Serine/threonine-protein kinase PDIK1L

Overview
NameSerine/threonine-protein kinase PDIK1L
Smed IDSMED30001580
Length (bp)1112
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein kinase PDIK1L (SMED30001580) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein kinase PDIK1L (SMED30001580) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein kinase PDIK1L (SMED30001580) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein kinase PDIK1L (SMED30001580) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001580

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30001580SMESG000059621.1 SmedASXL_004247SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30001580SMESG000059621.1 dd_Smed_v4_9834_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30001580SMESG000059621.1 dd_Smed_v4_9834_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001580SMESG000059621.1 dd_Smed_v4_9834_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001580SMESG000059621.1 dd_Smed_v4_9834_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30001580SMESG000059621.1 dd_Smed_v4_9834_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Smed sexual biotypeSMED30001580SMESG000059621.1 Contig39357uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001580SMESG000059621.1 Contig39357newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30001580SMESG000059621.1 dd_Smed_v6_9834_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30001580SMESG000059621.1 dd_Smed_v4_9834_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein kinase PDIK1L vs. TrEMBL
Match: A0A1I8HD51 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.334e-18
Identity = 71/205 (34.63%), Postives = 109/205 (53.17%), Query Frame = 2
Query:  422 PVDVDEAAKKYFPVTLGKACEVNAQINCDKSPPWT---VTFSPPSNGLPRQSSPWRVPTIHNHSQLAQKWTPTEKHLENNLH--------FLESTNNSTLDYERLAAIQTPFHAXXXXXXXXXXXXXXXXXMEVKRQEELERIRGPEPRWYELRDARFHYEARKNNELLKSSENW----QKLFDYRNKLKKKSDEFREKYNGNKR 991
            PVD D  A  +FP TLG +  +  QI    +       +TFSPP +GLP    PWR+ T HN       +     HL + L          +  T   T   E   ++  P+  EL++LR+ RLR+E+E+L+EVKRQ++LE    P+ +W+ELR  +FHYEA KNN+L++          +L ++R +L   S++F+E ++   R
Sbjct:  281 PVDFDPLAAVHFPATLGASYRLREQIEAAGTAGTADPRLTFSPPGSGLPYPPDPWRLRTPHNADDFVPTFRSVGDHLADALPAARQQRQLLMAETAPDTAAAEVFVSL--PYSVELARLRMQRLRIEEELLLEVKRQQQLEETAPPKSKWFELRTPQFHYEAHKNNQLVRGGAELPEFDDQLLEFRRQLASSSEKFKETFDAYAR 483          
BLAST of Serine/threonine-protein kinase PDIK1L vs. TrEMBL
Match: A0A1I8HHG3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.492e-18
Identity = 71/205 (34.63%), Postives = 109/205 (53.17%), Query Frame = 2
Query:  422 PVDVDEAAKKYFPVTLGKACEVNAQINCDKSPPWT---VTFSPPSNGLPRQSSPWRVPTIHNHSQLAQKWTPTEKHLENNLH--------FLESTNNSTLDYERLAAIQTPFHAXXXXXXXXXXXXXXXXXMEVKRQEELERIRGPEPRWYELRDARFHYEARKNNELLKSSENW----QKLFDYRNKLKKKSDEFREKYNGNKR 991
            PVD D  A  +FP TLG +  +  QI    +       +TFSPP +GLP    PWR+ T HN       +     HL + L          +  T   T   E    + +P+  EL++LR+ RLR+E+E+L+EVKRQ++LE    P+ +W+ELR  +FHYEA KNN+L++          +L ++R +L   S++F+E ++   R
Sbjct:  285 PVDFDPLAAVHFPATLGASYRLREQIEAAGTAGTADPRLTFSPPGSGLPYPPDPWRLRTPHNADDFVPTFRSVGDHLADALPAARQQRQLLMAETAPGTAAAEVF--VSSPYSVELARLRMQRLRIEEELLLEVKRQQQLEETAPPKRKWFELRTPQFHYEAHKNNQLVRGGTELPEFDDQLLEFRRQLASSSEKFKETFDAYAR 487          
BLAST of Serine/threonine-protein kinase PDIK1L vs. TrEMBL
Match: R7T9B2 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_225498 PE=4 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.611e-18
Identity = 51/86 (59.30%), Postives = 70/86 (81.40%), Query Frame = 2
Query:  710 IQTPFHAXXXXXXXXXXXXXXXXXMEVKRQEELERIRGPEPRWYELRDARFHYEARKNNELLKSSENWQKLFDYRNKLKKKSDEFR 967
            + +P+ +EL++LR++RLR+E+E L+E+KRQEELERIRGP P+WYELR   FHYEA KN  LLKS +NWQ L DYR ++++ S E+R
Sbjct:   14 LSSPYQSELARLRMERLRIEEEHLLELKRQEELERIRGPSPKWYELRSPHFHYEAHKNTSLLKSKDNWQMLMDYRTEMERASKEYR 99          
BLAST of Serine/threonine-protein kinase PDIK1L vs. TrEMBL
Match: A0A1I8HMZ4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.000e-18
Identity = 71/205 (34.63%), Postives = 109/205 (53.17%), Query Frame = 2
Query:  422 PVDVDEAAKKYFPVTLGKACEVNAQINCDKSPPWT---VTFSPPSNGLPRQSSPWRVPTIHNHSQLAQKWTPTEKHLENNLH--------FLESTNNSTLDYERLAAIQTPFHAXXXXXXXXXXXXXXXXXMEVKRQEELERIRGPEPRWYELRDARFHYEARKNNELLKSSENW----QKLFDYRNKLKKKSDEFREKYNGNKR 991
            PVD D  A  +FP TLG +  +  QI    +       +TFSPP +GLP    PWR+ T HN       +     HL + L          +  T   T   E   ++  P+  EL++LR+ RLR+E+E+L+EVKRQ++LE    P+ +W+ELR  +FHYEA KNN+L++          +L ++R +L   S++F+E ++   R
Sbjct:  290 PVDFDPLAAVHFPATLGASYRLREQIEAAGTAGTADPRLTFSPPGSGLPYPPDPWRLRTPHNADDFVPTFRSVGDHLADALPAARQQRQLLMAETAPDTAAAEVFVSL--PYSVELARLRMQRLRIEEELLLEVKRQQQLEETAPPKSKWFELRTPQFHYEAHKNNQLVRGGAELPEFDDQLLEFRRQLASSSEKFKETFDAYAR 492          
BLAST of Serine/threonine-protein kinase PDIK1L vs. TrEMBL
Match: A0A267G5H6 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032068g3 PE=4 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 4.133e-18
Identity = 71/205 (34.63%), Postives = 109/205 (53.17%), Query Frame = 2
Query:  422 PVDVDEAAKKYFPVTLGKACEVNAQINCDKSPPWT---VTFSPPSNGLPRQSSPWRVPTIHNHSQLAQKWTPTEKHLENNLH--------FLESTNNSTLDYERLAAIQTPFHAXXXXXXXXXXXXXXXXXMEVKRQEELERIRGPEPRWYELRDARFHYEARKNNELLKSSENW----QKLFDYRNKLKKKSDEFREKYNGNKR 991
            PVD D  A  +FP TLG +  +  QI    +       +TFSPP +GLP    PWR+ T HN       +     HL + L          +  T   T   E    + +P+  EL++LR+ RLR+E+E+L+EVKRQ++LE    P+ +W+ELR  +FHYEA KNN+L++          +L ++R +L   S++F+E ++   R
Sbjct:  171 PVDFDPLAAVHFPATLGASYRLREQIEAAGTAGTADPRLTFSPPGSGLPYPPDPWRLRTPHNADDFVPTFRSVGDHLADALPAARQQRQLLMAETAPGTAAAEVF--VSSPYSVELARLRMQRLRIEEELLLEVKRQQQLEETAPPKRKWFELRTPQFHYEAHKNNQLVRGGTELPEFDDQLLEFRRQLASSSEKFKETFDAYAR 373          
BLAST of Serine/threonine-protein kinase PDIK1L vs. Ensembl Nematostella
Match: EDO41087 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5A6])

HSP 1 Score: 68.9366 bits (167), Expect = 3.272e-13
Identity = 44/109 (40.37%), Postives = 68/109 (62.39%), Query Frame = 2
Query:  617 KWTPTEKHLENNLHFLESTNNSTLDYERLAAIQTPFHAXXXXXXXXXXXXXXXXXMEVKRQEELERIRGPEPRWYELRDARFHYEARKNNELLKSSENWQKLFDYRNKL 943
            + TP +   E ++          L    L+ + TP+  EL++L++  L+L++E L++ K  +ELERIRGP+PRWYEL+   FH EARKNN+LL  S ++ ++  YRN L
Sbjct:  179 RQTPVD---EFDMSVFRDAEEHMLSSRTLSGLSTPYRGELAQLKVKGLKLQEERLLKKKCLDELERIRGPKPRWYELKGPDFHREARKNNDLLSQSGHYDEIMQYRNTL 284          
BLAST of Serine/threonine-protein kinase PDIK1L vs. Planmine SMEST
Match: SMESG000059621.1 (SMESG000059621.1)

HSP 1 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 301/302 (99.67%), Postives = 301/302 (99.67%), Query Frame = 2
Query:  116 MSNKDFNDLYVIGKSPFLSEIEDEYTKTDYHRKCIGNGMLLNHKLCDNEMYIPRSNSCWFLNDYHINKDLKFYQSLKALDKLGKQINLLKYDNCEKEIDIITPVDVDEAAKKYFPVTLGKACEVNAQINCDKSPPWTVTFSPPSNGLPRQSSPWRVPTIHNHSQLAQKWTPTEKHLENNLHFLESTNNSTLDYERLAAIQTPFHAXXXXXXXXXXXXXXXXXMEVKRQEELERIRGPEPRWYELRDARFHYEARKNNELLKSSENWQKLFDYRNKLKKKSDEFREKYNGNKRYDPTNYIPVL 1021
            MSNKDFNDLYVIGKSPFLSEIEDEYTKTDYHRKCIGNGMLLNHKLCDNEMYIPRSNSCWFLNDYHINKDLKFYQSLKALDKLGKQINLLKYDNCEKEIDIITPVDVDEAAKKYFPVTLGKACEVNAQINCDKSPPWTVTFSPPSNGLPRQSSPWRVPTIHNHSQL QKWTPTEKHLENNLHFLESTNNSTLDYERLAAIQTPFHAELSKLRLDRLRLEDEILMEVKRQEELERIRGPEPRWYELRDARFHYEARKNNELLKSSENWQKLFDYRNKLKKKSDEFREKYNGNKRYDPTNYIPVL
Sbjct:    1 MSNKDFNDLYVIGKSPFLSEIEDEYTKTDYHRKCIGNGMLLNHKLCDNEMYIPRSNSCWFLNDYHINKDLKFYQSLKALDKLGKQINLLKYDNCEKEIDIITPVDVDEAAKKYFPVTLGKACEVNAQINCDKSPPWTVTFSPPSNGLPRQSSPWRVPTIHNHSQLTQKWTPTEKHLENNLHFLESTNNSTLDYERLAAIQTPFHAELSKLRLDRLRLEDEILMEVKRQEELERIRGPEPRWYELRDARFHYEARKNNELLKSSENWQKLFDYRNKLKKKSDEFREKYNGNKRYDPTNYIPVL 302          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein kinase PDIK1L vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase PDIK1L vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase PDIK1L vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase PDIK1L vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase PDIK1L vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase PDIK1L vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase PDIK1L vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase PDIK1L vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HD511.334e-1834.63Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HHG31.492e-1834.63Uncharacterized protein OS=Macrostomum lignano OX=... [more]
R7T9B21.611e-1859.30Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1I8HMZ42.000e-1834.63Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G5H64.133e-1834.63Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Serine/threonine-protein kinase PDIK1L vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase PDIK1L vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase PDIK1L vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase PDIK1L vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO410873.272e-1340.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine-protein kinase PDIK1L vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase PDIK1L vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000059621.10.000e+099.67SMESG000059621.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001580 ID=SMED30001580|Name=Serine/threonine-protein kinase PDIK1L|organism=Schmidtea mediterranea sexual|type=transcript|length=1112bp
CCAAGTTAATTAATAATTTAACATTCAAAATTTTAATTCAGTACAATCAA
ATTATGTATATTCTAACTTAAACTATTACGTAAAATATATTGCTAATACT
GTAAACAAAATTCTAATGAGTAACAAAGATTTCAATGATCTATATGTCAT
CGGAAAATCGCCATTTCTATCAGAAATTGAAGATGAATACACCAAAACGG
ATTACCATAGAAAATGCATTGGAAATGGAATGTTACTAAATCATAAGCTA
TGTGACAATGAGATGTATATTCCTAGGTCTAACAGTTGTTGGTTTTTGAA
TGATTATCATATAAATAAGGACTTAAAATTTTATCAATCGCTCAAAGCTT
TAGATAAACTTGGAAAACAAATAAATTTATTGAAATATGACAATTGTGAA
AAGGAAATTGATATCATTACTCCAGTCGATGTCGATGAGGCTGCAAAAAA
ATACTTTCCAGTTACTTTAGGAAAAGCTTGTGAGGTCAATGCACAAATCA
ATTGCGATAAAAGCCCCCCATGGACTGTGACATTTTCTCCCCCATCTAAT
GGCCTGCCGAGACAGTCATCTCCTTGGCGAGTACCGACGATTCACAACCA
CAGCCAATTGGCTCAAAAATGGACTCCTACCGAAAAGCATTTGGAAAATA
ATTTGCATTTTTTGGAATCAACCAACAATTCAACTCTAGACTATGAGCGT
TTGGCAGCTATCCAGACGCCTTTCCATGCGGAATTGTCTAAGTTGCGGCT
CGATAGATTGAGACTCGAAGATGAGATATTGATGGAAGTCAAACGGCAAG
AAGAATTGGAACGCATTCGTGGGCCGGAACCAAGATGGTATGAACTGCGA
GATGCAAGATTTCATTACGAAGCCAGAAAAAATAACGAATTATTGAAAAG
CAGCGAAAATTGGCAGAAATTATTTGATTATCGCAACAAACTAAAGAAAA
AATCTGATGAATTCCGTGAAAAATATAATGGAAATAAGAGATACGATCCG
ACTAATTATATTCCCGTTCTGTGAATGGGCTTCATATTTATATATCTATA
TCTGTGATGTCAGTGTTGTAAGGTGTCAATAATAAATGATATTTATGAAT
GGGAGATCGGAA
back to top

protein sequence of SMED30001580-orf-1

>SMED30001580-orf-1 ID=SMED30001580-orf-1|Name=SMED30001580-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=303bp
MSNKDFNDLYVIGKSPFLSEIEDEYTKTDYHRKCIGNGMLLNHKLCDNEM
YIPRSNSCWFLNDYHINKDLKFYQSLKALDKLGKQINLLKYDNCEKEIDI
ITPVDVDEAAKKYFPVTLGKACEVNAQINCDKSPPWTVTFSPPSNGLPRQ
SSPWRVPTIHNHSQLAQKWTPTEKHLENNLHFLESTNNSTLDYERLAAIQ
TPFHAELSKLRLDRLRLEDEILMEVKRQEELERIRGPEPRWYELRDARFH
YEARKNNELLKSSENWQKLFDYRNKLKKKSDEFREKYNGNKRYDPTNYIP
VL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head