLED++++QYFKRDADELESWI EK+Q 
Sbjct:    6 PKEVKILETVEDIQERREQVLSRYNDFKIETRQKREKLEDSRRFQYFKRDADELESWIHEKLQA 69          

HSP 2 Score: 54.299 bits (129), Expect = 7.401e-8
Identity = 23/55 (41.82%), Postives = 39/55 (70.91%), Query Frame = 2
Query:   77 TPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
              +D+ +RR+ +L R +A +E + +RR+ LED+ +YQ F+RD DE + WI EK++
Sbjct:  543 AADDVAQRRQMLLARRAALQEKSSKRRQLLEDSNRYQQFERDCDETKGWISEKLK 597          

HSP 3 Score: 52.7582 bits (125), Expect = 2.346e-7
Identity = 25/51 (49.02%), Postives = 35/51 (68.63%), Query Frame = 2
Query:   89 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            + E+R+QVL R+   KE   E+R +L D +  Q F RDADE+E+WI EK+Q
Sbjct: 1502 VDEKRKQVLERWRHLKEGLIEKRSRLGDEQTLQQFSRDADEIENWIAEKLQ 1552          
BLAST of Spectrin alpha chain vs. Ensembl Fly
Match: alpha-Spec (gene:FBgn0250789 transcript:FBtr0332878)

HSP 1 Score: 97.8265 bits (242), Expect = 2.761e-22
Identity = 46/64 (71.88%), Postives = 57/64 (89.06%), Query Frame = 2
Query:   53 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            PKE+KILET EDIQERREQVL+RY+ FK  T ++R+KLED++++QYFKRDADELESWI EK+Q 
Sbjct:    6 PKEVKILETVEDIQERREQVLSRYNDFKIETRQKREKLEDSRRFQYFKRDADELESWIHEKLQA 69          

HSP 2 Score: 54.299 bits (129), Expect = 7.337e-8
Identity = 23/55 (41.82%), Postives = 39/55 (70.91%), Query Frame = 2
Query:   77 TPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
              +D+ +RR+ +L R +A +E + +RR+ LED+ +YQ F+RD DE + WI EK++
Sbjct:  543 AADDVAQRRQMLLARRAALQEKSSKRRQLLEDSNRYQQFERDCDETKGWISEKLK 597          

HSP 3 Score: 52.7582 bits (125), Expect = 2.410e-7
Identity = 25/51 (49.02%), Postives = 35/51 (68.63%), Query Frame = 2
Query:   89 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            + E+R+QVL R+   KE   E+R +L D +  Q F RDADE+E+WI EK+Q
Sbjct: 1502 VDEKRKQVLERWRHLKEGLIEKRSRLGDEQTLQQFSRDADEIENWIAEKLQ 1552          
BLAST of Spectrin alpha chain vs. Ensembl Fly
Match: alpha-Spec (gene:FBgn0250789 transcript:FBtr0332880)

HSP 1 Score: 97.8265 bits (242), Expect = 2.783e-22
Identity = 46/64 (71.88%), Postives = 57/64 (89.06%), Query Frame = 2
Query:   53 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            PKE+KILET EDIQERREQVL+RY+ FK  T ++R+KLED++++QYFKRDADELESWI EK+Q 
Sbjct:    6 PKEVKILETVEDIQERREQVLSRYNDFKIETRQKREKLEDSRRFQYFKRDADELESWIHEKLQA 69          

HSP 2 Score: 54.299 bits (129), Expect = 7.200e-8
Identity = 23/55 (41.82%), Postives = 39/55 (70.91%), Query Frame = 2
Query:   77 TPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
              +D+ +RR+ +L R +A +E + +RR+ LED+ +YQ F+RD DE + WI EK++
Sbjct:  543 AADDVAQRRQMLLARRAALQEKSSKRRQLLEDSNRYQQFERDCDETKGWISEKLK 597          

HSP 3 Score: 52.7582 bits (125), Expect = 2.430e-7
Identity = 25/51 (49.02%), Postives = 35/51 (68.63%), Query Frame = 2
Query:   89 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            + E+R+QVL R+   KE   E+R +L D +  Q F RDADE+E+WI EK+Q
Sbjct: 1470 VDEKRKQVLERWRHLKEGLIEKRSRLGDEQTLQQFSRDADEIENWIAEKLQ 1520          
BLAST of Spectrin alpha chain vs. Ensembl Fly
Match: alpha-Spec (gene:FBgn0250789 transcript:FBtr0072789)

HSP 1 Score: 97.8265 bits (242), Expect = 2.835e-22
Identity = 46/64 (71.88%), Postives = 57/64 (89.06%), Query Frame = 2
Query:   53 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            PKE+KILET EDIQERREQVL+RY+ FK  T ++R+KLED++++QYFKRDADELESWI EK+Q 
Sbjct:    6 PKEVKILETVEDIQERREQVLSRYNDFKIETRQKREKLEDSRRFQYFKRDADELESWIHEKLQA 69          

HSP 2 Score: 54.299 bits (129), Expect = 7.595e-8
Identity = 23/55 (41.82%), Postives = 39/55 (70.91%), Query Frame = 2
Query:   77 TPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
              +D+ +RR+ +L R +A +E + +RR+ LED+ +YQ F+RD DE + WI EK++
Sbjct:  543 AADDVAQRRQMLLARRAALQEKSSKRRQLLEDSNRYQQFERDCDETKGWISEKLK 597          

HSP 3 Score: 52.7582 bits (125), Expect = 2.517e-7
Identity = 25/51 (49.02%), Postives = 35/51 (68.63%), Query Frame = 2
Query:   89 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            + E+R+QVL R+   KE   E+R +L D +  Q F RDADE+E+WI EK+Q
Sbjct: 1470 VDEKRKQVLERWRHLKEGLIEKRSRLGDEQTLQQFSRDADEIENWIAEKLQ 1520          
BLAST of Spectrin alpha chain vs. Ensembl Zebrafish
Match: sptan1 (spectrin alpha, non-erythrocytic 1 [Source:ZFIN;Acc:ZDB-GENE-051113-60])

HSP 1 Score: 84.3445 bits (207), Expect = 1.296e-17
Identity = 38/60 (63.33%), Postives = 51/60 (85.00%), Query Frame = 2
Query:   62 IKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            +K+LET +DIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDADELE WI EK+Q
Sbjct:    6 VKVLETADDIQERRQQVLDRYRRFKELSVVRRQKLEDSYRFQFFRRDADELEKWIQEKLQ 65          

HSP 2 Score: 50.0618 bits (118), Expect = 2.742e-6
Identity = 25/56 (44.64%), Postives = 37/56 (66.07%), Query Frame = 2
Query:   77 TPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
              +D+  RR+ +L+R +A  E  + RR  LED+   Q F RD+DEL+SWI EK++T
Sbjct:  540 AKDDVATRRDALLSRRNALHERAQFRRAALEDSFHLQQFFRDSDELKSWINEKMKT 595          

HSP 3 Score: 48.521 bits (114), Expect = 8.315e-6
Identity = 26/55 (47.27%), Postives = 37/55 (67.27%), Query Frame = 2
Query:   80 PEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            PE I +RR +VL+R+   K    E+R KL +++  Q F RD DE+E+WI EK+QT
Sbjct: 1523 PE-IFKRRSEVLDRWLRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQT 1576          
BLAST of Spectrin alpha chain vs. Ensembl Xenopus
Match: sptan1 (spectrin, alpha, non-erythrocytic 1 [Source:NCBI gene;Acc:100036647])

HSP 1 Score: 84.3445 bits (207), Expect = 1.605e-17
Identity = 39/60 (65.00%), Postives = 51/60 (85.00%), Query Frame = 2
Query:   62 IKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDADELE WI EK+Q
Sbjct:    6 VKVLETAEDIQERRQQVLDRYLRFKELSVLRRQKLEDSYRFQFFQRDADELEKWIQEKLQ 65          

HSP 2 Score: 51.2174 bits (121), Expect = 1.481e-6
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 2
Query:   86 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            DI  RR +VL+R+   K    E+R KL +++  Q F RD DE+E+WI EK+QT
Sbjct: 1519 DIASRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQT 1571          
BLAST of Spectrin alpha chain vs. Ensembl Xenopus
Match: sptan1 (spectrin, alpha, non-erythrocytic 1 [Source:NCBI gene;Acc:100036647])

HSP 1 Score: 84.3445 bits (207), Expect = 1.635e-17
Identity = 39/60 (65.00%), Postives = 51/60 (85.00%), Query Frame = 2
Query:   62 IKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDADELE WI EK+Q
Sbjct:    6 VKVLETAEDIQERRQQVLDRYLRFKELSVLRRQKLEDSYRFQFFQRDADELEKWIQEKLQ 65          

HSP 2 Score: 51.2174 bits (121), Expect = 1.455e-6
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 2
Query:   86 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            DI  RR +VL+R+   K    E+R KL +++  Q F RD DE+E+WI EK+QT
Sbjct: 1520 DIASRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQT 1572          
BLAST of Spectrin alpha chain vs. Ensembl Xenopus
Match: sptan1 (spectrin, alpha, non-erythrocytic 1 [Source:NCBI gene;Acc:100036647])

HSP 1 Score: 84.3445 bits (207), Expect = 1.649e-17
Identity = 39/60 (65.00%), Postives = 51/60 (85.00%), Query Frame = 2
Query:   62 IKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDADELE WI EK+Q
Sbjct:    6 VKVLETAEDIQERRQQVLDRYLRFKELSVLRRQKLEDSYRFQFFQRDADELEKWIQEKLQ 65          

HSP 2 Score: 51.2174 bits (121), Expect = 1.480e-6
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 2
Query:   86 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            DI  RR +VL+R+   K    E+R KL +++  Q F RD DE+E+WI EK+QT
Sbjct: 1519 DIASRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQT 1571          
BLAST of Spectrin alpha chain vs. Ensembl Xenopus
Match: sptan1 (spectrin, alpha, non-erythrocytic 1 [Source:NCBI gene;Acc:100036647])

HSP 1 Score: 84.3445 bits (207), Expect = 1.651e-17
Identity = 39/60 (65.00%), Postives = 51/60 (85.00%), Query Frame = 2
Query:   62 IKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDADELE WI EK+Q
Sbjct:   10 VKVLETAEDIQERRQQVLDRYLRFKELSVLRRQKLEDSYRFQFFQRDADELEKWIQEKLQ 69          

HSP 2 Score: 51.2174 bits (121), Expect = 1.494e-6
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 2
Query:   86 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            DI  RR +VL+R+   K    E+R KL +++  Q F RD DE+E+WI EK+QT
Sbjct: 1523 DIASRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQT 1575          
BLAST of Spectrin alpha chain vs. Ensembl Xenopus
Match: sptan1 (spectrin, alpha, non-erythrocytic 1 [Source:NCBI gene;Acc:100036647])

HSP 1 Score: 84.3445 bits (207), Expect = 1.682e-17
Identity = 39/60 (65.00%), Postives = 51/60 (85.00%), Query Frame = 2
Query:   62 IKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDADELE WI EK+Q
Sbjct:    6 VKVLETAEDIQERRQQVLDRYLRFKELSVLRRQKLEDSYRFQFFQRDADELEKWIQEKLQ 65          

HSP 2 Score: 51.2174 bits (121), Expect = 1.522e-6
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 2
Query:   86 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            DI  RR +VL+R+   K    E+R KL +++  Q F RD DE+E+WI EK+QT
Sbjct: 1513 DIASRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQT 1565          
BLAST of Spectrin alpha chain vs. Ensembl Mouse
Match: Sptan1 (spectrin alpha, non-erythrocytic 1 [Source:MGI Symbol;Acc:MGI:98386])

HSP 1 Score: 85.8853 bits (211), Expect = 1.928e-19
Identity = 39/64 (60.94%), Postives = 52/64 (81.25%), Query Frame = 2
Query:   53 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q 
Sbjct:   15 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQV 78          
BLAST of Spectrin alpha chain vs. Ensembl Mouse
Match: Sptan1 (spectrin alpha, non-erythrocytic 1 [Source:MGI Symbol;Acc:MGI:98386])

HSP 1 Score: 86.2705 bits (212), Expect = 3.119e-18
Identity = 39/64 (60.94%), Postives = 52/64 (81.25%), Query Frame = 2
Query:   53 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q 
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQV 66          

HSP 2 Score: 51.2174 bits (121), Expect = 1.205e-6
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 2
Query:   86 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            DI  RR +VL+R+   K    E+R KL +++  Q F RD DE+E+WI EK+QT
Sbjct: 1501 DIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQT 1553          

HSP 3 Score: 48.9062 bits (115), Expect = 6.074e-6
Identity = 24/54 (44.44%), Postives = 36/54 (66.67%), Query Frame = 2
Query:   83 EDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            ED+  RR+ +L+R +A  E    RR +L D+   Q F RD+DEL+SW+ EK++T
Sbjct:  542 EDVATRRDALLSRRNALHERAMHRRAQLADSFHLQQFFRDSDELKSWVNEKMKT 595          
BLAST of Spectrin alpha chain vs. Ensembl Mouse
Match: Sptan1 (spectrin alpha, non-erythrocytic 1 [Source:MGI Symbol;Acc:MGI:98386])

HSP 1 Score: 86.2705 bits (212), Expect = 3.151e-18
Identity = 39/64 (60.94%), Postives = 52/64 (81.25%), Query Frame = 2
Query:   53 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q 
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQV 66          

HSP 2 Score: 51.2174 bits (121), Expect = 1.205e-6
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 2
Query:   86 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            DI  RR +VL+R+   K    E+R KL +++  Q F RD DE+E+WI EK+QT
Sbjct: 1521 DIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQT 1573          

HSP 3 Score: 48.9062 bits (115), Expect = 6.353e-6
Identity = 24/54 (44.44%), Postives = 36/54 (66.67%), Query Frame = 2
Query:   83 EDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            ED+  RR+ +L+R +A  E    RR +L D+   Q F RD+DEL+SW+ EK++T
Sbjct:  542 EDVATRRDALLSRRNALHERAMHRRAQLADSFHLQQFFRDSDELKSWVNEKMKT 595          
BLAST of Spectrin alpha chain vs. Ensembl Mouse
Match: Sptan1 (spectrin alpha, non-erythrocytic 1 [Source:MGI Symbol;Acc:MGI:98386])

HSP 1 Score: 86.2705 bits (212), Expect = 3.177e-18
Identity = 39/64 (60.94%), Postives = 52/64 (81.25%), Query Frame = 2
Query:   53 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q 
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQV 66          

HSP 2 Score: 51.2174 bits (121), Expect = 1.204e-6
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 2
Query:   86 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            DI  RR +VL+R+   K    E+R KL +++  Q F RD DE+E+WI EK+QT
Sbjct: 1521 DIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQT 1573          

HSP 3 Score: 48.9062 bits (115), Expect = 6.462e-6
Identity = 24/54 (44.44%), Postives = 36/54 (66.67%), Query Frame = 2
Query:   83 EDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            ED+  RR+ +L+R +A  E    RR +L D+   Q F RD+DEL+SW+ EK++T
Sbjct:  542 EDVATRRDALLSRRNALHERAMHRRAQLADSFHLQQFFRDSDELKSWVNEKMKT 595          
BLAST of Spectrin alpha chain vs. Ensembl Mouse
Match: Sptan1 (spectrin alpha, non-erythrocytic 1 [Source:MGI Symbol;Acc:MGI:98386])

HSP 1 Score: 86.2705 bits (212), Expect = 3.208e-18
Identity = 39/64 (60.94%), Postives = 52/64 (81.25%), Query Frame = 2
Query:   53 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q 
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQV 66          

HSP 2 Score: 51.2174 bits (121), Expect = 1.194e-6
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 2
Query:   86 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            DI  RR +VL+R+   K    E+R KL +++  Q F RD DE+E+WI EK+QT
Sbjct: 1521 DIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQT 1573          

HSP 3 Score: 48.9062 bits (115), Expect = 6.406e-6
Identity = 24/54 (44.44%), Postives = 36/54 (66.67%), Query Frame = 2
Query:   83 EDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            ED+  RR+ +L+R +A  E    RR +L D+   Q F RD+DEL+SW+ EK++T
Sbjct:  542 EDVATRRDALLSRRNALHERAMHRRAQLADSFHLQQFFRDSDELKSWVNEKMKT 595          
BLAST of Spectrin alpha chain vs. UniProt/SwissProt
Match: sp|P13395|SPTCA_DROME (Spectrin alpha chain OS=Drosophila melanogaster OX=7227 GN=alpha-Spec PE=1 SV=2)

HSP 1 Score: 97.8265 bits (242), Expect = 2.842e-21
Identity = 46/64 (71.88%), Postives = 57/64 (89.06%), Query Frame = 2
Query:   53 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            PKE+KILET EDIQERREQVL+RY+ FK  T ++R+KLED++++QYFKRDADELESWI EK+Q 
Sbjct:    6 PKEVKILETVEDIQERREQVLSRYNDFKIETRQKREKLEDSRRFQYFKRDADELESWIHEKLQA 69          

HSP 2 Score: 54.299 bits (129), Expect = 7.613e-7
Identity = 23/55 (41.82%), Postives = 39/55 (70.91%), Query Frame = 2
Query:   77 TPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
              +D+ +RR+ +L R +A +E + +RR+ LED+ +YQ F+RD DE + WI EK++
Sbjct:  543 AADDVAQRRQMLLARRAALQEKSSKRRQLLEDSNRYQQFERDCDETKGWISEKLK 597          

HSP 3 Score: 52.7582 bits (125), Expect = 2.523e-6
Identity = 25/51 (49.02%), Postives = 35/51 (68.63%), Query Frame = 2
Query:   89 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            + E+R+QVL R+   KE   E+R +L D +  Q F RDADE+E+WI EK+Q
Sbjct: 1470 VDEKRKQVLERWRHLKEGLIEKRSRLGDEQTLQQFSRDADEIENWIAEKLQ 1520          
BLAST of Spectrin alpha chain vs. UniProt/SwissProt
Match: sp|P16086|SPTN1_RAT (Spectrin alpha chain, non-erythrocytic 1 OS=Rattus norvegicus OX=10116 GN=Sptan1 PE=1 SV=2)

HSP 1 Score: 86.2705 bits (212), Expect = 2.223e-17
Identity = 39/64 (60.94%), Postives = 52/64 (81.25%), Query Frame = 2
Query:   53 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q 
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQV 66          

HSP 2 Score: 51.2174 bits (121), Expect = 8.350e-6
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 2
Query:   86 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            DI  RR +VL+R+   K    E+R KL +++  Q F RD DE+E+WI EK+QT
Sbjct: 1521 DIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQT 1573          
BLAST of Spectrin alpha chain vs. UniProt/SwissProt
Match: sp|P16546|SPTN1_MOUSE (Spectrin alpha chain, non-erythrocytic 1 OS=Mus musculus OX=10090 GN=Sptan1 PE=1 SV=4)

HSP 1 Score: 86.2705 bits (212), Expect = 2.223e-17
Identity = 39/64 (60.94%), Postives = 52/64 (81.25%), Query Frame = 2
Query:   53 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q 
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQV 66          

HSP 2 Score: 51.2174 bits (121), Expect = 8.425e-6
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 2
Query:   86 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            DI  RR +VL+R+   K    E+R KL +++  Q F RD DE+E+WI EK+QT
Sbjct: 1521 DIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQT 1573          
BLAST of Spectrin alpha chain vs. UniProt/SwissProt
Match: sp|P07751|SPTN1_CHICK (Spectrin alpha chain, non-erythrocytic 1 OS=Gallus gallus OX=9031 GN=SPTAN1 PE=1 SV=3)

HSP 1 Score: 86.2705 bits (212), Expect = 2.286e-17
Identity = 39/63 (61.90%), Postives = 51/63 (80.95%), Query Frame = 2
Query:   53 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDADEL  WI EK+Q
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSSLRRQKLEDSYRFQFFQRDADELGKWIQEKLQ 65          
BLAST of Spectrin alpha chain vs. UniProt/SwissProt
Match: sp|Q13813|SPTN1_HUMAN (Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3)

HSP 1 Score: 86.2705 bits (212), Expect = 2.463e-17
Identity = 39/63 (61.90%), Postives = 52/63 (82.54%), Query Frame = 2
Query:   53 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQ 65          

HSP 2 Score: 51.6026 bits (122), Expect = 6.624e-6
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 2
Query:   86 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            DI  RR +VL+R+   K    E+R KL +++  Q F RD DE+E+WI EK+QT
Sbjct: 1521 DISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQT 1573          
BLAST of Spectrin alpha chain vs. TrEMBL
Match: A0A4E0R0S1 (Spna2 protein OS=Fasciola hepatica OX=6192 GN=D915_009742 PE=4 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 4.596e-27
Identity = 53/65 (81.54%), Postives = 60/65 (92.31%), Query Frame = 2
Query:   50 LPKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            LP ++KILETPEDIQERREQVL+RYSAFKEATE RR +LE AK+YQ+FKRDADELE WILEK+QT
Sbjct:    4 LPTKVKILETPEDIQERREQVLSRYSAFKEATEFRRHRLEQAKRYQFFKRDADELEGWILEKLQT 68          
BLAST of Spectrin alpha chain vs. TrEMBL
Match: A0A5J4P2W7 (Spectrin alpha OS=Paragonimus westermani OX=34504 GN=DEA37_0010677 PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 7.960e-25
Identity = 56/65 (86.15%), Postives = 61/65 (93.85%), Query Frame = 2
Query:   50 LPKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            LP ++KILETPEDIQERREQVL+RYSAFKEATE RR KLE AK+YQYFKRDADELESWILEK+QT
Sbjct:    4 LPLKVKILETPEDIQERREQVLSRYSAFKEATEYRRYKLEQAKRYQYFKRDADELESWILEKLQT 68          
BLAST of Spectrin alpha chain vs. TrEMBL
Match: A0A4S2M595 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003879 PE=4 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 1.366e-24
Identity = 55/65 (84.62%), Postives = 61/65 (93.85%), Query Frame = 2
Query:   50 LPKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            LP ++KILETPEDIQERREQVL+RYSAFKEATE RR +LE AK+YQYFKRDADELESWILEK+QT
Sbjct:    4 LPIKVKILETPEDIQERREQVLSRYSAFKEATEYRRHRLEQAKRYQYFKRDADELESWILEKLQT 68          
BLAST of Spectrin alpha chain vs. TrEMBL
Match: A0A419PZF6 (Spectrin alpha chain OS=Clonorchis sinensis OX=79923 GN=alpha-Spec PE=4 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 1.379e-24
Identity = 55/65 (84.62%), Postives = 61/65 (93.85%), Query Frame = 2
Query:   50 LPKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            LP ++KILETPEDIQERREQVL+RYSAFKEATE RR +LE AK+YQYFKRDADELESWILEK+QT
Sbjct:    4 LPIKVKILETPEDIQERREQVLSRYSAFKEATEYRRHRLEQAKRYQYFKRDADELESWILEKLQT 68          
BLAST of Spectrin alpha chain vs. TrEMBL
Match: A0A075AI56 (Spectrin repeat-containing domain protein OS=Opisthorchis viverrini OX=6198 GN=T265_13055 PE=4 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 3.392e-24
Identity = 54/65 (83.08%), Postives = 61/65 (93.85%), Query Frame = 2
Query:   50 LPKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            LP ++KILETPEDIQERREQVL+RYSAFKEATE RR +LE AK+YQYFKRDADELESW+LEK+QT
Sbjct:    4 LPIKVKILETPEDIQERREQVLSRYSAFKEATEYRRHRLEQAKRYQYFKRDADELESWMLEKLQT 68          
BLAST of Spectrin alpha chain vs. Ensembl Cavefish
Match: sptan1 (spectrin alpha, non-erythrocytic 1 [Source:NCBI gene;Acc:103022593])

HSP 1 Score: 85.1149 bits (209), Expect = 5.299e-18
Identity = 38/60 (63.33%), Postives = 51/60 (85.00%), Query Frame = 2
Query:   62 IKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            +K+LET +DIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDADELE WI EK+Q
Sbjct:    6 VKVLETADDIQERRQQVLDRYRRFKELSAMRRQKLEDSYRFQFFRRDADELEKWIQEKLQ 65          

HSP 2 Score: 52.373 bits (124), Expect = 3.978e-7
Identity = 26/56 (46.43%), Postives = 37/56 (66.07%), Query Frame = 2
Query:   77 TPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
              ED+  RR+ +L+R +A  E  + RR  LED+   Q F RD+DEL+SWI EK++T
Sbjct:  540 AKEDVATRRDALLSRRNALHERAQSRRAALEDSFHLQQFFRDSDELKSWINEKMKT 595          

HSP 3 Score: 48.1358 bits (113), Expect = 7.826e-6
Identity = 26/55 (47.27%), Postives = 36/55 (65.45%), Query Frame = 2
Query:   80 PEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            PE I  RR +VL+R+   K    E+R KL +++  Q F RD DE+E+WI EK+QT
Sbjct: 1473 PE-IFNRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQT 1526          
BLAST of Spectrin alpha chain vs. Ensembl Cavefish
Match: sptan1 (spectrin alpha, non-erythrocytic 1 [Source:NCBI gene;Acc:103022593])

HSP 1 Score: 85.1149 bits (209), Expect = 5.464e-18
Identity = 38/60 (63.33%), Postives = 51/60 (85.00%), Query Frame = 2
Query:   62 IKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            +K+LET +DIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDADELE WI EK+Q
Sbjct:    6 VKVLETADDIQERRQQVLDRYRRFKELSAMRRQKLEDSYRFQFFRRDADELEKWIQEKLQ 65          

HSP 2 Score: 52.373 bits (124), Expect = 4.058e-7
Identity = 26/56 (46.43%), Postives = 37/56 (66.07%), Query Frame = 2
Query:   77 TPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
              ED+  RR+ +L+R +A  E  + RR  LED+   Q F RD+DEL+SWI EK++T
Sbjct:  563 AKEDVATRRDALLSRRNALHERAQSRRAALEDSFHLQQFFRDSDELKSWINEKMKT 618          

HSP 3 Score: 48.1358 bits (113), Expect = 7.772e-6
Identity = 26/55 (47.27%), Postives = 36/55 (65.45%), Query Frame = 2
Query:   80 PEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            PE I  RR +VL+R+   K    E+R KL +++  Q F RD DE+E+WI EK+QT
Sbjct: 1546 PE-IFNRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQT 1599          
BLAST of Spectrin alpha chain vs. Ensembl Cavefish
Match: sptan1 (spectrin alpha, non-erythrocytic 1 [Source:NCBI gene;Acc:103022593])

HSP 1 Score: 85.1149 bits (209), Expect = 5.567e-18
Identity = 38/60 (63.33%), Postives = 51/60 (85.00%), Query Frame = 2
Query:   62 IKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            +K+LET +DIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDADELE WI EK+Q
Sbjct:    6 VKVLETADDIQERRQQVLDRYRRFKELSAMRRQKLEDSYRFQFFRRDADELEKWIQEKLQ 65          

HSP 2 Score: 52.373 bits (124), Expect = 3.987e-7
Identity = 26/56 (46.43%), Postives = 37/56 (66.07%), Query Frame = 2
Query:   77 TPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
              ED+  RR+ +L+R +A  E  + RR  LED+   Q F RD+DEL+SWI EK++T
Sbjct:  563 AKEDVATRRDALLSRRNALHERAQSRRAALEDSFHLQQFFRDSDELKSWINEKMKT 618          

HSP 3 Score: 48.1358 bits (113), Expect = 7.981e-6
Identity = 26/55 (47.27%), Postives = 36/55 (65.45%), Query Frame = 2
Query:   80 PEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            PE I  RR +VL+R+   K    E+R KL +++  Q F RD DE+E+WI EK+QT
Sbjct: 1546 PE-IFNRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQT 1599          
BLAST of Spectrin alpha chain vs. Ensembl Cavefish
Match: sptan1 (spectrin alpha, non-erythrocytic 1 [Source:NCBI gene;Acc:103022593])

HSP 1 Score: 85.1149 bits (209), Expect = 5.614e-18
Identity = 38/60 (63.33%), Postives = 51/60 (85.00%), Query Frame = 2
Query:   62 IKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            +K+LET +DIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDADELE WI EK+Q
Sbjct:    6 VKVLETADDIQERRQQVLDRYRRFKELSAMRRQKLEDSYRFQFFRRDADELEKWIQEKLQ 65          

HSP 2 Score: 52.373 bits (124), Expect = 4.055e-7
Identity = 26/56 (46.43%), Postives = 37/56 (66.07%), Query Frame = 2
Query:   77 TPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
              ED+  RR+ +L+R +A  E  + RR  LED+   Q F RD+DEL+SWI EK++T
Sbjct:  540 AKEDVATRRDALLSRRNALHERAQSRRAALEDSFHLQQFFRDSDELKSWINEKMKT 595          

HSP 3 Score: 48.1358 bits (113), Expect = 8.046e-6
Identity = 26/55 (47.27%), Postives = 36/55 (65.45%), Query Frame = 2
Query:   80 PEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            PE I  RR +VL+R+   K    E+R KL +++  Q F RD DE+E+WI EK+QT
Sbjct: 1492 PE-IFNRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQT 1545          
BLAST of Spectrin alpha chain vs. Ensembl Cavefish
Match: sptan1 (spectrin alpha, non-erythrocytic 1 [Source:NCBI gene;Acc:103022593])

HSP 1 Score: 85.1149 bits (209), Expect = 5.722e-18
Identity = 38/60 (63.33%), Postives = 51/60 (85.00%), Query Frame = 2
Query:   62 IKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            +K+LET +DIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDADELE WI EK+Q
Sbjct:    6 VKVLETADDIQERRQQVLDRYRRFKELSAMRRQKLEDSYRFQFFRRDADELEKWIQEKLQ 65          

HSP 2 Score: 52.373 bits (124), Expect = 4.093e-7
Identity = 26/56 (46.43%), Postives = 37/56 (66.07%), Query Frame = 2
Query:   77 TPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
              ED+  RR+ +L+R +A  E  + RR  LED+   Q F RD+DEL+SWI EK++T
Sbjct:  563 AKEDVATRRDALLSRRNALHERAQSRRAALEDSFHLQQFFRDSDELKSWINEKMKT 618          

HSP 3 Score: 48.1358 bits (113), Expect = 8.266e-6
Identity = 26/55 (47.27%), Postives = 36/55 (65.45%), Query Frame = 2
Query:   80 PEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            PE I  RR +VL+R+   K    E+R KL +++  Q F RD DE+E+WI EK+QT
Sbjct: 1526 PE-IFNRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQT 1579          
BLAST of Spectrin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000039102.1 (pep primary_assembly:ASM223467v1:12:24689488:24690705:-1 gene:ENSORLG00000023857.1 transcript:ENSORLT00000039102.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.1149 bits (209), Expect = 1.130e-19
Identity = 39/60 (65.00%), Postives = 51/60 (85.00%), Query Frame = 2
Query:   62 IKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ 241
            +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDADELE WI EK+Q
Sbjct:    6 VKVLETAEDIQERRQQVLDRYRRFKELSIMRRQKLEDSYRFQFFRRDADELEKWIQEKLQ 65          
BLAST of Spectrin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000045528.1 (pep primary_assembly:ASM223467v1:12:24685984:24689086:-1 gene:ENSORLG00000029984.1 transcript:ENSORLT00000045528.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 3.043e-7
Identity = 26/56 (46.43%), Postives = 37/56 (66.07%), Query Frame = 2
Query:   77 TPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
              ED+  RR+ +L+R +A  E  + RR  LED+   Q F RD+DEL+SWI EK++T
Sbjct:  280 AKEDVATRRDALLSRRNALHERAQSRRAALEDSFHLQQFCRDSDELKSWINEKMKT 335          
BLAST of Spectrin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000043413.1 (pep primary_assembly:ASM223467v1:12:24675012:24681272:-1 gene:ENSORLG00000023290.1 transcript:ENSORLT00000043413.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 5.713e-7
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 2
Query:   86 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            DI  RR +VL+R+   K    E+R KL +++  Q F RD DE+E+WI EK+QT
Sbjct:  226 DITNRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQT 278          
BLAST of Spectrin alpha chain vs. Planmine SMEST
Match: SMESG000017064.1 (SMESG000017064.1)

HSP 1 Score: 164.851 bits (416), Expect = 1.825e-45
Identity = 75/76 (98.68%), Postives = 76/76 (100.00%), Query Frame = 2
Query:  281 VKKTPIFMENLLLTGSKSDQWISIDIDTGEIIHKYQTGNIENCPHHESNNKVNRTMYIGICQYNLFVTEPNSRQLM 508
            VKKTPIFMENLLLTGSKSDQWISIDIDTGEIIHKYQTGNIENCPHHESNNKVNRTMYIGICQYNLFVTEPNSRQL+
Sbjct:  125 VKKTPIFMENLLLTGSKSDQWISIDIDTGEIIHKYQTGNIENCPHHESNNKVNRTMYIGICQYNLFVTEPNSRQLI 200          
BLAST of Spectrin alpha chain vs. Planmine SMEST
Match: SMESG000005289.1 (SMESG000005289.1)

HSP 1 Score: 142.51 bits (358), Expect = 1.286e-37
Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 2
Query:   35 MADITLPKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            MADITLPKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT
Sbjct:    1 MADITLPKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 70          

HSP 2 Score: 51.2174 bits (121), Expect = 6.342e-7
Identity = 23/53 (43.40%), Postives = 38/53 (71.70%), Query Frame = 2
Query:   86 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT 244
            D+ ++R+ +L R S  +E  + R+  LED+  YQ F RDADE+++WI+EK++T
Sbjct:  547 DVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKT 599          
The following BLAST results are available for this feature:
BLAST of Spectrin alpha chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPTAN17.383e-2061.90spectrin alpha, non-erythrocytic 1 [Source:HGNC Sy... [more]
SPTAN15.128e-1861.90spectrin alpha, non-erythrocytic 1 [Source:HGNC Sy... [more]
SPTAN15.129e-1861.90spectrin alpha, non-erythrocytic 1 [Source:HGNC Sy... [more]
SPTAN15.173e-1861.90spectrin alpha, non-erythrocytic 1 [Source:HGNC Sy... [more]
SPTAN15.181e-1861.90spectrin alpha, non-erythrocytic 1 [Source:HGNC Sy... [more]
back to top
BLAST of Spectrin alpha chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
spc-11.329e-1758.73SPeCtrin [Source:UniProtKB/TrEMBL;Acc:G4S034][more]
spc-11.329e-1758.73SPeCtrin [Source:UniProtKB/TrEMBL;Acc:G4S034][more]
back to top
BLAST of Spectrin alpha chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
alpha-Spec2.734e-2271.88gene:FBgn0250789 transcript:FBtr0332879[more]
alpha-Spec2.761e-2271.88gene:FBgn0250789 transcript:FBtr0332878[more]
alpha-Spec2.783e-2271.88gene:FBgn0250789 transcript:FBtr0332880[more]
alpha-Spec2.835e-2271.88gene:FBgn0250789 transcript:FBtr0072789[more]
back to top
BLAST of Spectrin alpha chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sptan11.296e-1763.33spectrin alpha, non-erythrocytic 1 [Source:ZFIN;Ac... [more]
back to top
BLAST of Spectrin alpha chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sptan11.605e-1765.00spectrin, alpha, non-erythrocytic 1 [Source:NCBI g... [more]
sptan11.635e-1765.00spectrin, alpha, non-erythrocytic 1 [Source:NCBI g... [more]
sptan11.649e-1765.00spectrin, alpha, non-erythrocytic 1 [Source:NCBI g... [more]
sptan11.651e-1765.00spectrin, alpha, non-erythrocytic 1 [Source:NCBI g... [more]
sptan11.682e-1765.00spectrin, alpha, non-erythrocytic 1 [Source:NCBI g... [more]
back to top
BLAST of Spectrin alpha chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sptan11.928e-1960.94spectrin alpha, non-erythrocytic 1 [Source:MGI Sym... [more]
Sptan13.119e-1860.94spectrin alpha, non-erythrocytic 1 [Source:MGI Sym... [more]
Sptan13.151e-1860.94spectrin alpha, non-erythrocytic 1 [Source:MGI Sym... [more]
Sptan13.177e-1860.94spectrin alpha, non-erythrocytic 1 [Source:MGI Sym... [more]
Sptan13.208e-1860.94spectrin alpha, non-erythrocytic 1 [Source:MGI Sym... [more]
back to top
BLAST of Spectrin alpha chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P13395|SPTCA_DROME2.842e-2171.88Spectrin alpha chain OS=Drosophila melanogaster OX... [more]
sp|P16086|SPTN1_RAT2.223e-1760.94Spectrin alpha chain, non-erythrocytic 1 OS=Rattus... [more]
sp|P16546|SPTN1_MOUSE2.223e-1760.94Spectrin alpha chain, non-erythrocytic 1 OS=Mus mu... [more]
sp|P07751|SPTN1_CHICK2.286e-1761.90Spectrin alpha chain, non-erythrocytic 1 OS=Gallus... [more]
sp|Q13813|SPTN1_HUMAN2.463e-1761.90Spectrin alpha chain, non-erythrocytic 1 OS=Homo s... [more]
back to top
BLAST of Spectrin alpha chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0R0S14.596e-2781.54Spna2 protein OS=Fasciola hepatica OX=6192 GN=D915... [more]
A0A5J4P2W77.960e-2586.15Spectrin alpha OS=Paragonimus westermani OX=34504 ... [more]
A0A4S2M5951.366e-2484.62Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A419PZF61.379e-2484.62Spectrin alpha chain OS=Clonorchis sinensis OX=799... [more]
A0A075AI563.392e-2483.08Spectrin repeat-containing domain protein OS=Opist... [more]
back to top
BLAST of Spectrin alpha chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sptan15.299e-1863.33spectrin alpha, non-erythrocytic 1 [Source:NCBI ge... [more]
sptan15.464e-1863.33spectrin alpha, non-erythrocytic 1 [Source:NCBI ge... [more]
sptan15.567e-1863.33spectrin alpha, non-erythrocytic 1 [Source:NCBI ge... [more]
sptan15.614e-1863.33spectrin alpha, non-erythrocytic 1 [Source:NCBI ge... [more]
sptan15.722e-1863.33spectrin alpha, non-erythrocytic 1 [Source:NCBI ge... [more]
back to top
BLAST of Spectrin alpha chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spectrin alpha chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spectrin alpha chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spectrin alpha chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000039102.11.130e-1965.00pep primary_assembly:ASM223467v1:12:24689488:24690... [more]
ENSORLT00000045528.13.043e-746.43pep primary_assembly:ASM223467v1:12:24685984:24689... [more]
ENSORLT00000043413.15.713e-747.17pep primary_assembly:ASM223467v1:12:24675012:24681... [more]
back to top
BLAST of Spectrin alpha chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000017064.11.825e-4598.68SMESG000017064.1[more]
SMESG000005289.11.286e-37100.00SMESG000005289.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001586 ID=SMED30001586|Name=Spectrin alpha chain|organism=Schmidtea mediterranea sexual|type=transcript|length=899bp
ATTTTCGCTTTCTGTTAGTTATTAAATATTTAAGATGGCTGATATAACTT
TACCGAAGGAAATAAAAATACTTGAAACTCCTGAGGATATTCAAGAAAGA
CGTGAGCAAGTATTAAATCGTTATTCGGCTTTCAAAGAAGCTACTGAGGA
GAGACGGAAAAAACTTGAAGATGCTAAAAAATATCAATACTTCAAGAGAG
ATGCTGATGAATTGGAAAGTTGGATATTGGAAAAAATTCAAACATATTCA
GATGAGCTTGAATATAGTCTTTATGAATATGTTAAGAAAACTCCAATTTT
CATGGAAAATTTATTATTGACTGGAAGTAAAAGTGATCAATGGATATCAA
TTGATATTGATACGGGAGAAATAATACATAAGTATCAAACTGGAAATATT
GAAAACTGTCCACATCATGAGTCAAATAACAAAGTAAATAGAACAATGTA
TATTGGAATTTGTCAATATAATTTATTTGTCACTGAGCCTAATAGTCGAC
AATTAATGTAAGTTATTTGATTTTTTTAGAATTTCGCGTATTTTTAAAAT
GATTTAAATTTAATTTCAAATTAATTATATTCTCTAAAAATTGTATTTAA
TATGCATTTCAATTATTTGACAAATAAAGGGGAAACTCTGGGAGATACAT
TACCCTACAAATAACTTGTTTAATAGATATTTGAATAATGAAAAAAATGT
TTATATCATTATTGAACGTAAAATATTTTGGCATAGAATAATCTGATATA
AACTGATAAAACACTAACGCAATTTTTTAAGCATCGAAATCAATCGGTTT
TCAAAAATATACTTACTATTATGGAGATGTTATTGACGAGAGGGATATCC
ATATATTGTATGTGCATTGCTGAGGAGGGAGGGGGATCTGCTACCCAAT
back to top

protein sequence of SMED30001586-orf-1

>SMED30001586-orf-1 ID=SMED30001586-orf-1|Name=SMED30001586-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=159bp
MADITLPKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKY
QYFKRDADELESWILEKIQTYSDELEYSLYEYVKKTPIFMENLLLTGSKS
DQWISIDIDTGEIIHKYQTGNIENCPHHESNNKVNRTMYIGICQYNLFVT
EPNSRQLM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000099neuron
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR011047Quinoprotein_ADH-like_supfam
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 27..47
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 5..74
e-value: 1.9E-24
score: 88.2
NoneNo IPR availablePANTHERPTHR11915SPECTRIN/FILAMIN RELATED CYTOSKELETAL PROTEINcoord: 10..74
NoneNo IPR availablePANTHERPTHR11915:SF427SPECTRIN ALPHA CHAIN, NON-ERYTHROCYTIC 1coord: 10..74
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 16..72