EF-hand calcium-binding domain-containing protein 6

Overview
NameEF-hand calcium-binding domain-containing protein 6
Smed IDSMED30001575
Uniprot Best hitEF-hand calcium-binding domain-containing protein 6 (Fragment) OS=Macaca fascicularis OX=9541 GN=EFCAB6 PE=2 SV=2 (E=7.5923e-27)
Length (bp)2902
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of EF-hand calcium-binding domain-containing protein 6 (SMED30001575) t-SNE clustered cells

Violin plots show distribution of expression levels for EF-hand calcium-binding domain-containing protein 6 (SMED30001575) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of EF-hand calcium-binding domain-containing protein 6 (SMED30001575) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for EF-hand calcium-binding domain-containing protein 6 (SMED30001575) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001575

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30001575SMESG000009107.1 SmedASXL_014361SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30001575SMESG000009107.1 dd_Smed_v4_7631_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30001575SMESG000009107.1 dd_Smed_v4_7631_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30001575SMESG000009107.1 dd_Smed_v6_7631_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30001575SMESG000009107.1 dd_Smed_v6_7631_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30001575SMESG000009107.1 dd_Smed_v6_7631_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30001575SMESG000009107.1 dd_Smed_v4_7631_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30001575SMESG000009107.1 dd_Smed_v4_7631_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30001575SMESG000009107.1 dd_Smed_v4_7631_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Human
Match: EFCAB6 (EF-hand calcium binding domain 6 [Source:HGNC Symbol;Acc:HGNC:24204])

HSP 1 Score: 118.627 bits (296), Expect = 2.309e-26
Identity = 155/702 (22.08%), Postives = 283/702 (40.31%), Query Frame = 1
Query:  838 IVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGIISYPIASLTPNVRASNDSFKLNLNASFIEKL----------------LKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNID-SELNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETSSVLNEADPVTDYNIEEIQSGKTVA--EIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFMY---------------------------NKSTASFPNAKLNPPVKGDSD-LMQRSRKLNAAT------DILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFK-TPNNKIAYLELLKP---FCSHKSQQILENXXXXXXXXXXXXIDQFNGKDSNSFH-FFHKLQAVIQSA---MIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQ 2760
            +  +++    A  Y+  K ++R   L+  F ++       + + D+KN+LY   I L P E EKLW ++D   +G I   +FL+++G I+Y  A   P    + D F    + +  ++L                 + KL +    + + F K D ++T ++SI    +VL E    L E  L   L+   ++     I Y +FL   ++    G   K     + ++S  I+ + LNP   V  K+  + +   L +   F   DK   G ++  +F +VL++    + T++Q+   +  L   R    PY+++  ++   NFS        E +  + +  P T        S K  A  +I   + +A  S +  I + F   D      ++ E  F+ +    V+  L+      +W    +N K  L + +F   F                              +S  S P  +L P  K  S      S  +   T      D +   LR +I   +  LLKE    D    G I+  DF  ++++ ++ ++  E + +  K+    N K AY + ++        K   ++     +      +      G ++ SF+    ++Q  I      M R  K  D   TG +S+A+ R +L    ++LSE+E F+++  YDK L+  I+Y   L+
Sbjct:  827 VADSELACEQAHQYLVTKAKNRWSDLSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQKLG-INYSPAVHRP---CAEDYFNFMGHFTKPQQLQEEMKELQQSTEKAVAARDKLMDRHQDISKAFTKTDQSKTNYISICKMQEVLEECGCSLTEGELTHLLNSWGVSRHDNAINYLDFLRAVENSKSTGAQPK-----EKEESMPINFATLNPQEAVR-KIQEVVESSQLALSTAFSALDKEDTGFVKATEFGQVLKD-FCYKLTDNQYHYFLRKL---RIHLTPYINW--KYFLQNFSCFLEETADEWAEKMPKGPPPT--------SPKATADRDILARLHKAVTSHYHAITQEFENFDTMKTNTISRE-EFRAICNRRVQI-LTDEQFDRLWNEMPVNAKGRLKYPDFLSRFSSETAATPMATGDSAVAQRGSSVPDVSEGTRSALSLPTQELRPGSKSQSHPCTPASTTVIPGTPPLQNCDPIESRLRKRIQGCWRQLLKECKEKDVARQGDINASDFLALVEKFNLDISKEECQQLIIKYDLKSNGKFAYCDFIQSCVLLLKAKESSLMHRMKIQNAHKMKEA-----GAETPSFYSALLRIQPKIVHCWRPMRRTFKSYDEAGTGLLSVADFRTVLRQYSINLSEEEFFHILEYYDKTLSSKISYNDFLR 1497          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Human
Match: EFCAB6 (EF-hand calcium binding domain 6 [Source:HGNC Symbol;Acc:HGNC:24204])

HSP 1 Score: 118.627 bits (296), Expect = 2.787e-26
Identity = 155/702 (22.08%), Postives = 283/702 (40.31%), Query Frame = 1
Query:  838 IVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGIISYPIASLTPNVRASNDSFKLNLNASFIEKL----------------LKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNID-SELNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETSSVLNEADPVTDYNIEEIQSGKTVA--EIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFMY---------------------------NKSTASFPNAKLNPPVKGDSD-LMQRSRKLNAAT------DILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFK-TPNNKIAYLELLKP---FCSHKSQQILENXXXXXXXXXXXXIDQFNGKDSNSFH-FFHKLQAVIQSA---MIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQ 2760
            +  +++    A  Y+  K ++R   L+  F ++       + + D+KN+LY   I L P E EKLW ++D   +G I   +FL+++G I+Y  A   P    + D F    + +  ++L                 + KL +    + + F K D ++T ++SI    +VL E    L E  L   L+   ++     I Y +FL   ++    G   K     + ++S  I+ + LNP   V  K+  + +   L +   F   DK   G ++  +F +VL++    + T++Q+   +  L   R    PY+++  ++   NFS        E +  + +  P T        S K  A  +I   + +A  S +  I + F   D      ++ E  F+ +    V+  L+      +W    +N K  L + +F   F                              +S  S P  +L P  K  S      S  +   T      D +   LR +I   +  LLKE    D    G I+  DF  ++++ ++ ++  E + +  K+    N K AY + ++        K   ++     +      +      G ++ SF+    ++Q  I      M R  K  D   TG +S+A+ R +L    ++LSE+E F+++  YDK L+  I+Y   L+
Sbjct:  675 VADSELACEQAHQYLVTKAKNRWSDLSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQKLG-INYSPAVHRP---CAEDYFNFMGHFTKPQQLQEEMKELQQSTEKAVAARDKLMDRHQDISKAFTKTDQSKTNYISICKMQEVLEECGCSLTEGELTHLLNSWGVSRHDNAINYLDFLRAVENSKSTGAQPK-----EKEESMPINFATLNPQEAVR-KIQEVVESSQLALSTAFSALDKEDTGFVKATEFGQVLKD-FCYKLTDNQYHYFLRKL---RIHLTPYINW--KYFLQNFSCFLEETADEWAEKMPKGPPPT--------SPKATADRDILARLHKAVTSHYHAITQEFENFDTMKTNTISRE-EFRAICNRRVQI-LTDEQFDRLWNEMPVNAKGRLKYPDFLSRFSSETAATPMATGDSAVAQRGSSVPDVSEGTRSALSLPTQELRPGSKSQSHPCTPASTTVIPGTPPLQNCDPIESRLRKRIQGCWRQLLKECKEKDVARQGDINASDFLALVEKFNLDISKEECQQLIIKYDLKSNGKFAYCDFIQSCVLLLKAKESSLMHRMKIQNAHKMKEA-----GAETPSFYSALLRIQPKIVHCWRPMRRTFKSYDEAGTGLLSVADFRTVLRQYSINLSEEEFFHILEYYDKTLSSKISYNDFLR 1345          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Zebrafish
Match: si:dkey-256e7.5 (si:dkey-256e7.5 [Source:ZFIN;Acc:ZDB-GENE-090313-282])

HSP 1 Score: 162.155 bits (409), Expect = 3.078e-43
Identity = 99/298 (33.22%), Postives = 182/298 (61.07%), Query Frame = 1
Query: 1876 TIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFMYNKSTASFPNAKLNPPVKGDSDLMQRSRKLNAATDILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTPNNK-IAYLELLKPFCSHKSQQILENXXXXXXXXXXXXIDQ-FNGKDSNSFHFFHKLQAVIQSAMIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQD 2763
            +++K    +++ D+ + F ELDE N + LT E M+QL+K L    E++RG++R +W +    +   +DF++F RHF  +  +  FPNAK NPP +GD+D M+ S +L+  +DIL+D LRAK+++  ++L  EF+ +D    G +S ++F+EI+  L +HL+ +E  ++  KF   ++  ++YLE L+PF S    QI ++ S+    L + + +Q     ++ + +   KLQ   + A+ +   ++DS ++G +S AEL A+L L GV  S++E+ ++ ++   + +G ++Y+ LL D
Sbjct:   43 SLVKSLVANRYKDVLQVFEELDEKNTRRLTQEDMYQLLKRLVPHQEVTRGEVRRLWSSLFTQQDGTVDFQQFLRHFGPSPRSCCFPNAKRNPPKRGDNDFMRLSNRLSYVSDILVDALRAKVEMSVSELWTEFSEMDFSGTGFVSSDEFKEILMSLCVHLSQYECDVLARKFDINHDGCVSYLEFLRPFLSQS--QIWKHGSNMAAALQTPRENQEIATPETLNRNIRKKLQRKAK-ALSKACTRLDSSSSGLLSAAELGAVLQLLGVCQSQEELKSVFSTLHTHPSGCLDYRPLLLD 337          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Zebrafish
Match: si:dkey-256e7.5 (si:dkey-256e7.5 [Source:ZFIN;Acc:ZDB-GENE-090313-282])

HSP 1 Score: 92.8189 bits (229), Expect = 1.764e-21
Identity = 54/133 (40.60%), Postives = 80/133 (60.15%), Query Frame = 1
Query: 1183 IEKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSS--NIDSELNPVSLVEFKLVNLFQKDFLEILENFR 1575
            IE  LK + R+G   ++ +F K D   TG +  +DF+QVL + DL L+   LG FLSRC +   K  + Y  FL  FQDRS  GITHK++ +  ++  S  N+ S  + +S +E KL+ LFQ +FL +L+ F+
Sbjct:   21 IETWLKDRFRDGAQRMKAEFDKLDPESTGKVRGADFLQVLGKFDLHLKREQLGLFLSRCGLKIKKGCVQYLNFLRTFQDRSSDGITHKIIYNPKHRFHSVENV-SCASSLSAIEAKLIRLFQSEFLSLLKTFQ 152          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Xenopus
Match: immp2l (inner mitochondrial membrane peptidase subunit 2 [Source:Xenbase;Acc:XB-GENE-1010851])

HSP 1 Score: 134.42 bits (337), Expect = 2.851e-31
Identity = 186/846 (21.99%), Postives = 340/846 (40.19%), Query Frame = 1
Query:  520 LSLEEISEILQNKLEKNYYEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCEITTSCLNSLFEMWGIKSEK-------------QMLSFNEIYTIFVNKSKEKSETSFFDPV--NRHKAKAIVPAK-MTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSIT-KADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGII-----SYPIASLTPNVRAS-----NDSFKLN-------------LNASFIEKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNIDSELNPVSLVEFKLVNLFQKDFLEILE-----------NFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETSSVLNEADPVTDYNIEEIQSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLM-KTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRH--------------------FMYNKSTASFPN-----------------AKLNPPVKGDSDLMQRSRKLNAATDI-----LMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTPNN-KIAYLELLKPFCSHKSQQILENXXXXXXXXXXXXIDQFNGKDSNSF-HFFHKLQAVI---QSAMIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQ 2760
            +S E+    L++KL++ Y ++   F   D +R G V       ++                  M+ IK ++               L++ E   +F     +K ++  + P   + H  K  +  + +    A  Y+  K + R   +   F + ++S+   I  K DL+N L++  + + P E EKLW ++D   +G +   +FL+++GI      S P   +T + RA      N+  K+              L+   IE+ +K K R+ +      F K D N+ G +S+ D   +L   +  L++      L R  I  T   + Y +FL             +++   D+ ++S       PVS  E       QK  L++ E            F  FD+   G+I+  +  ++L++    + ++ QF  ++  LPL   QT+ +  FL  F T +          E SS   E   V          G T+ +I   +++   ++F  + + F  LD  N   ++ E   +L  K   +   L+     ++W T  LN    L + EF                       F+Y  ++A   N                 A LN P K D+   QR +   A++ +     +   LR  +  ++ ++L+     DPE  G I+  DF  ++K+ +    + E+  +T K+ + NN K +Y +  +        + LE S   + K+   ++    G D   F +   ++Q  +      M R     D   TGFIS+ E + +L   G++LSEDE F+++  +DK+L   ++Y   L+
Sbjct:  741 MSAEDCLAQLRDKLQQGYGDLYSAFYKIDSNRDGLVTMHDFRHLLDSF---------------MFIIKPQEFQRLLGLLGLNLSSTLNYKEFLHLF-----QKPQSPVYPPWLQSSHSPKQSMGGEDLACEQAHYYLVTKAQGRWHDMAKTFCE-IDSEGNGIVQKKDLRNVLFRFYLPIHPKEFEKLWGRYDPEGKGFLTHNEFLEKLGISFASGDSGPSKQITEDNRACLEGHYNNQLKIQEEMDAFHKHQTKALDMKDIEQQIKDKFRDYYHDFSAAFAKIDRNKDGQISVHDLRAMLQSLNFHLDDEQFANLLYRLRIKVTDNKLSYPDFL-------------RMI---DDGRASKYGQRQRPVSAAETPPKLSLQKVLLKLKEAVVSSHDALYKAFSSFDRDGTGTIKASELHQILDS-FCFKLSDRQFGYLLSKLPLGEEQTIDWKAFLHHFSTSH---------PEPSSSWVER--VQHATRPRSTQGLTMKDILNHIREVVTARFYTVAQDFISLDYANINAVSKEDFRELFNKDFML---LTDEQFENLWNTLPLNPYGNLKYHEFLSQFGGGDALVSPYEKTAGDQSEFIYKPASALAGNHTPPESQAGIRRPKTAPAILNKP-KTDT---QRPKTAGASSRLVNCEQIEARLRGSLQKVWQEVLRACRDYDPERTGEITTNDFSGVLKQFNAETNEEELERLTVKYDSRNNGKFSYADFFRNIML--GPKPLEKSPLHRMKVQKTRVPISTGPDGPCFLNAMMRIQPKVLDCWRPMRRAFLSFDEARTGFISVQEFKQVLRKSGLNLSEDEFFHILGFFDKDLKAKVSYNDFLR 1528          

HSP 2 Score: 87.4261 bits (215), Expect = 9.800e-17
Identity = 108/450 (24.00%), Postives = 204/450 (45.33%), Query Frame = 1
Query: 1486 DSELNPVSL--VEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETSSVLNEADPVTDYNIEEIQSGKTVAE-IKTIMKQA--FDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHF-----MYNKSTASFPNAKLN-PPVKGDSDLMQRSR-----KLNAATDILMDN----LRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTP-NNKIAYLELLKPFCSHKSQQILENXXXXXXXXXXXXIDQFNGKDS--NSFHFFHKLQAVIQSA---MIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLL 2757
            D  L P+ +  + ++ VN  ++D   +   F   D  QN ++   +F +VL+N + +  TESQF  +++ +P+N N T+PYLDFL +F   + S+     +  + S  ++A+ V   N  EI+   TV++ +K +++    FD         +N+    NG++   EL  ++++    K  +   +   +W  + + +K  LD++E  R+      ++NK TA    + LN   V+ +    +  R     K  +A D  +D+    LR KI   Y +L+K F   D  ++G +S E  Q +I      L +   + + ++      ++I + + L+ F   +S      +        + +++   G+    +S H   KLQ   Q A   + +    +D G  G IS  ELR ++      +++ +   LM   D    G I+Y   L
Sbjct:   51 DPTLTPLEIEGIIYRRVNENEED---VTNAFLTLDTEQNFTVTRGEFYRVLQNFI-LPLTESQFNELLEKIPVNNNGTIPYLDFLAKFLRTSSSATCARSVKRSWSC-SQANQVLSLNELEIRLKNTVSKNLKNVVRSCRLFD---------YNQ----NGQIQKQELR-RILENCCFK--MKTAEFEKLWNRYCIGKKNTLDYRELLRNLGVNVELHNKPTAENVASALNREAVQREQQKEKNCRPPPPLKELSAEDYTIDDIEAALRKKISASYPNLVKAFRAFDGSHSGYVSAEALQSVINNFIFPLPNGTFQKLMNRLAIKCTDRIGWEQFLRRFQGPESMA----NGQTIPMKPNHRVNPVRGESPVVSSEHILQKLQRHFQDAYPSLKQAFLVLDEGRKGRISRKELRRIVDCMMFRVTDAQFKELMIILDPQHTGFISYLQFL 475          

HSP 3 Score: 68.9366 bits (167), Expect = 4.515e-11
Identity = 124/635 (19.53%), Postives = 246/635 (38.74%), Query Frame = 1
Query:  679 TTSCLNSLFEMWGIKSEKQMLSFNEIYTIFVNKSKEKSETSFFDPVNRHKAKAIVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGIISYPIASLTPNVRASNDSFKLNLNA---------------------------SFIEKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNIDSELNPVSLVEF---KLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQF-DTGNFSSLSFNDIHETSSVLNEADPVTDYNIEEIQSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFMYNKSTASFPNAKLNPPVKGDS--------DLMQRSRKLNAATDILMDNLRAK--IDLLYNDLLKE-------FTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTPNNKIAYLELLKPF 2439
            + +C  S+   W      Q+LS NE+            E    + V+++    +   ++     FDY                     +Q   I K +L+  L      +   E EKLW ++   K+ ++D  + L+ +G+       L     A N +  LN  A                             IE  L+ K+   +  L + F+  D + +G++S      V++     L      + ++R  I  T + I +++FL RFQ   E+    + +  + N + + +  E +PV   E    KL   FQ  +  + + F   D+ + G I  K+ +++++  M    T++QFK ++  L       + YL FL  F D  + S   +  +H   + L E  PVT   +E  + G        I+ +  +  + D  K     D     ++  +   +++++    P LS      + + +       + + +F R+     S A   N      V G          DL  R +++ +    L+  +  +  I  L + ++ +       F     ++ G IS +DF+++++E  IHL + + + +T+K      +++YL+ +  F
Sbjct:  140 SATCARSVKRSWSCSQANQVLSLNEL------------EIRLKNTVSKNLKNVVRSCRL-----FDY---------------------NQNGQIQKQELRRILENCCFKMKTAEFEKLWNRYCIGKKNTLDYRELLRNLGVN----VELHNKPTAENVASALNREAVQREQQKEKNCRPPPPLKELSAEDYTIDDIEAALRKKISASYPNLVKAFRAFDGSHSGYVSAEALQSVINNFIFPLPNGTFQKLMNRLAIKCT-DRIGWEQFLRRFQG-PESMANGQTIPMKPNHRVNPVRGE-SPVVSSEHILQKLQRHFQDAYPSLKQAFLVLDEGRKGRISRKELRRIVDCMM-FRVTDAQFKELMIILDPQHTGFISYLQFLDLFEDKESVSGHKW--LHNMRTPLKET-PVT---LEWEKMG-------NILCEKIEHNWADFSKAMKSCDSAGCGMVDKDQFKRILQSF--CPPLSDRHYNMLCEQYNDGANGYISYMDFLRNVGVCTSAAGDLNGVSTEIVHGSQLREELRQDDLSARMKEIESQATQLVKKMPVEEVIGKLKDCVIGQEFSPRESFLAFAKQHKGRISKKDFRKVLREHEIHLDEDQFKRLTEKLGFTKEELSYLDFVSLF 713          

HSP 4 Score: 53.5286 bits (127), Expect = 2.215e-6
Identity = 125/669 (18.68%), Postives = 260/669 (38.86%), Query Frame = 1
Query:  517 KLSLEEISEILQNKLEKNYYEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCEITTSCLNSLFEMWGIKSEKQMLSFNEIYTIFVNKSKEKSETSFFDPVNRHKAKAIVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGIISYPIASLTPNVRASNDSFKLNLNASFI-----EKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEG-IPYKEFL----IRFQDRSEAGITHKLLTDRDNKKSSNIDSELN----------------PVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLN-RNQTVPYLDFLKQFDTGNFSSLSFNDIHETSSVLNEADPVTDYNIEEIQSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFMYNKSTASFPNAKLNPPVKGDSDLMQRSRKLNAATDILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFK-TPNNKIAYLELLKPF 2439
            K+ +EE+   L++ +    +  R+ F+      KG + K+   +++++     +       L E  G   E+  LS+ +  ++F + +      +  D  + H         M+A D    +++K +     L   F     ++   +T  D ++ L   M  + P E ++L          +++  +FL    +   P + + P    S+ S K ++    +        L TK +  +  + + F + D+   G +   D   VL    L +      +   R    P  +G + + EFL    I F    ++G + ++  D       + +++L                  +  +E ++ + F+  + +    F K D+ ++G I + D + +L++ +N    + QF  ++  L +   +  + Y DFL+  D G  S                  PV+     E     ++ ++   +K+A  S    + K F+  D      +    + Q++ +   K  LS      +     L E++ +D+K F  HF     + S P    +   +       RS +     DIL +++R  +   +  + ++F  LD  N  A+S EDF+E+  +  + LTD +   + +     P   + Y E L  F
Sbjct:  633 KMPVEEVIGKLKDCVIGQEFSPRESFLAFAKQHKGRISKKDFRKVLRE-HEIHLDEDQFKRLTEKLGFTKEE--LSYLDFVSLFEDPTGNGPGAAL-DTGSNHHVNDTKFHYMSAEDCLAQLRDKLQQGYGDLYSAFYKIDSNRDGLVTMHDFRHLLDSFMFIIKPQEFQRLLGLLGLNLSSTLNYKEFLH---LFQKPQSPVYPPWLQSSHSPKQSMGGEDLACEQAHYYLVTKAQGRWHDMAKTFCEIDSEGNGIVQKKDLRNVLFRFYLPIHPKEFEKLWGR--YDPEGKGFLTHNEFLEKLGISFAS-GDSGPSKQITEDNRACLEGHYNNQLKIQEEMDAFHKHQTKALDMKDIEQQIKDKFRDYYHDFSAAFAKIDRNKDGQISVHDLRAMLQS-LNFHLDDEQFANLLYRLRIKVTDNKLSYPDFLRMIDDGRASKYG-----------QRQRPVS---AAETPPKLSLQKVLLKLKEAVVSSHDALYKAFSSFDRDGTGTIKASELHQILDSFCFK--LSDRQFGYLLSKLPLGEEQTIDWKAFLHHF-----STSHPEPSSSWVERVQHATRPRSTQGLTMKDIL-NHIREVVTARFYTVAQDFISLDYANINAVSKEDFRELFNKDFMLLTDEQFENLWNTLPLNPYGNLKYHEFLSQF 1268          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Xenopus
Match: immp2l (inner mitochondrial membrane peptidase subunit 2 [Source:Xenbase;Acc:XB-GENE-1010851])

HSP 1 Score: 134.035 bits (336), Expect = 3.877e-31
Identity = 186/846 (21.99%), Postives = 340/846 (40.19%), Query Frame = 1
Query:  520 LSLEEISEILQNKLEKNYYEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCEITTSCLNSLFEMWGIKSEK-------------QMLSFNEIYTIFVNKSKEKSETSFFDPV--NRHKAKAIVPAK-MTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSIT-KADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGII-----SYPIASLTPNVRAS-----NDSFKLN-------------LNASFIEKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNIDSELNPVSLVEFKLVNLFQKDFLEILE-----------NFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETSSVLNEADPVTDYNIEEIQSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLM-KTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRH--------------------FMYNKSTASFPN-----------------AKLNPPVKGDSDLMQRSRKLNAATDI-----LMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTPNN-KIAYLELLKPFCSHKSQQILENXXXXXXXXXXXXIDQFNGKDSNSF-HFFHKLQAVI---QSAMIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQ 2760
            +S E+    L++KL++ Y ++   F   D +R G V       ++                  M+ IK ++               L++ E   +F     +K ++  + P   + H  K  +  + +    A  Y+  K + R   +   F + ++S+   I  K DL+N L++  + + P E EKLW ++D   +G +   +FL+++GI      S P   +T + RA      N+  K+              L+   IE+ +K K R+ +      F K D N+ G +S+ D   +L   +  L++      L R  I  T   + Y +FL             +++   D+ ++S       PVS  E       QK  L++ E            F  FD+   G+I+  +  ++L++    + ++ QF  ++  LPL   QT+ +  FL  F T +          E SS   E   V          G T+ +I   +++   ++F  + + F  LD  N   ++ E   +L  K   +   L+     ++W T  LN    L + EF                       F+Y  ++A   N                 A LN P K D+   QR +   A++ +     +   LR  +  ++ ++L+     DPE  G I+  DF  ++K+ +    + E+  +T K+ + NN K +Y +  +        + LE S   + K+   ++    G D   F +   ++Q  +      M R     D   TGFIS+ E + +L   G++LSEDE F+++  +DK+L   ++Y   L+
Sbjct:  717 MSAEDCLAQLRDKLQQGYGDLYSAFYKIDSNRDGLVTMHDFRHLLDSF---------------MFIIKPQEFQRLLGLLGLNLSSTLNYKEFLHLF-----QKPQSPVYPPWLQSSHSPKQSMGGEDLACEQAHYYLVTKAQGRWHDMAKTFCE-IDSEGNGIVQKKDLRNVLFRFYLPIHPKEFEKLWGRYDPEGKGFLTHNEFLEKLGISFASGDSGPSKQITEDNRACLEGHYNNQLKIQEEMDAFHKHQTKALDMKDIEQQIKDKFRDYYHDFSAAFAKIDRNKDGQISVHDLRAMLQSLNFHLDDEQFANLLYRLRIKVTDNKLSYPDFL-------------RMI---DDGRASKYGQRQRPVSAAETPPKLSLQKVLLKLKEAVVSSHDALYKAFSSFDRDGTGTIKASELHQILDS-FCFKLSDRQFGYLLSKLPLGEEQTIDWKAFLHHFSTSH---------PEPSSSWVER--VQHATRPRSTQGLTMKDILNHIREVVTARFYTVAQDFISLDYANINAVSKEDFRELFNKDFML---LTDEQFENLWNTLPLNPYGNLKYHEFLSQFGGGDALVSPYEKTAGDQSEFIYKPASALAGNHTPPESQAGIRRPKTAPAILNKP-KTDT---QRPKTAGASSRLVNCEQIEARLRGSLQKVWQEVLRACRDYDPERTGEITTNDFSGVLKQFNAETNEEELERLTVKYDSRNNGKFSYADFFRNIML--GPKPLEKSPLHRMKVQKTRVPISTGPDGPCFLNAMMRIQPKVLDCWRPMRRAFLSFDEARTGFISVQEFKQVLRKSGLNLSEDEFFHILGFFDKDLKAKVSYNDFLR 1504          

HSP 2 Score: 87.0409 bits (214), Expect = 1.290e-16
Identity = 108/450 (24.00%), Postives = 204/450 (45.33%), Query Frame = 1
Query: 1486 DSELNPVSL--VEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETSSVLNEADPVTDYNIEEIQSGKTVAE-IKTIMKQA--FDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHF-----MYNKSTASFPNAKLN-PPVKGDSDLMQRSR-----KLNAATDILMDN----LRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTP-NNKIAYLELLKPFCSHKSQQILENXXXXXXXXXXXXIDQFNGKDS--NSFHFFHKLQAVIQSA---MIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLL 2757
            D  L P+ +  + ++ VN  ++D   +   F   D  QN ++   +F +VL+N + +  TESQF  +++ +P+N N T+PYLDFL +F   + S+     +  + S  ++A+ V   N  EI+   TV++ +K +++    FD         +N+    NG++   EL  ++++    K  +   +   +W  + + +K  LD++E  R+      ++NK TA    + LN   V+ +    +  R     K  +A D  +D+    LR KI   Y +L+K F   D  ++G +S E  Q +I      L +   + + ++      ++I + + L+ F   +S      +        + +++   G+    +S H   KLQ   Q A   + +    +D G  G IS  ELR ++      +++ +   LM   D    G I+Y   L
Sbjct:   51 DPTLTPLEIEGIIYRRVNENEED---VTNAFLTLDTEQNFTVTRGEFYRVLQNFI-LPLTESQFNELLEKIPVNNNGTIPYLDFLAKFLRTSSSATCARSVKRSWSC-SQANQVLSLNELEIRLKNTVSKNLKNVVRSCRLFD---------YNQ----NGQIQKQELR-RILENCCFK--MKTAEFEKLWNRYCIGKKNTLDYRELLRNLGVNVELHNKPTAENVASALNREAVQREQQKEKNCRPPPPLKELSAEDYTIDDIEAALRKKISASYPNLVKAFRAFDGSHSGYVSAEALQSVINNFIFPLPNGTFQKLMNRLAIKCTDRIGWEQFLRRFQGPESMA----NGQTIPMKPNHRVNPVRGESPVVSSEHILQKLQRHFQDAYPSLKQAFLVLDEGRKGRISRKELRRIVDCMMFRVTDAQFKELMIILDPQHTGFISYLQFL 475          

HSP 3 Score: 53.1434 bits (126), Expect = 2.730e-6
Identity = 125/669 (18.68%), Postives = 260/669 (38.86%), Query Frame = 1
Query:  517 KLSLEEISEILQNKLEKNYYEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCEITTSCLNSLFEMWGIKSEKQMLSFNEIYTIFVNKSKEKSETSFFDPVNRHKAKAIVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGIISYPIASLTPNVRASNDSFKLNLNASFI-----EKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEG-IPYKEFL----IRFQDRSEAGITHKLLTDRDNKKSSNIDSELN----------------PVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLN-RNQTVPYLDFLKQFDTGNFSSLSFNDIHETSSVLNEADPVTDYNIEEIQSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFMYNKSTASFPNAKLNPPVKGDSDLMQRSRKLNAATDILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFK-TPNNKIAYLELLKPF 2439
            K+ +EE+   L++ +    +  R+ F+      KG + K+   +++++     +       L E  G   E+  LS+ +  ++F + +      +  D  + H         M+A D    +++K +     L   F     ++   +T  D ++ L   M  + P E ++L          +++  +FL    +   P + + P    S+ S K ++    +        L TK +  +  + + F + D+   G +   D   VL    L +      +   R    P  +G + + EFL    I F    ++G + ++  D       + +++L                  +  +E ++ + F+  + +    F K D+ ++G I + D + +L++ +N    + QF  ++  L +   +  + Y DFL+  D G  S                  PV+     E     ++ ++   +K+A  S    + K F+  D      +    + Q++ +   K  LS      +     L E++ +D+K F  HF     + S P    +   +       RS +     DIL +++R  +   +  + ++F  LD  N  A+S EDF+E+  +  + LTD +   + +     P   + Y E L  F
Sbjct:  609 KMPVEEVIGKLKDCVIGQEFSPRESFLAFAKQHKGRISKKDFRKVLRE-HEIHLDEDQFKRLTEKLGFTKEE--LSYLDFVSLFEDPTGNGPGAAL-DTGSNHHVNDTKFHYMSAEDCLAQLRDKLQQGYGDLYSAFYKIDSNRDGLVTMHDFRHLLDSFMFIIKPQEFQRLLGLLGLNLSSTLNYKEFLH---LFQKPQSPVYPPWLQSSHSPKQSMGGEDLACEQAHYYLVTKAQGRWHDMAKTFCEIDSEGNGIVQKKDLRNVLFRFYLPIHPKEFEKLWGR--YDPEGKGFLTHNEFLEKLGISFAS-GDSGPSKQITEDNRACLEGHYNNQLKIQEEMDAFHKHQTKALDMKDIEQQIKDKFRDYYHDFSAAFAKIDRNKDGQISVHDLRAMLQS-LNFHLDDEQFANLLYRLRIKVTDNKLSYPDFLRMIDDGRASKYG-----------QRQRPVS---AAETPPKLSLQKVLLKLKEAVVSSHDALYKAFSSFDRDGTGTIKASELHQILDSFCFK--LSDRQFGYLLSKLPLGEEQTIDWKAFLHHF-----STSHPEPSSSWVERVQHATRPRSTQGLTMKDIL-NHIREVVTARFYTVAQDFISLDYANINAVSKEDFRELFNKDFMLLTDEQFENLWNTLPLNPYGNLKYHEFLSQF 1244          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Xenopus
Match: immp2l (inner mitochondrial membrane peptidase subunit 2 [Source:Xenbase;Acc:XB-GENE-1010851])

HSP 1 Score: 103.99 bits (258), Expect = 8.036e-22
Identity = 132/591 (22.34%), Postives = 238/591 (40.27%), Query Frame = 1
Query: 1156 FKLNLNASFIEKLL-KTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNIDSELNPVSLVEFKLVNLFQKDFLEILEN-----------FRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETSSVLNEADPVTDYNIEEIQSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLM-KTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHF--------------------MYNKSTASFPN-------AKLNPPVKGDSDL------MQRSRKLNAATDI-----LMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTPNN-KIAYLELLKPFCSHKSQQILENXXXXXXXXXXXXIDQFNGKDSNSF-HFFHKLQAVI---QSAMIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQ 2760
            F L ++    EKL  + K R+ +      F K D N+ G +S+ D   +L   +  L++      L R  I  T   + Y +FL             +++   D+ ++S       PVS  E       QK  L++ E            F  FD+   G+I+  +  ++L++    + ++ QF  ++  LPL   QT+ +  FL  F T +          E SS   E   V          G T+ +I   +++   ++F  + + F  LD  N   ++ E   +L  K   +   L+     ++W T  LN    L + EF   F                    +Y  ++A   N       A +  P    + L       QR +   A++ +     +   LR  +  ++ ++L+     DPE  G I+  DF  ++K+ +    + E+  +T K+ + NN K +Y +  +        + LE S   + K+   ++    G D   F +   ++Q  +      M R     D   TGFIS+ E + +L   G++LSEDE F+++  +DK+L   ++Y   L+
Sbjct:  895 FYLPIHPKEFEKLWGRDKFRDYYHDFSAAFAKIDRNKDGQISVHDLRAMLQSLNFHLDDEQFANLLYRLRIKVTDNKLSYPDFL-------------RMI---DDGRASKYGQRQRPVSAAETPPKLSLQKVLLKLKEAVVSSHDALYKAFSSFDRDGTGTIKASELHQILDS-FCFKLSDRQFGYLLSKLPLGEEQTIDWKAFLHHFSTSH---------PEPSSSWVER--VQHATRPRSTQGLTMKDILNHIREVVTARFYTVAQDFISLDYANINAVSKEDFRELFNKDFML---LTDEQFENLWNTLPLNPYGNLKYHEFLSQFGGGDALVSPYEKTAGDQSEFIYKPASALAGNHTPPESQAGIRRPKTAPAILNKPKTDTQRPKTAGASSRLVNCEQIEARLRGSLQKVWQEVLRACRDYDPERTGEITTNDFSGVLKQFNAETNEEELERLTVKYDSRNNGKFSYADFFRNIML--GPKPLEKSPLHRMKVQKTRVPISTGPDGPCFLNAMMRIQPKVLDCWRPMRRAFLSFDEARTGFISVQEFKQVLRKSGLNLSEDEFFHILGFFDKDLKAKVSYNDFLR 1452          

HSP 2 Score: 87.4261 bits (215), Expect = 9.005e-17
Identity = 108/450 (24.00%), Postives = 204/450 (45.33%), Query Frame = 1
Query: 1486 DSELNPVSL--VEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETSSVLNEADPVTDYNIEEIQSGKTVAE-IKTIMKQA--FDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHF-----MYNKSTASFPNAKLN-PPVKGDSDLMQRSR-----KLNAATDILMDN----LRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTP-NNKIAYLELLKPFCSHKSQQILENXXXXXXXXXXXXIDQFNGKDS--NSFHFFHKLQAVIQSA---MIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLL 2757
            D  L P+ +  + ++ VN  ++D   +   F   D  QN ++   +F +VL+N + +  TESQF  +++ +P+N N T+PYLDFL +F   + S+     +  + S  ++A+ V   N  EI+   TV++ +K +++    FD         +N+    NG++   EL  ++++    K  +   +   +W  + + +K  LD++E  R+      ++NK TA    + LN   V+ +    +  R     K  +A D  +D+    LR KI   Y +L+K F   D  ++G +S E  Q +I      L +   + + ++      ++I + + L+ F   +S      +        + +++   G+    +S H   KLQ   Q A   + +    +D G  G IS  ELR ++      +++ +   LM   D    G I+Y   L
Sbjct:   51 DPTLTPLEIEGIIYRRVNENEED---VTNAFLTLDTEQNFTVTRGEFYRVLQNFI-LPLTESQFNELLEKIPVNNNGTIPYLDFLAKFLRTSSSATCARSVKRSWSC-SQANQVLSLNELEIRLKNTVSKNLKNVVRSCRLFD---------YNQ----NGQIQKQELR-RILENCCFK--MKTAEFEKLWNRYCIGKKNTLDYRELLRNLGVNVELHNKPTAENVASALNREAVQREQQKEKNCRPPPPLKELSAEDYTIDDIEAALRKKISASYPNLVKAFRAFDGSHSGYVSAEALQSVINNFIFPLPNGTFQKLMNRLAIKCTDRIGWEQFLRRFQGPESMA----NGQTIPMKPNHRVNPVRGESPVVSSEHILQKLQRHFQDAYPSLKQAFLVLDEGRKGRISRKELRRIVDCMMFRVTDAQFKELMIILDPQHTGFISYLQFL 475          

HSP 3 Score: 68.5514 bits (166), Expect = 4.735e-11
Identity = 124/635 (19.53%), Postives = 246/635 (38.74%), Query Frame = 1
Query:  679 TTSCLNSLFEMWGIKSEKQMLSFNEIYTIFVNKSKEKSETSFFDPVNRHKAKAIVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGIISYPIASLTPNVRASNDSFKLNLNA---------------------------SFIEKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNIDSELNPVSLVEF---KLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQF-DTGNFSSLSFNDIHETSSVLNEADPVTDYNIEEIQSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFMYNKSTASFPNAKLNPPVKGDS--------DLMQRSRKLNAATDILMDNLRAK--IDLLYNDLLKE-------FTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTPNNKIAYLELLKPF 2439
            + +C  S+   W      Q+LS NE+            E    + V+++    +   ++     FDY                     +Q   I K +L+  L      +   E EKLW ++   K+ ++D  + L+ +G+       L     A N +  LN  A                             IE  L+ K+   +  L + F+  D + +G++S      V++     L      + ++R  I  T + I +++FL RFQ   E+    + +  + N + + +  E +PV   E    KL   FQ  +  + + F   D+ + G I  K+ +++++  M    T++QFK ++  L       + YL FL  F D  + S   +  +H   + L E  PVT   +E  + G        I+ +  +  + D  K     D     ++  +   +++++    P LS      + + +       + + +F R+     S A   N      V G          DL  R +++ +    L+  +  +  I  L + ++ +       F     ++ G IS +DF+++++E  IHL + + + +T+K      +++YL+ +  F
Sbjct:  140 SATCARSVKRSWSCSQANQVLSLNEL------------EIRLKNTVSKNLKNVVRSCRL-----FDY---------------------NQNGQIQKQELRRILENCCFKMKTAEFEKLWNRYCIGKKNTLDYRELLRNLGVN----VELHNKPTAENVASALNREAVQREQQKEKNCRPPPPLKELSAEDYTIDDIEAALRKKISASYPNLVKAFRAFDGSHSGYVSAEALQSVINNFIFPLPNGTFQKLMNRLAIKCT-DRIGWEQFLRRFQG-PESMANGQTIPMKPNHRVNPVRGE-SPVVSSEHILQKLQRHFQDAYPSLKQAFLVLDEGRKGRISRKELRRIVDCMM-FRVTDAQFKELMIILDPQHTGFISYLQFLDLFEDKESVSGHKW--LHNMRTPLKET-PVT---LEWEKMG-------NILCEKIEHNWADFSKAMKSCDSAGCGMVDKDQFKRILQSF--CPPLSDRHYNMLCEQYNDGANGYISYMDFLRNVGVCTSAAGDLNGVSTEIVHGSQLREELRQDDLSARMKEIESQATQLVKKMPVEEVIGKLKDCVIGQEFSPRESFLAFAKQHKGRISKKDFRKVLREHEIHLDEDQFKRLTEKLGFTKEELSYLDFVSLF 713          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Xenopus
Match: ENSXETT00000007484.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:1:35434641:35435264:1 gene:ENSXETG00000002733.1 transcript:ENSXETT00000007484.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 3.736e-8
Identity = 22/53 (41.51%), Postives = 39/53 (73.58%), Query Frame = 1
Query: 2602 KIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQ 2760
            K+D  ++G++S+ E +++L L    L EDEV+++M+ YD+N++G INYK  L+
Sbjct:    7 KLDMDSSGYLSLPEFKSVLKLCNFVLDEDEVYHIMSKYDQNMDGRINYKSFLE 59          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Mouse
Match: Efcab6 (EF-hand calcium binding domain 6 [Source:MGI Symbol;Acc:MGI:1924877])

HSP 1 Score: 92.4337 bits (228), Expect = 1.884e-18
Identity = 164/800 (20.50%), Postives = 315/800 (39.38%), Query Frame = 1
Query:  520 LSLEEISEILQNKLEKNYYEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCEITTSCLNSLFEMWGIKSEKQMLSFNEIYTIFVNKSKEKSETSFFDPVNRHKAKA-IVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGIISYPIASLTPNVRASNDSFKLNLNASF---------IEKLLKTKLREGFTTLRQDFQKK--DTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNID-SELNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETSSVLNEADPVTDYNIEEIQSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFMYNK---------------------STASFPNAK----LNPPVKGDSDLMQRSRKLNAATDILMDN-------LRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTPNN-KIAYLELLKP---FCSHKSQQILENXXXXXXXXXXXXIDQFNGKDSNSFH-FFHKLQAVIQSA---MIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQ 2760
            +S EE   I   KL++++ +V   F   D DR G +      R++Q  +   +          + G++     LS    +  F N  +++   S   P    + K  +  +++    A  Y+  K ++R   L+  F ++       + + D+KNSLY   I L P E EKLW  +D   +G I   +FL ++GI        +P V         N    F         I++L +   RE      ++  K      ++  +++    +VL E    L+E  L   L    ++     I   EFL   +    +    K   +++      I  S++ P  +++  +  + +     ++E F   DK   G ++  +F  VL + +  + T++Q+   +  L L+    + +  FL+ F T  F   + +D  E    + +A P    + +E      VA +    ++A  S +  I + F   D      ++ +  F+ + T  ++  L+      +W    +N K  L +++F       +                     S   F         +PP      L  RS          + N       LR +I   + +LL+E    D +  G IS  +F  ++++  + ++  E + +  K+   NN K AY + ++        K   ++     +      +      G ++ SF+    ++Q  I      M R+ K  D   TG +S+A+ R +L    ++LSE+E F+++  YDK+L+  I+Y   L+
Sbjct:  748 ISAEECLRIFPKKLKESFRDVYSAFFRIDLDRDGIISMHDFHRLLQ-YLQLNMVDLEFERFLSLLGLR-----LSVTLNFREFQNLCEKRPWKSDEAPQRLIRCKQKVADSELACEQAHQYLIMKAKTRWADLSKNFIETDNEGNGILRRRDIKNSLYGFDIPLTPREFEKLWQNYDTEGRGYITYQEFLHRLGI------RYSPKVHRPYKEDYFNFLGHFTKPKQVQEEIQELQQISEREKLMNHYEEISKAFNAMEKSKPVALCRVQKVLQECGCPLKEEELISLLKSLDVSVHNNHIDPVEFLRALEISWASKARPK---EKEESSPPPISFSKVTPDEVIK-TMQEVVESSQPALVEAFSALDKEDTGFVKAMEFGDVLRS-VCQKLTDNQYHYFLRRLRLHLTPNIHWKYFLENFST--FQDETADDWAEN---MPKAPP--PMSPKETAHRDIVARV----QKAVASHYHTIVQEFENFDTLKSNTVSRD-EFRSICTRHIQI-LTDEQFDRLWSELPVNAKGRLKYQDFLSKLSIERVPSPPMAAGDSGESTMAQRGSSAPEFSQGTRSNLYSPPRDSRVGLKSRSHPCTPVGTPPLQNCEPIESRLRKQIQGCWRELLRECKEKDTDKQGTISAAEFLALVEKFKLDISREESQQLIVKYDLKNNGKFAYCDFIQSCVLLLKAKETSLMRRMRIQNADKMKEA-----GMETPSFYSALLRIQPKIVHCWRPMRRSFKTYDKNGTGLLSVADFRKVLRQYSINLSEEEFFHVLEYYDKSLSSKISYNDFLR 1512          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. UniProt
Match: sp|Q4R8T1|EFCB6_MACFA (EF-hand calcium-binding domain-containing protein 6 (Fragment) OS=Macaca fascicularis OX=9541 GN=EFCAB6 PE=2 SV=2)

HSP 1 Score: 120.939 bits (302), Expect = 7.592e-27
Identity = 148/662 (22.36%), Postives = 274/662 (41.39%), Query Frame = 1
Query:  958 ITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGIISYPIASLTPNVRASNDSFKLNLNASFIEKL----------------LKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNID-SELNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETSSVLNEADPVTDYNIEEIQSGKTVA--EIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFMYN---------------------------KSTASFPNAKLNPPVKGDSDLMQRSRKLNAA-------TDILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTPNN-KIAYLELLKP---FCSHKSQQILENXXXXXXXXXXXXIDQFNGKDSNSFH-FFHKLQAVIQSA---MIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQ 2760
            + + D+KN+LY   I L P E EKLW  +D   +G I   +FL+++G ++Y  A   P    + D F    + +  ++L                 + KL + +  + + F K D ++T ++SI    +VL E    L E  L   L+   ++     I Y +FL   ++    G   K     + ++S  I+ + LNP  +V  K+  + +   L +   F   DK   G ++  +F +VL++  + + T++Q+   +  L   R    PY+++  ++   NFS        E +  + +  P T        S K +A  +I   + +A  S +  I + F   D      ++ E  F+ +   +V+  L+      +W    +N K  L + +F   F                              +S  S PN +L P  K  S     +              D +   LR +I   +  LLKE    D    G IS  +F  ++++ ++ ++  E + +  K+   NN K AY + ++        K   +++    +            +G +++SF+    ++Q  I      M R  K  D   TG +S+A+ R +L    ++LSE+E F+++  YDK L+ +I+Y   L+
Sbjct:   12 LRRRDIKNALYGFDIPLTPREFEKLWASYDTEGKGHITYQEFLQKLG-VNYSPAVHRP---CAEDYFNFMGHFTKPQQLQEEMKELQQSTEKAVAARDKLVDCYQDISKAFTKIDKSKTNYISICKMQKVLEECGCSLTEGELTNLLNSWGVSRHDNSINYLDFLRAVENSKSTGAQPK-----EKEESMPINFATLNPQEVVR-KIQEVVESSQLALSTAFSALDKEDTGFVKSTEFGQVLKDFCH-KLTDNQYHYFLRKL---RIHLTPYINW--KYFLQNFSCFLEETAEEWAEKMPKGPPPT--------SPKAMASRDILARLHKAVTSHYHAITQEFENFDTMKTNTISRE-EFRAVCNRNVQI-LTDEQFDRLWNEMPVNAKGRLKYPDFLSRFSSERAATPTATGDSAAAQRGSSVPDVSEGIRSALSLPNQELRPGSKPQSHPCTAASTTAIPGTPPLQNCDPIESRLRKRIQGCWRQLLKECKEKDVARQGDISASEFLALVEKFNLDISKEECQQLIIKYDLKNNGKFAYCDFIQSCVLLLKAKESSLMQRMKIQNAHKMKD-----SGAETSSFYSALLRIQPKIVHCWRPMRRTFKSYDEAGTGLLSVADFRTVLRQYSINLSEEEFFHILEYYDKTLSSNISYNDFLR 642          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. UniProt
Match: sp|Q5THR3|EFCB6_HUMAN (EF-hand calcium-binding domain-containing protein 6 OS=Homo sapiens OX=9606 GN=EFCAB6 PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 1.109e-25
Identity = 155/702 (22.08%), Postives = 283/702 (40.31%), Query Frame = 1
Query:  838 IVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGIISYPIASLTPNVRASNDSFKLNLNASFIEKL----------------LKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNID-SELNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETSSVLNEADPVTDYNIEEIQSGKTVA--EIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFMY---------------------------NKSTASFPNAKLNPPVKGDSD-LMQRSRKLNAAT------DILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFK-TPNNKIAYLELLKP---FCSHKSQQILENXXXXXXXXXXXXIDQFNGKDSNSFH-FFHKLQAVIQSA---MIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQ 2760
            +  +++    A  Y+  K ++R   L+  F ++       + + D+KN+LY   I L P E EKLW ++D   +G I   +FL+++G I+Y  A   P    + D F    + +  ++L                 + KL +    + + F K D ++T ++SI    +VL E    L E  L   L+   ++     I Y +FL   ++    G   K     + ++S  I+ + LNP   V  K+  + +   L +   F   DK   G ++  +F +VL++    + T++Q+   +  L   R    PY+++  ++   NFS        E +  + +  P T        S K  A  +I   + +A  S +  I + F   D      ++ E  F+ +    V+  L+      +W    +N K  L + +F   F                              +S  S P  +L P  K  S      S  +   T      D +   LR +I   +  LLKE    D    G I+  DF  ++++ ++ ++  E + +  K+    N K AY + ++        K   ++     +      +      G ++ SF+    ++Q  I      M R  K  D   TG +S+A+ R +L    ++LSE+E F+++  YDK L+  I+Y   L+
Sbjct:  827 VADSELACEQAHQYLVTKAKNRWSDLSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQKLG-INYSPAVHRP---CAEDYFNFMGHFTKPQQLQEEMKELQQSTEKAVAARDKLMDRHQDISKAFTKTDQSKTNYISICKMQEVLEECGCSLTEGELTHLLNSWGVSRHDNAINYLDFLRAVENSKSTGAQPK-----EKEESMPINFATLNPQEAVR-KIQEVVESSQLALSTAFSALDKEDTGFVKATEFGQVLKD-FCYKLTDNQYHYFLRKL---RIHLTPYINW--KYFLQNFSCFLEETADEWAEKMPKGPPPT--------SPKATADRDILARLHKAVTSHYHAITQEFENFDTMKTNTISRE-EFRAICNRRVQI-LTDEQFDRLWNEMPVNAKGRLKYPDFLSRFSSETAATPMATGDSAVAQRGSSVPDVSEGTRSALSLPTQELRPGSKSQSHPCTPASTTVIPGTPPLQNCDPIESRLRKRIQGCWRQLLKECKEKDVARQGDINASDFLALVEKFNLDISKEECQQLIIKYDLKSNGKFAYCDFIQSCVLLLKAKESSLMHRMKIQNAHKMKEA-----GAETPSFYSALLRIQPKIVHCWRPMRRTFKSYDEAGTGLLSVADFRTVLRQYSINLSEEEFFHILEYYDKTLSSKISYNDFLR 1497          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. UniProt
Match: sp|Q6P1E8|EFCB6_MOUSE (EF-hand calcium-binding domain-containing protein 6 OS=Mus musculus OX=10090 GN=Efcab6 PE=1 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 1.318e-17
Identity = 164/800 (20.50%), Postives = 315/800 (39.38%), Query Frame = 1
Query:  520 LSLEEISEILQNKLEKNYYEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCEITTSCLNSLFEMWGIKSEKQMLSFNEIYTIFVNKSKEKSETSFFDPVNRHKAKA-IVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGIISYPIASLTPNVRASNDSFKLNLNASF---------IEKLLKTKLREGFTTLRQDFQKK--DTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNID-SELNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETSSVLNEADPVTDYNIEEIQSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFMYNK---------------------STASFPNAK----LNPPVKGDSDLMQRSRKLNAATDILMDN-------LRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTPNN-KIAYLELLKP---FCSHKSQQILENXXXXXXXXXXXXIDQFNGKDSNSFH-FFHKLQAVIQSA---MIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQ 2760
            +S EE   I   KL++++ +V   F   D DR G +      R++Q  +   +          + G++     LS    +  F N  +++   S   P    + K  +  +++    A  Y+  K ++R   L+  F ++       + + D+KNSLY   I L P E EKLW  +D   +G I   +FL ++GI        +P V         N    F         I++L +   RE      ++  K      ++  +++    +VL E    L+E  L   L    ++     I   EFL   +    +    K   +++      I  S++ P  +++  +  + +     ++E F   DK   G ++  +F  VL + +  + T++Q+   +  L L+    + +  FL+ F T  F   + +D  E    + +A P    + +E      VA +    ++A  S +  I + F   D      ++ +  F+ + T  ++  L+      +W    +N K  L +++F       +                     S   F         +PP      L  RS          + N       LR +I   + +LL+E    D +  G IS  +F  ++++  + ++  E + +  K+   NN K AY + ++        K   ++     +      +      G ++ SF+    ++Q  I      M R+ K  D   TG +S+A+ R +L    ++LSE+E F+++  YDK+L+  I+Y   L+
Sbjct:  748 ISAEECLRIFPKKLKESFRDVYSAFFRIDLDRDGIISMHDFHRLLQ-YLQLNMVDLEFERFLSLLGLR-----LSVTLNFREFQNLCEKRPWKSDEAPQRLIRCKQKVADSELACEQAHQYLIMKAKTRWADLSKNFIETDNEGNGILRRRDIKNSLYGFDIPLTPREFEKLWQNYDTEGRGYITYQEFLHRLGI------RYSPKVHRPYKEDYFNFLGHFTKPKQVQEEIQELQQISEREKLMNHYEEISKAFNAMEKSKPVALCRVQKVLQECGCPLKEEELISLLKSLDVSVHNNHIDPVEFLRALEISWASKARPK---EKEESSPPPISFSKVTPDEVIK-TMQEVVESSQPALVEAFSALDKEDTGFVKAMEFGDVLRS-VCQKLTDNQYHYFLRRLRLHLTPNIHWKYFLENFST--FQDETADDWAEN---MPKAPP--PMSPKETAHRDIVARV----QKAVASHYHTIVQEFENFDTLKSNTVSRD-EFRSICTRHIQI-LTDEQFDRLWSELPVNAKGRLKYQDFLSKLSIERVPSPPMAAGDSGESTMAQRGSSAPEFSQGTRSNLYSPPRDSRVGLKSRSHPCTPVGTPPLQNCEPIESRLRKQIQGCWRELLRECKEKDTDKQGTISAAEFLALVEKFKLDISREESQQLIVKYDLKNNGKFAYCDFIQSCVLLLKAKETSLMRRMRIQNADKMKEA-----GMETPSFYSALLRIQPKIVHCWRPMRRSFKTYDKNGTGLLSVADFRKVLRQYSINLSEEEFFHVLEYYDKSLSSKISYNDFLR 1512          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. UniProt
Match: sp|Q5RE62|EFCB6_PONAB (EF-hand calcium-binding domain-containing protein 6 OS=Pongo abelii OX=9601 GN=EFCAB6 PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 6.216e-11
Identity = 77/325 (23.69%), Postives = 140/325 (43.08%), Query Frame = 1
Query:  838 IVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGIISYPIASLTPNVRASNDSFKLNLNASF----------------IEKLLKTKLREGFTTLRQD----FQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNID-SELNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDT 1749
            +  +++    A  Y+  K ++R   L+  F ++       + + D+KN+LY   I L P E EKLW +++   +G I   +FL+++G I+Y  A   P    + D F  N    F                 EK +    R+    L QD    F K D ++T ++SI    +VL E    L E  L   L+   ++  +  I Y +FL   ++    G   K     + ++S  I  + LNP  +V  K+  + +   L +   F   DK   G ++  +F +VL++    +  ++Q+   +  L ++    + +  FL+ F  
Sbjct:  675 VADSELACEQAHQYLVTKAKNRWSDLSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYNTEGKGHITYQEFLQKLG-INYSPAVHQP---CAEDYF--NFMGHFTKPQQLQEEMKELQQSTEKAMAA--RDKLMDLHQDISKAFTKIDKSKTNYISICKMQKVLEECGCSLTEGELTHLLNSWGVSRHENAINYLDFLRAVENSKSTGAQPK-----EKEESMPISFATLNPQEVVR-KIQEVVESSQLALSTAFSALDKEDTGFVKATEFGQVLKD-FCYKLMDNQYHYFLRKLRIHLTPYINWKYFLQNFSC 984          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. TrEMBL
Match: gnl|BL_ORD_ID|18198014 (tr|A0A267DVA3|A0A267DVA3_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033909g1 PE=4 SV=1)

HSP 1 Score: 527.709 bits (1358), Expect = 9.958e-169
Identity = 320/931 (34.37%), Postives = 519/931 (55.75%), Query Frame = 1
Query:  172 IEHPLSKMA---------KENTFDNTVNNFLTPADEGRSLAFEDEQKYKPKKXXXXXXXXXXXXXXXXMDNLNLHGTFLTNIPESIAVVGGDANLTRMPLFGNRSNIQS---------------------------RNSTTSRHGSAKEAVKLSLEEISEILQNKLEKNYYEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCEITTSCLNSLFEMWGIKSEKQMLSFNEIYTIFVNKSKEKSE-TSFFDPVNRHKAKAIVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGIISYPIASLTPN-------------------VRASNDSFKLNLNASFIEKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNIDSELNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETSSVLNEADPVTDYN--IEEI--QSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFMYNKSTASFPNAKLNPPVKGDSDLMQRSRKLNAATDILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKF-KTPNNKIAYLELLKPFCSHKSQQILENXXXXXXXXXXXXIDQFNGKDSNSFHFFHKLQAVIQSAMI-------RNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQ 2760
            IEHP++KMA         + +    T  + +   + GR LA E      P +   + SS R  RS  +  N    G     IPE + VV G++  TR+P+FG R+   +                           ++S +SR   A+ A +L L+EI  I++ K+  NYYE+RK+F  NDP++KGNV ++AL+RI+   VG  ++   L  LFE  GI+ + Q+++F+E Y+    + +E  E  ++ DP+ R +   +   +++A      + E+ R R + L D+FP  V+     + K +L++SL K+++ +   E E+LW  +D    G+++ +  LK++GI   P      +                      S +S + +L    IE  LK K REGF  L+  F+ +D  +TG +S  DF+ VL EH L LE+ +L EFL+RC +T TK G+ Y++FL RFQDRSEAG+ HK++ +  + K  +  S    +S +E +L+N+FQ+DFL +L  F+K D++    I  ++F+ V+E++   E T++Q++  VD LPLN +  + Y  F++QFDT   +   F  +   + V +E+D   D +  +EE    + ++V+E +  ++    S+F ++E  F ELD +N   LT E+M+QL+    +KPE++RG+IR +WKTFIL  ++ LD++EF R F++N  TA++PNAKL PP KGDSDLM RSRK+N+  ++L D LRAKID L++ L  EF  +DP   G IS E+FQE++KEL+I LTD+E+  +TDKF +  + ++ Y+ELL+PF   K     ++ ++   +      +        +      L A ++  +        R + K+D  N+G IS+AE R++L L  V L E+E F LM+ +D +L+G + YK +L+
Sbjct:   21 IEHPMAKMADRLQTPLDVRGDGRSGTAGDVM---EGGRPLASEQ----PPVQPASAASSRRGRRSQVAASNGGGGGLRHQTIPEGVEVVHGESGRTRLPVFGVRAQDAAEAALDRARQSLDADASPAAAAGDRALLKSSNSSRLSEAQSA-RLELDEIEAIIKEKVRNNYYEMRKRFTANDPEQKGNVTRDALLRILVSAVGRPVSLRQLAQLFERVGIRRDAQLINFSEFYSAL--RDQEPGEYPNWMDPIQRQR---LERNRLSAEQVHANLSERMRQRFVDLADVFPQFVDGGTGRMLKHELRSSLEKMLLPMDDDEFERLWRIYDPRDTGTVNGVSLLKKLGIAMKPAEGGGSHRDAAAKPAAKPAAAATRRPALKSEESRQRSLT---IESWLKDKFREGFQALKAGFEARDPERTGLVSHDDFLAVLREHSLSLEKRHLAEFLARCAVTHTKAGVMYRDFLHRFQDRSEAGMAHKIMANPHHTKEDDTVSRT--LSSIEKQLMNMFQRDFLSLLSAFQKIDRHGLNVISQEEFRAVMESRFGFELTDAQYREFVDKLPLNSDGLIRYDIFMRQFDTKGMAPSLFKSVG-GNDVASESDAARDEDDELEEPYDPNKRSVSETRRCIRDLLHSRFQEVETAFYELDTFNSGRLTQEMMYQLLNRF-IKPEVTRGEIRDLWKTFILGGREALDYQEFLRAFIFNPLTAAYPNAKLAPPRKGDSDLMMRSRKVNSDVNLLEDGLRAKIDYLWDQLRDEFVSMDPYGTGCISREEFQEVLKELAIQLTDYELNRLTDKFTQKSDGRVNYIELLRPFAYKKFGPKRQHMNELLSQRSPAAENGHATGQPVASAELQSLAAKLKRQLTGEWKNLRRQLMKMDPNNSGSISLAEFRSVLKLFNVILDEEESFQLMSHFDTSLSGKLPYKKVLE 931          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. TrEMBL
Match: gnl|BL_ORD_ID|18270781 (tr|A0A267GEM4|A0A267GEM4_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033909g3 PE=4 SV=1)

HSP 1 Score: 520.776 bits (1340), Expect = 4.577e-166
Identity = 318/939 (33.87%), Postives = 516/939 (54.95%), Query Frame = 1
Query:  172 IEHPLSKMA---------KENTFDNTVNNFLTPADEGRSLAFEDEQKYKPKKXXXXXXXXXXXXXXXXMDNLNLHGTFLTNIPESIAVVGGDANLTRMPLFGNRSNIQS---------------------------RNSTTSRHGSAKEAVKLSLEEISEILQNKLEKNYYEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCEITTSCLNSLFEMWGIKSEKQMLSFNEIYTIFVNKSKEKSE-TSFFDPVNRHKAKAIVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGIISYPIASLTPN-----------------------VRASNDSFKLNLNASFIEKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNIDSELNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGN-----FSSLSFNDIHETSSV---LNEADPVTDYNIEEIQSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFMYNKSTASFPNAKLNPPVKGDSDLMQRSRKLNAATDILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKF-KTPNNKIAYLELLKPFCSHKSQQILENXXXXXXXXXXXXIDQFNGKDSNSFHFFHKLQAVIQSAMI-------RNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQ 2760
            IEHP++KMA         + +    T  + +   + GR LA E      P +   + SS R  RS  +  N    G     IPE + VV G++  TR+P+FG R+   +                           ++S +SR   A+ A +L L+EI  I++ K+  NYYE+RK+F  NDP++KGNV ++AL+RI+   VG  ++   L  LFE  GI+ + Q+++F+E Y+    + +E  E  ++ DP+ R +   +   +++A      + E+ R R + L D+FP  V+     + K +L++SL ++++ +   E E+LW  +D    G+++ +  LK++GI   P      +                          S +S + +L    IE  LK K REGF  L+  F+ +D  +TG +S  DF+ VL EH L LE+ +L EFL+RC +T TK G+ Y++FL RFQDRSEAG+ HK++ +  + K  +  S    +S +E +L+N+FQ+DFL +L  F+K D++    I  ++F+ V+E++   E T++Q++  VD LPLN +  + Y  F++QFDT       F S+  ND+   S      ++      Y+  +    ++V+E +  ++    S+F ++E  F ELD +N   LT E+M+QL+    +KPE++RG+IR +WKTFIL  ++ LD++EF R F++N  TA++PNAKL PP KGDSDLM RSRK+N+  ++L D LRAKID L++ L  EF  +DP   G IS E+FQE++KEL+I LTD+E+  +TDKF +  + ++ Y+ELL+PF   K     ++ ++   +      +        +      L A ++  +        R + K+D  N+G IS+AE R++L L  V L E+E F LM+ +D +L+G + YK +L+
Sbjct:   21 IEHPMAKMADRLQTPLDVRGDGRSGTAGDVM---EGGRPLASEQ----PPVQPASAASSRRGRRSQVAASNGGGGGLRHQTIPEGVEVVHGESGRTRLPVFGVRAQDAAEAALDRARQSLDADASPAAAAGDRALLKSSNSSRLSEAQSA-RLELDEIEAIIKEKVRNNYYEMRKRFTANDPEQKGNVTRDALLRILVSAVGRPVSLRQLAQLFERVGIRRDAQLINFSEFYSAL--RDQEPGEYPNWMDPIQRQR---LERNRLSAEQVHANLSERMRQRFVDLADVFPQFVDGGTGRMLKHELRSSLERMLLPMDDDEFERLWRIYDPRDTGTVNGVSLLKKLGIAMKPAEGGGSHRDAAAKSAAKPAAKPAAAAPRRPALKSEESRQRSLT---IESWLKDKFREGFQALKAGFEARDPERTGLVSHDDFLAVLREHSLSLEKRHLAEFLARCAVTHTKAGVMYRDFLHRFQDRSEAGMAHKIMANPHHTKEDDTVSRT--LSSIEKQLMNMFQRDFLSLLSAFQKIDRHGLNVISQEEFRAVMESRFGFELTDAQYREFVDKLPLNSDGLIRYDIFMRQFDTKGMAPSLFKSVGGNDVASESDAGIDEDDELEEEPYDPNK----RSVSETRRCIRDLLHSRFQEVETAFYELDTFNSGRLTQEMMYQLLNRF-IKPEVTRGEIRDLWKTFILRGREALDYQEFLRAFIFNPLTAAYPNAKLAPPRKGDSDLMMRSRKVNSDVNLLEDGLRAKIDYLWDQLRDEFVSMDPYGTGCISREEFQEVLKELAIQLTDYELNRLTDKFTQKSDGRVNYIELLRPFAYKKFGPKRQHMNELLSQRSPAAENGHATGQPVASAELQSLAAKLKRQLTGEWKNLRRQLMKMDPNNSGSISLAEFRSVLKLFNVILDEEEAFQLMSHFDTSLSGKLPYKKVLE 936          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. TrEMBL
Match: gnl|BL_ORD_ID|23846446 (tr|V4AX16|V4AX16_LOTGI Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_238765 PE=4 SV=1)

HSP 1 Score: 515.768 bits (1327), Expect = 1.220e-164
Identity = 319/924 (34.52%), Postives = 516/924 (55.84%), Query Frame = 1
Query:  124 MSRPASVKTAVNKMLA---IEHPLSKMAKENTFDNT-----VNNFLTPADEGRSLAFEDEQKYKPKKXXXXXXXXXXXXXXXXMDNLNLHGTFLTNIPESIAVVGGDANLTRMPLFGNRSNIQSRN-----STTSRHGSAKEAVKLSLEEISEILQNKLEKNYYEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCEITTSCLNSLFEMWGIKSEKQMLSFNEIYTIFVNKSKEKSETSFFDPVNRHKAKAIVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGIISYPIAS------LTPNVRASNDSFKLNLNASF--------------IEKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTD---RDNKKSSNIDSELNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETSSVLNEADPVTDYNIEEIQSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFMYNKSTASFPNAKLNPPVKGDSDLMQRSRKLNAATDILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTPNN-KIAYLELLKPFCSHKSQQILENXXXXXXXXXXXXIDQFNGKDSNSFHFFHKLQAVIQSAMI-------RNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQD 2763
            ++RPAS  + +   ++   I+HPLS+M+     + T      +   +   +GR LA E EQ +  K            R     DN       + +IPE + V  GD   TRMP+FG+R+ +  R      S   R  +A    +L ++E+  +L+ K++ NY E++K+F DNDP+ KGNV +EAL RI+  I+  +++ S ++ L E   +K EK ++SF E ++ F    ++++   + DPV R+         M+A+     +KEK + R M L D+ P      +  I K + +  L K+M  L   E +KLW K+D+  +G I   KFLK +GI    +++      L+P V   N S +   ++S               IE+ LK K REGF  +++ F+ KD +++G +S  DF++VL  H LKL+++ LG FLSRC +     GIPY+EFL RFQDRSE G+ H +L+    R NK  S   S  + +S +E +L+N+FQ+DFL +L  F+  DK     I L++F+  +E++ N+E T+ QF   +D LPL+ +  V Y +F+KQFDT   +   F    +         P+ +  +EE  S +   EI  ++K     KF ++EK F +LD+ N + +T E+M+QL+K  ++KP +SRG+IR +WKTFI N  + LD+ +F RHF ++  +A++PNAK  PP  GDSD M RSRKLN+  D+L DN+R+KI+LL++DL +EF  +D  N G I+VE+F++I+ EL+IHL++ E+  +T KF T N+ +++Y+E LKP+     QQ   +         +  + Q   +D  +    H +   ++  M        R  +K+D    G++S+ E +++L L  V L EDE++++M+ +DK ++G I+Y   +Q+
Sbjct:    6 LARPASQMSVMQTRMSLPEIQHPLSRMSNPGNMNVTGVSKSQDRPFSQMSQGRPLANE-EQLFVRKSFSAMGRRESRLRFRK--DNFAQPPPAIDSIPEGVEVSQGDPTKTRMPIFGSRAEMADREDIVPPSRAGRMSAASTQARLEIDELESLLRGKVKNNYREIKKRFKDNDPELKGNVTREALSRILMVILNRQLSQSVISRLLERLHLK-EKSVISFTEFHSAF-RVDEDRNYPKWMDPVTRNDK-----VNMSASQVHTQLKEKAKQRFMDLADMIPQINPGGSGRILKPEFRQMLSKMMFYLEDEEFDKLWNKYDRDCEGVIKGEKFLKALGIQWRGMSAESEKCPLSPVVEQGNPSPESERSSSRTPKRREVERRQQLDIERWLKDKFREGFFNMKESFEVKDIDKSGVVSYDDFLEVLETHGLKLDKTLLGAFLSRCSVKVQGRGIPYREFLHRFQDRSEDGMVHNILSQTKHRFNKPGS--PSNNSTLSAIESQLMNMFQRDFLALLATFKNIDKLGQDRISLEEFRAAVESRFNLELTDGQFDSFIDRLPLDEDGDVIYGEFMKQFDTKGKAQSLFTGKKKVDI------PLQEEYLEEAPSHRHPKEIFKVIKDLLSRKFQEVEKEFYDLDDTNTRRITQEMMYQLLKRFNIKPHVSRGEIRDLWKTFITNSDRTLDYHQFVRHFGFSIRSAAYPNAKYCPPRHGDSDCMVRSRKLNSTRDLLEDNVRSKIELLFDDLRREFQSMDVFNTGFITVEEFKDILLELNIHLSEVELDNITRKFNTRNDGRVSYVEFLKPY--EWKQQTWRH-----GNDMATVLQQPLAEDDGAIS-LHGITNKLREKMSGDWKTLRRAFRKLDLNGNGYLSLPEFKSVLKLANVILDEDEIYHVMSEFDKGMSGKISYDQFIQE 903          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. TrEMBL
Match: gnl|BL_ORD_ID|20270144 (tr|A0A1S3I399|A0A1S3I399_LINUN EF-hand calcium-binding domain-containing protein 6-like OS=Lingula unguis OX=7574 GN=LOC106160635 PE=4 SV=1)

HSP 1 Score: 514.227 bits (1323), Expect = 4.975e-164
Identity = 320/927 (34.52%), Postives = 504/927 (54.37%), Query Frame = 1
Query:  124 MSRPASVKTAVNKMLAIEHPLSKMAKENTFDNTVNNFLTPADE------GRSLAFEDEQKYKPKKXXXXXXXXXXXXXXXXMDNLNLHGTFLTNIPESIAVVGGDANLTRMPLFGNRSNIQSRNSTTSRHGS----AKEAVKLSLEEISEILQNKLEKNYYEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCEITTSCLNSLFEMWGIKSEKQMLSFNEIYTIFVNKSKEKSETSFFDPVNRHKAKAIVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGI--------ISYPIASLTPN-------VRASNDSFKLNLNASFIEKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTD---RDNKKSSNIDSELNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDT-GNFSSLSFNDIHETSSVLNEADPVT-----------DYNIEEIQSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFMYNKSTASFPNAKLNPPVKGDSDLMQRSRKLNAATDILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKT-PNNKIAYLELLKPFCSHKSQQILENXXXXXXXXXXXXI---DQFNGKDSNSFHFFHKLQAVIQS---AMIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQD 2763
            +SRPA   T   K+  I+HPLS+M+     D  V  F    D       GR LA E+     P++   S      ++   SM  L        +IPE I +  GD + TR+P+FG+R+ + SR    SR  S         +L ++E+  +L+ K +  +YE+RK+F DNDP+ KGNV +EAL RII   +G  ++ +  + L E + + ++K ++SF E + IF + +  +    + DPV+RH  + +    M A      +KEK + R + + DL P S       + K + +N+L K+M  +   E EKLW ++D    G+ID  K +K++GI         + P  S  P         R+          +  IE  LK K REG   +R  F+  D   TG +S  +F+ VL+E  LKLE+ +L EFL+R  I   ++G+ Y+EFL RFQDRSEAG+ HK+L++   R NK  +      + VS +E +++N+FQ DFL +L  F K D+     I  ++F+  +E++ ++  T+ QF  ++D +PL+ + +V Y +F+ QFDT G   SL      +T+       P T           D + E     +T+ +++ ++K    +++ ++E  F ELDE N + L+ EL +QLMK   ++PE++RG+IR +WKTFILN +K LD+ EF RHF YN   ASFPNAKL+PP KGDSD M RSRKLN A D+L D+LRAKID ++ DL +E   +DP     +++++F+EI+ EL +HL+D+E+ ++  KF+T  + +I Y+E LKPF   K      N+     +  + ++   D     +        KL+  +      + R  KK+D  N G++S+ E R++L L  V L E+EV+ +M  +D+N++G I Y   L +
Sbjct:    6 VSRPA---TGFGKLPEIQHPLSRMSNPEKLD--VRGFSRAGDRPASQMNGRPLAAENNY-MSPRRLNTSAGRQSKNQLRHSMPELTHE-----SIPEGIEITHGDPSKTRLPVFGSRAEVASRAEMGSRLASRMSRPGTQARLEIDELEMLLREKSKGGFYELRKRFKDNDPEGKGNVTREALARIIVTFLGRPLSNTQFSRLLERFAL-ADKTVVSFTEFFAIFRDAASSEY-PRWMDPVHRHHQEKVT---MNAAQVHAQLKEKAKQRFLDMADLIPQSNPGGTGRLLKPEFRNALNKMMFFMDDDEFEKLWERYDTEGYGTIDGKKLMKKLGIDLANGTAGKTSPRLSPIPEGGRRSGMARSPRKKEADRQRSLGIENWLKNKFREGCQNMRVAFETYDEKNTGMVSAENFLTVLNEFGLKLEKPHLEEFLARANIELQRQGVKYREFLHRFQDRSEAGMPHKILSNPKHRYNKSRAGSAGGKSTVSALEAQIMNMFQTDFLALLGTFHKIDRMGTDQISQEEFRAAIESRFSLNMTDLQFNNLIDKVPLSEDGSVKYAEFMSQFDTRGKAPSL----FEKTAGEPQMPKPNTKVDRLVVQEPMDIDSEVEYKHRTIPQLQKMIKDLLHNRYAEVESAFYELDESNNQRLSQELFYQLMKKF-IEPEITRGEIRELWKTFILNTRKTLDYLEFVRHFGYNAKDASFPNAKLSPPKKGDSDFMMRSRKLNCAADMLQDSLRAKIDYMWEDLRRELVDMDPYATQFVTIDEFREILTELCVHLSDYELDMLCKKFETKKDGRINYVEFLKPFALKKQVWRHGNNMLSLLQHPAAELPIADIVENPEKGLTGLTAKLRQKLSGDWKNLRRTFKKLDVNNEGYLSVPEFRSVLKLANVVLDEEEVYQVMQKFDENMSGKIPYNKFLSE 911          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. TrEMBL
Match: gnl|BL_ORD_ID|23920022 (tr|K1PYF0|K1PYF0_CRAGI EF-hand calcium-binding domain-containing protein 6 OS=Crassostrea gigas OX=29159 GN=CGI_10014601 PE=4 SV=1)

HSP 1 Score: 511.916 bits (1317), Expect = 1.337e-162
Identity = 317/958 (33.09%), Postives = 515/958 (53.76%), Query Frame = 1
Query:  124 MSRPASVKTAVNKMLA-IEHPLSKMAKENTFD-----NTVNNFLT-PADEGRSLAFEDEQKYKPKKXXXXXXXXXXXXXXXXMDNLNLHGTFLTNIPESIAVVGGDANLTRMPLFGNRSNIQSR-------NSTTSRHGSAKEAVKLSLEEISEILQNKLEKNYYEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCEITTSCLNSLFEMWGIKSEKQMLSFNEIYTIFVNKSKEKSETSFFDPVNRHKA-KAIVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGII------------------------------SYPIASLTPNVRASNDSFKLNLNASFIEKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNID------SELNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFN-----DIHET----SSVLNEADPVTDYNIEEI-----------QSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFMYNKSTASFPNAKLNPPVKGDSDLMQRSRKLNAATDILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTP-NNKIAYLELLKPFCSHKSQQILENXXXXXXXXXXXXI---DQFNGKDSNSFHFFHKLQAVIQS---AMIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQD 2763
            + RPAS+   +   L  IEHPLS+M      D      + +  L+ PA  GR LA  +E  Y  +KS+ +        S   M         + +IPE + V  GD   TR+P+FG+R+++ SR       +  +SR        +L ++EI  +L+ +++ +YYE++KKF DNDP++KGNV +EA  RI+  I+   ++ +  N L +  G K +KQ+++++E +  F     +     + DPV R    KAI    MT++     +KEK R + + + DL P         I K + K  L K+M  +   E EKLW K+D    G+++  +FL  +GI                                 P ++ TP  R      K +L+   IE+ LK K REG   +++ F+ KD   +G +S   F++VL+++ LKLE+  L  FLSRC +   ++G+PY++FL RFQDRSE G+TH +LT+  ++    ++      S+++ +S +E +++N+FQ+DFL +L  F+  DK     I  ++F+  +E++ N    + QF   VD LPL+ +  + Y DF++QFDT   +   F      D+       S +L  + P  D  ++ +           Q  ++  E+  ++K   + +F DIE+ F ELDE N + L+ E+MFQL+K  D++PE+SRG+IR +WKTFI N  K LD+ EF RHF ++K +ASFPNAK+NPP +GD+D M RSRKLN A D+L D+LR+K+D ++ DL KEF  +DP   G IS E+F++++ EL +HL++ EI  ++DKF    + +++Y+E LKPF   K      N+          ++   D              KL+  +      + R  +K+D+ N G++S+ E R++L L  V L EDEV++++  +D N++G I Y+  +++
Sbjct:    6 IPRPASMGQKMGVSLPQIEHPLSRMGNPTNMDIRGVSRSGDRPLSHPA--GRPLA--NENVYSGRKSVSAYGRDSRLGSRQMMQA----PLPIDSIPEGVEVTYGDPAKTRLPVFGSRADVGSRMDNGAPPSRMSSRLSQVSTQARLEIDEIETMLKQRIKGSYYEIKKKFKDNDPEQKGNVSREAFYRILMTILNRNVSQNVFNRLMDRLGFK-DKQIINYSEFFAYFHEAQAQNDYPRWMDPVQRMWPDKAI----MTSSQVHAQLKEKVRQKFLDIADLIPQMNPGGTGRILKPEFKQMLNKLMFYMEDTEFEKLWKKYDPNNSGTVNGAQFLNALGIQMENGGEERQASPQLITGKDAKKVAKKVTLKEGPSSNRTP--RKKEIERKQSLD---IERWLKNKFREGCHQMQEAFEAKDPTNSGVVSFDVFLEVLAQYHLKLEKKLLAAFLSRCAVQARRDGVPYRDFLHRFQDRSEVGMTHNILTNTKHRLVRLVNDRPASPSQVSTMSGIEVQVMNMFQRDFLALLGTFKSIDKLGLNVISQEEFRAAIESRFNFHLQDDQFDAFVDRLPLDEDGNIKYADFMQQFDTKGKAKSLFEKQPGVDLSGPPKVPSPILEVSPPEADEGVDRLVVDEPVFADYAQVRRSPQELFKVIKDLMNRRFQDIERVFYELDEINSERLSQEMMFQLLKRFDIRPEVSRGEIRDLWKTFITNTDKTLDYNEFVRHFGFSKKSASFPNAKMNPPKRGDADFMIRSRKLNCAADMLEDSLRSKVDYMWEDLRKEFVEMDPYGTGFISREEFKDVLTELCVHLSEFEINKLSDKFDLKRDGRVSYIEFLKPFALRKQIWRHGNNMLSLLAHPQPELPIHDIVEPPQKGLHGITSKLRQKLAGDWKNLRRAFRKLDTRNEGYLSVPEFRSVLKLANVILDEDEVYHVLTQFDHNMSGKIPYEKFIEE 945          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Cavefish
Match: si:dkey-256e7.5 (si:dkey-256e7.5 [Source:ZFIN;Acc:ZDB-GENE-090313-282])

HSP 1 Score: 166.392 bits (420), Expect = 3.106e-45
Identity = 92/305 (30.16%), Postives = 169/305 (55.41%), Query Frame = 1
Query: 1870 IKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFMYNKSTASFPNAKLNPPVKGDSDLMQRSRKLNAATDILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTPNNKIAYLELLKPFCSHKSQ--------QILENXXXXXXXXXXXXIDQFNGKDSNSFHFFHKLQAVIQSAMIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQ 2760
            +  +++      + D+ K F ELDE N + LT E M+QL+K   V  E++RG++R +W + +  +   ++F+ F RHF  + ++  +PNAK  PP +GD+DLM+ S+ L+  +DIL+D+LRAK++L   +L  EFT +D    G++S E+F+E++  L + L  +E  ++ +KF   N+ ++Y E L+PF S   +          L +  +      + ++       +N      K +  I+ A     +++D+ + G +S AEL  +L L GV  S +E+ ++++    +  G ++Y+ LLQ
Sbjct:    7 LSKLIRNTVAQHYRDVVKVFEELDEKNTRRLTQEDMYQLLK-FPVLSEITRGEVRHLWSSLLTRQDGTVEFEHFIRHFGPSPTSRRYPNAKRCPPKRGDNDLMRLSKNLSYVSDILVDSLRAKVELSVAELWAEFTSMDMLGTGSVSREEFKEVLTSLCVLLNQYECEVLANKFDLNNDGVSYREFLRPFASQGQEWTNGFNMAAALHSHRETGDSPRNMEVVSLETLSTNIRKRLGKKRRAIRKA----CQRLDASSCGHLSAAELVTVLQLCGVCKSPEELKSVISVLSTDPTGHLDYRPLLQ 306          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004536.1 (pep scaffold:Pmarinus_7.0:GL477109:94389:131012:-1 gene:ENSPMAG00000004110.1 transcript:ENSPMAT00000004536.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.561 bits (314), Expect = 1.850e-29
Identity = 167/809 (20.64%), Postives = 322/809 (39.80%), Query Frame = 1
Query:  529 EEISEILQNKLEKNYYEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCEITTSCLNSLFEMWGIKSEKQMLSFNEIYTIFVNKSKEKSETSFFDPVNRHKAKAIVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLK-FDQTKQGSIDSMKFLKQIGIISYP------------------IASLTPNVR----------ASNDSFKLNLNASFIEKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNIDSELNPVSLVEFKLVNLFQK--DFLEILEN-FRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETS-SVLNEADPVTDYNIEEIQSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLL---DFKEFTRHFMYNKS------TASFPNAK--LNPP---------------VKGDSDLMQRSRKLNAATDILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKT-PNNKIAYLELLKPFC---SHKSQQILENXXXXXXXXXXXXIDQFNGKDSNSFHFFHKLQAVIQS--AMIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQ 2760
            E+    L +KL + Y ++R  F   D DR G V    L R+++ +    +T      L  M G+ +E+  LS+ +    F   ++E  E  + +   R   +   P++M    A  Y+  + R     ++  F D  E+    + K++L+  L++ M+ L   + + LW + +D    G I   +  + + +   P                  +A+L    R          A   +F    N   + + +K K R+ ++     F + D ++ GF++  D   +L EH+  L+     + L +  I      + Y +FL    D    G   +           N    L+P    E  L  L +K    L +L+  F  FDK Q G ++ ++F++VL+N   ++    QF+ ++  L    + TV + DFL+ F   +  +   +   E + + L       D+    + +G  +  ++ ++     ++F  + +     D      LT E   Q++    ++  LS      +W    ++E   L   D++EF + F    +      T+S P A     PP               V+G +    RS  L    + L   LR ++   + ++L+E    DP  +G I   D   +++   + L++ E+  +  KF       +AY   L+        +   +L+    ++              D+      H  + V+ +   M R  + +D   +GF+S  + R +L    ++L+EDE F ++N YD  L+  + Y   L+
Sbjct:  750 EDCHAALPDKLRQVYTDLRSAFNKADGDRDGAVTAGDLRRLLETL-HFSLTDGEFGRLLGMLGL-NERSRLSYGDFLQTFDPPTQE-GEPRWLEAGAR-IMEIKDPSEMACEQAHQYLVSRARKSWKDVSQAFRDYDENGDRVVQKSELRTLLFRYMLPLTSHDFDSLWARRYDPDGHGVISEQELAQLLDVARPPTGVDKGPSARIAEQNQATLATLAEGQRERRCELAGQQARRGAF---YNLEQLAQEIKDKFRDKYSDFGAAFARADRDKDGFVTEDDLRHMLCEHNYSLDREQFEQLLGKLGIPTEGSRLSYADFLRAVDD----GRASRYGVRPSKPCGGNATQRLSP----EGALAFLREKVPSLLAVLQKAFSAFDKSQRGLVKEEEFRRVLDN-FCLKLDGPQFQHLLKRLKRGGDGTVDWQDFLEAFSLLSDKTEGADWQREVARAALAGHRGAGDH---ALSAGGVLRRLRDVVS----ARFYAVARALVCADLPGVGRLTREQFRQVVHRHFLR--LSDKQFEELWAQLPVDECDKLDYRDYREFLKRFCDGTALPAAAFTSSAPPALGIYKPPQSLNTGHRPASVAGSVRGGTARAVRSTPL-VDCEALESRLRERVSRRWQEILRECRLKDPTASGEIGANDLLGVLRTFDVWLSEDELAGLASKFAAHSTGHVAYRAFLRHLVLTLRPRQHGLLQRQRLQQPSFTPGGTAP---NDAFLEAMLHLREQVLPNWRPMRRAFRAVDPSASGFLSAPDFRQVLKQFAINLTEDEFFQILNYYDGQLHNRVPYNAFLR 1529          

HSP 2 Score: 78.1814 bits (191), Expect = 6.540e-15
Identity = 137/712 (19.24%), Postives = 270/712 (37.92%), Query Frame = 1
Query:  523 SLEEISEILQNKLEKNYYEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCEITTSCLNSLFEMWGIKSEKQMLSFNEIYTIFVNKSKEKSETSFFDP---------------VNRHKAKAIVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFS-ITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGIISYP--IASLTPNVRASNDSFKLNLNASFIEKL----------------------LKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNIDSELNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETSSVLNEADPVTDYNIEEIQSGKTVAEIKTIMKQAFDSK-----------FGDIEKRFNELDEYNGKVLTPE----LMFQLMKTLDVKPELSRGDIRSVWKT-------FILNEKKLLDFKEFTRHFMYNKSTASFPNAKLNPPVKGDSDLMQRSRKLNAAT-----------DILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTP--NNKIAYLELLK 2433
            S  E+   L+  + + Y  +++ F+  D +R+G V ++ L R+++               F M      + ML  +  ++ FV+ +        F+P               VN HK   I    +T   A + +++K   R   + + F DS +  A   IT+ +L+  L +    L      KL    +Q     I   +FL ++G+   P   A ++  + + +++ ++   A    +L                      L+  + +  TTL Q F + D    G +S  DF Q+L E  + +E+      L R  +  T   I Y +F+  F DR   G   +LL    N + +    + +        L +  ++ + ++   F K D  ++G++   D +++LE  ++   T+ +F  ++  L LN    + Y DFL+ FD                       P  +     +++G  + EIK   + A +             + D+ + F + DE   +V+       L+F+ M        L+  D  S+W          +++E++L    +  R         S   A+ N          QR R+   A            + L   ++ K    Y+D    F   D + +G ++ +D + ++ E +  L   +   +  K   P   ++++Y + L+
Sbjct:  405 SASEVLARLRKHILECYPSLKEAFLALDINRQGRVTRQELRRLVEGFG------------FRMGDGHFRELMLLLDPGHSGFVDYT---DFLCLFEPRETLDAHKWLNSTHRVNGHKTTDI----LTWKAAEEILRDKLTERWKDVCEAF-DSCDQDADGFITQDNLRAILRRFGPSLSDEHFNKLCTGCEQGPGFRILFSEFLLRLGVDPRPGDFAGVSSRLHSESNAREVKRQADLSARLELIEGEARKLTGALPLREVLVRLRDHVAQRDTTLHQSFARHDRRGEGRVSHFDFRQILQECGMIMEDDQFNALLQR--LGFTNGSITYSDFVACFDDRRIHGPGEQLLLS-PNHRVAEASRQHSRAEDCHAALPDKLRQVYTDLRSAFNKADGDRDGAVTAGDLRRLLET-LHFSLTDGEFGRLLGMLGLNERSRLSYGDFLQTFDP----------------------PTQEGEPRWLEAGARIMEIKDPSEMACEQAHQYLVSRARKSWKDVSQAFRDYDENGDRVVQKSELRTLLFRYMLP------LTSHDFDSLWARRYDPDGHGVISEQELAQLLDVARPPTGVDKGPSARIAEQNQATLATLAEGQRERRCELAGQQARRGAFYNLEQLAQEIKDKFRDKYSDFGAAFARADRDKDGFVTEDDLRHMLCEHNYSLDREQFEQLLGKLGIPTEGSRLSYADFLR 1064          

HSP 3 Score: 66.2402 bits (160), Expect = 2.943e-11
Identity = 116/570 (20.35%), Postives = 218/570 (38.25%), Query Frame = 1
Query: 1120 SLTPNVRASNDSFKLNLNASFIEKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEG-IPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNIDSELNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQF------------DTGNFSSLSFNDIHETSSVLNEADPVTDYNIEEIQSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMK--TLDVKPE-----LSRGDIRSV----WKTFILNEKKLLDFKEFTRHFMYNKSTASFPNAKLNPPVKGDSDLMQRSRKLN---------AATDILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTD---HEIRIVTDKFKTPNNKIAYLELLKPFCSHKSQQILENXXXXXXXXXXXXIDQFNGKDSNSFHFFHKLQAVIQSAMIRNIKKI-------DSGNTGFISIAELRALLLLEGVSLSEDEVFN 2700
            +LTP+V  S    K  L+AS + +L++  + E    L + F+  D  + G +S  +  +VL    L L +   G   S  ++   + G IPY +FL  F  +     T              I+ E       +  L     +D   ++  FR FD   +G ++  + + VLE+      +ESQF  +     +++  TV Y +FL+              DT     L      E +     + P   Y I        +   ++ +++     +G++++ F   D      L  E    +++  TL + PE     L++  I++     W+ F+                      A FPN +      G +  M+ S ++N         +A+++L   LR  I   Y  L + F  LD    G ++ ++ + +++     + D    E+ ++ D   +    + Y + L   C  + ++ L+         +     + NG  +     +   + +++  +    K +       D    GFI+   LRA+L   G SLS DE FN
Sbjct:   48 ALTPSVALSP---KPALSASEVAELVRHGVEERTEQLVRAFRALDPGRAGTVSHGELRRVLDLFVLPLTDPQFGALFS--MVPAGRNGNIPYLQFLEHFLGQPTRPSTASSRQKSTPPAGRGINEE------TDLLLRKKLGRDLKGVVRTFRLFDYNGDGRVQRHELRGVLESH-GARLSESQFSKLWARHDVHQGGTVAYQEFLESLGLSQESQWHPEPDTVQLCMLHARHRWEHTQPSCHSRPYEIYEISVKGYCLNIVSTESAVQRIVCENYGNLQRAFRAFDGSGSGTLAVEDFVSVLRSFTLPLAPEAMLRVLTQLGIKATGKVPWELFL----------------------AKFPNPQ--SIGNGQTLPMRSSHRVNPFRGADESTSASEVLA-RLRKHILECYPSLKEAFLALDINRQGRVTRQELRRLVEGFGFRMGDGHFRELMLLLDPGHS--GFVDYTDFL---CLFEPRETLD------AHKWLNSTHRVNGHKTTDILTWKAAEEILRDKLTERWKDVCEAFDSCDQDADGFITQDNLRAILRRFGPSLS-DEHFN 568          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004547.1 (pep scaffold:Pmarinus_7.0:GL477109:94389:129511:-1 gene:ENSPMAG00000004110.1 transcript:ENSPMAT00000004547.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.168 bits (300), Expect = 9.451e-28
Identity = 163/809 (20.15%), Postives = 319/809 (39.43%), Query Frame = 1
Query:  529 EEISEILQNKLEKNYYEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCEITTSCLNSLFEMWGIKSEKQMLSFNEIYTIFVNKSKEKSETSFFDPVNRHKAKAIVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLK-FDQTKQGSIDSMKF-----LKQIGIISYPIASLTPNVRASNDSFKLNLNASFIEKLL----------KTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNIDSELNPVSLVEFKLVNLFQK--DFLEILEN-FRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETS-SVLNEADPVTDYNIEEIQSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFM--YNKSTASFPNAKLN---PPVKGDSDLMQRSR----------------------KLNAAT------------DILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKT-PNNKIAYLELLKPFC---SHKSQQILENXXXXXXXXXXXXIDQFNGKDSNSFHFFHKLQAVIQS--AMIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQ 2760
            E+    L +KL + Y ++R  F   D DR G V    L R+++ +    +T      L  M G+ +E+  LS+ +    F   ++E  E  + +   R   +   P++M    A  Y+  + R     ++  F D  E+    + K++L+  L++ M+ L   + + LW + +D    G I   +      ++Q          +  NV       +  L    IE++           + K R+ ++     F + D ++ GF++  D   +L EH+  L+     + L +  I      + Y +FL    D    G   +           N    L+P    E  L  L +K    L +L+  F  FDK Q G ++ ++F++VL+N   ++    QF+ ++  L    + TV + DFL+ F   +  +   +   E + + L       D+    + +G  +  ++ ++     ++F  + +     D      LT E   Q++    ++  LS      +W    ++E   LD++++ R F+  +   TA  P A      PP  G + +  R +                       L+  T            + L   LR ++   + ++L+E    DP  +G I   D   +++   + L++ E+  +  KF       +AY   L+        +   +L+    ++              D+      H  + V+ +   M R  + +D   +GF+S  + R +L    ++L+EDE F ++N YD  L+  + Y   L+
Sbjct:  689 EDCHAALPDKLRQVYTDLRSAFNKADGDRDGAVTAGDLRRLLETL-HFSLTDGEFGRLLGMLGL-NERSRLSYGDFLQTFDPPTQE-GEPRWLEAGAR-IMEIKDPSEMACEQAHQYLVSRARKSWKDVSQAFRDYDENGDRVVQKSELRTLLFRYMLPLTSHDFDSLWARRYDPDGHGVISEQELAQLLDVQQSSTCLLQCNGIYCNVMKGCTKKQCPLIMGRIEEMSFSLSLSSSFHRDKFRDKYSDFGAAFARADRDKDGFVTEDDLRHMLCEHNYSLDREQFEQLLGKLGIPTEGSRLSYADFLRAVDD----GRASRYGVRPSKPCGGNATQRLSP----EGALAFLREKVPSLLAVLQKAFSAFDKSQRGLVKEEEFRRVLDN-FCLKLDGPQFQHLLKRLKRGGDGTVDWQDFLEAFSLLSDKTEGADWQREVARAALAGHRGAGDH---ALSAGGVLRRLRDVVS----ARFYAVARALVCADLPGVGRLTREQFRQVVHRHFLR--LSDKQFEELWAQLPVDECDKLDYRDY-REFLKRFCDGTA-LPAAAFTSSAPPDNGATAMKSRPKTTASCLLTRSEHTHGHAQSTHPSLSGGTARAVRSTPLVDCEALESRLRERVSRRWQEILRECRLKDPTASGEIGANDLLGVLRTFDVWLSEDELAGLASKFAAHSTGHVAYRAFLRHLVLTLRPRQHGLLQRQRLQQPSFTPGGTAP---NDAFLEAMLHLREQVLPNWRPMRRAFRAVDPSASGFLSAPDFRQVLKQFAINLTEDEFFQILNYYDGQLHNRVPYNAFLR 1470          

HSP 2 Score: 83.1889 bits (204), Expect = 2.169e-16
Identity = 136/696 (19.54%), Postives = 274/696 (39.37%), Query Frame = 1
Query:  523 SLEEISEILQNKLEKNYYEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCEITTSCLNSLFEMWGIKSEKQMLSFNEIYTIFVNKSK-----EKSET--SFFDPVNRHKAKAIVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFS-ITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGIISYP--IASLTPNVRASNDSFKLNLNASFIEKL----------------------LKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNIDSELNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETSSVLNEADPVTDYNIEEIQSGKTVAEIKTIMKQAFDS-----------KFGDIEKRFNELDEYNGKVLTPE----LMFQLMKTLDVKPELSRGDIRSVWKT-------FILNEK---KLLDFKEFTRHFMYNKSTASFPNAKLNPPVKGDSDLMQRSRKLNAATDILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTP--NNKIAYLELLK 2433
            S  E+   L+  + + Y  +++ F+  D +R+G V ++ L R+++               F M      + ML  +  ++ FV+ +      E  ET       VN HK   I    +T   A + +++K   R   + + F DS +  A   IT+ +L+  L +    L      KL    +Q     I   +FL ++G+   P   A ++  + + +++ ++   A    +L                      L+  + +  TTL Q F + D    G +S  DF Q+L E  + +E+      L R  +  T   I Y +F+  F DR   G   +LL    N + +    + +        L +  ++ + ++   F K D  ++G++   D +++LE  ++   T+ +F  ++  L LN    + Y DFL+ FD                       P  +     +++G  + EIK   + A +             + D+ + F + DE   +V+       L+F+ M        L+  D  S+W          +++E+   +LLD ++ +   +  +    + N       K    +M R  +++ +  +     R K    Y+D    F   D + +G ++ +D + ++ E +  L   +   +  K   P   ++++Y + L+
Sbjct:  349 SASEVLARLRKHILECYPSLKEAFLALDINRQGRVTRQELRRLVEGFG------------FRMGDGHFRELMLLLDPGHSGFVDYTDFLCLFEPRETLVGLTHRVNGHKTTDI----LTWKAAEEILRDKLTERWKDVCEAF-DSCDQDADGFITQDNLRAILRRFGPSLSDEHFNKLCTGCEQGPGFRILFSEFLLRLGVDPRPGDFAGVSSRLHSESNAREVKRQADLSARLELIEGEARKLTGALPLREVLVRLRDHVAQRDTTLHQSFARHDRRGEGRVSHFDFRQILQECGMIMEDDQFNALLQR--LGFTNGSITYSDFVACFDDRRIHGPGEQLLLS-PNHRVAEASRQHSRAEDCHAALPDKLRQVYTDLRSAFNKADGDRDGAVTAGDLRRLLET-LHFSLTDGEFGRLLGMLGLNERSRLSYGDFLQTFDP----------------------PTQEGEPRWLEAGARIMEIKDPSEMACEQAHQYLVSRARKSWKDVSQAFRDYDENGDRVVQKSELRTLLFRYMLP------LTSHDFDSLWARRYDPDGHGVISEQELAQLLDVQQSSTCLL--QCNGIYCNVMKGCTKKQCPLIMGRIEEMSFSLSLSSSFHRDKFRDKYSDFGAAFARADRDKDGFVTEDDLRHMLCEHNYSLDREQFEQLLGKLGIPTEGSRLSYADFLR 993          

HSP 3 Score: 54.299 bits (129), Expect = 1.681e-7
Identity = 113/564 (20.04%), Postives = 211/564 (37.41%), Query Frame = 1
Query: 1168 LNASFIEKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCII-TPTKEG--IPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNIDSELNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQF------------DTGNFSSLSFNDIHETSSVLNEADPVTDYNIEEIQSG--------KTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMK--TLDVKPE-----LSRGDIRSV----WKTFILNEKKLLDFKEFTRHFMYNKSTASFPNAKLNPPVKGDSDLMQRSRKLN---------AATDILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTD---HEIRIVTDKFKTPNNKIAYLELLKPFCSHKSQQILENXXXXXXXXXXXXIDQFNGKDSNSFHFFHKLQAVIQSAMIRNIKKI-------DSGNTGFISIAELRALLLLEGVSLSEDEVFN 2700
            L+AS + +L++  + E    L + F+  D  + G +S  +  +VL    L L +   G     C+I  P      IPY +FL  F  +     T              I+ E       +  L     +D   ++  FR FD   +G ++  + + VLE+      +ESQF  +     +++  TV Y +FL+              DT     L      E +   N    V D+    +QS          ++ +  T+++      +G++++ F   D      L  E    +++  TL + PE     L++  I++     W+ F+                      A FPN +      G +  M+ S ++N         +A+++L   LR  I   Y  L + F  LD    G ++ ++ + +++     + D    E+ ++ D    P +   +++     C  + ++ L                + NG  +     +   + +++  +    K +       D    GFI+   LRA+L   G SLS DE FN
Sbjct:    3 LSASEVAELVRHGVEERTEQLVRAFRALDPGRAGTVSHGELRRVLDLFVLPLTDPQFGA----CVIQVPAGRNGNIPYLQFLEHFLGQPTRPSTASSRQKSTPPAGRGINEE------TDLLLRKKLGRDLKGVVRTFRLFDYNGDGRVQRHELRGVLESH-GARLSESQFSKLWARHDVHQGGTVAYQEFLESLGLSQESQWHPEPDTVQLCMLHARHRWEHTQPFN----VKDHTRLGLQSSISIKKQHKVSIHQNSTVLQVC--ENYGNLQRAFRAFDGSGSGTLAVEDFVSVLRSFTLPLAPEAMLRVLTQLGIKATGKVPWELFL----------------------AKFPNPQ--SIGNGQTLPMRSSHRVNPFRGADESTSASEVLA-RLRKHILECYPSLKEAFLALDINRQGRVTRQELRRLVEGFGFRMGDGHFRELMLLLD----PGHS-GFVDYTDFLCLFEPRETLVGL-----------THRVNGHKTTDILTWKAAEEILRDKLTERWKDVCEAFDSCDQDADGFITQDNLRAILRRFGPSLS-DEHFN 507          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004557.1 (pep scaffold:Pmarinus_7.0:GL477109:94389:108111:-1 gene:ENSPMAG00000004110.1 transcript:ENSPMAT00000004557.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.523 bits (249), Expect = 5.209e-22
Identity = 132/665 (19.85%), Postives = 260/665 (39.10%), Query Frame = 1
Query:  958 ITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKF-----LKQIGIISYPIASLTPNVRASNDSFKLNLNASFIEKLL----------KTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNIDSELNPVSLVEF---KLVNLFQKDFLEILEN-FRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETS-SVLNEADPVTDYNIEEIQSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLL---DFKEFTRHFM-----------------------YNKSTA---SFPNAKLN---------PPVKGDSDLMQRSRKLNAATDILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKT-PNNKIAYLELLKPFC---SHKSQQILENXXXXXXXXXXXXIDQFNGKDSNSFHFFHKLQAVIQS--AMIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQ 2760
            + K++L+  L++ M+ L   + + LW ++D    G I   +      ++Q          +  NV       +  L    IE++           + K R+ ++     F + D ++ GF++  D   +L EH+  L+     + L +  I      + Y +FL    D    G   +           N    L+P   + F   K+ +L     L +L+  F  FDK Q G ++ ++F++VL+N   ++    QF+ ++  L    + TV + DFL+ F   +  +   +   E + + L       D+    + +G  +  ++ ++     ++F  + +     D      LT E   Q++    ++  LS      +W    ++E   L   D++EF + F                        + +ST    SFP   LN           V+G +    RS  L    + L   LR ++   + ++L+E    DP  +G I   D   +++   + L++ E+  +  KF       +AY   L+        +   +L+    ++              D+      H  + V+ +   M R  + +D   +GF+S  + R +L    ++L+EDE F ++N YD  L+  + Y   L+
Sbjct:   12 VQKSELRTLLFRYMLPLTSHDFDSLWARYDPDGHGVISEQELAQLLDVQQSSTCLLQCNGIYCNVMKGCTKKQCPLIMGRIEEMSFSLSLSSSFHRDKFRDKYSDFGAAFARADRDKDGFVTEDDLRHMLCEHNYSLDREQFEQLLGKLGIPTEGSRLSYADFLRAVDD----GRASRYGVRPSKPCGGNATQRLSPEGALAFLREKVPSL-----LAVLQKAFSAFDKSQRGLVKEEEFRRVLDN-FCLKLDGPQFQHLLKRLKRGGDGTVDWQDFLEAFSLLSDKTEGADWQREVARAALAGHRGAGDH---ALSAGGVLRRLRDVVS----ARFYAVARALVCADLPGVGRLTREQFRQVVHRHFLR--LSDKQFEELWAQLPVDECDKLDYRDYREFLKRFCDGTALPAAAFTSSAPPGIEHTHGHAQSTHPSLSFPPQSLNTGHRPASVAGSVRGGTARAVRSTPL-VDCEALESRLRERVSRRWQEILRECRLKDPTASGEIGANDLLGVLRTFDVWLSEDELAGLASKFAAHSTGHVAYRAFLRHLVLTLRPRQHGLLQRQRLQQPSFTPGGTAP---NDAFLEAMLHLREQVLPNWRPMRRAFRAVDPSASGFLSAPDFRQVLKQFAINLTEDEFFQILNYYDGQLHNRVPYNAFLR 653          

HSP 2 Score: 63.5438 bits (153), Expect = 1.539e-10
Identity = 110/572 (19.23%), Postives = 228/572 (39.86%), Query Frame = 1
Query:  883 KEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGS-IDSMKFLKQI--GIIS-YPIASLTPNVRASNDSFKLNLNASFIEKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEG-IPYKEFLIRFQ---DRSEAGITHKLLTDRDNKKSSNIDSELNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLD---FLKQFDTGN------FSSLSFNDIHETSSVLNEADPVTDYNIEEIQSGKTVAEIKTIMK---------------QAFDSKFGD-IEKRFNEL--------DEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFMYNKSTASFPNAKLNPPVKGDSDLMQRSR--------KLNAATDILMD---NLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTP-NNKIAYLELLKPF 2439
            ++KFR +       F  +   +   +T+ DL++ L +    L   + E+L  K     +GS +    FL+ +  G  S Y +    P     N + +L+   +     L+ K+      L++ F   D +Q G +   +F +VL    LKL+       L R  +    +G + +++FL  F    D++E     + +                    V  +L ++    F  +       D    G +  + F++V+     +  ++ QF+ +   LP++    + Y D   FLK+F  G       F+S +   I  T        P   +  + + +G   A +   ++               +A +S+  + + +R+ E+           +G++   +L+  +++T DV   LS  ++  +   F  +    + ++ F RH +            L P   G   L+QR R           A  D  ++   +LR ++   +  + + F  +DP  +G +S  DF++++K+ +I+LT+ E   + + +    +N++ Y   L+ F
Sbjct:  107 RDKFRDKYSDFGAAFARADRDKDGFVTEDDLRHMLCEHNYSLDREQFEQLLGKLGIPTEGSRLSYADFLRAVDDGRASRYGVRPSKPC--GGNATQRLSPEGALA--FLREKVPSLLAVLQKAFSAFDKSQRGLVKEEEFRRVLDNFCLKLDGPQFQHLLKR--LKRGGDGTVDWQDFLEAFSLLSDKTEGADWQREVARAALAGHRGAGDHALSAGGVLRRLRDVVSARFYAVARALVCADLPGVGRLTREQFRQVVHRHF-LRLSDKQFEELWAQLPVDECDKLDYRDYREFLKRFCDGTALPAAAFTSSAPPGIEHTHGHAQSTHPSLSFPPQSLNTGHRPASVAGSVRGGTARAVRSTPLVDCEALESRLRERVSRRWQEILRECRLKDPTASGEIGANDLL-GVLRTFDV--WLSEDELAGLASKFAAHSTGHVAYRAFLRHLVLT----------LRPRQHG---LLQRQRLQQPSFTPGGTAPNDAFLEAMLHLREQVLPNWRPMRRAFRAVDPSASGFLSAPDFRQVLKQFAINLTEDEFFQILNYYDGQLHNRVPYNAFLRTF 655          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Nematostella
Match: EDO46548 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPQ2])

HSP 1 Score: 418.698 bits (1075), Expect = 1.240e-131
Identity = 284/921 (30.84%), Postives = 487/921 (52.88%), Query Frame = 1
Query:  148 TAVNKMLAIEHPLSKMAKENTFDNTVNNFLTPADEGRSLAFEDEQKYKP----KKXXXXXXXXXXXXXXXXMDNLNLHGTFLTNIPESIAVVGG-DANLTRMPLFGNRSNIQSR-NSTTSR----HGSAKEAVKLSLEEISEILQNKLEKNYYEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCEITTSCLNSLFEMWGIKSEKQMLSFNEIYTIFVNKSKEKSETSFFD---PVNRHKAKAIVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGIISYP--IASLTPNVRASNDSFKLNLNASFIEKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLE-ESNLGEFLSRCIITPTKEG-IPYKEFLIRFQDRSEAGITHKLLTDRDNK-KSSNIDSELNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETSSVLNEADPVTDYNIEEI----------------------QSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFMYNKSTASFPNAKLNPPVKGDSDLMQRSRKLNAATDILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTPN-NKIAYLELLKPFCSHKSQQILENXXXXXXXXXXX-XIDQFNGKDSNSFH-FFHKLQAVIQSA---MIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQDLQS 2772
             A   + AI+HPLS+M      +    +   P    R      E K +P    +       SS      +  D+LNL      NIPE I V    D +   +P+FG+R+++ SR  S  SR      S++   K S++E   +L+ K++  Y+ ++  F   DP+ KG V +E+L +I+   VG  I+ S  N L     +   K+M++++E Y  F    K     ++ +   P  R          MTA+    ++KEK + R + + +L P      +  I + +L+N L ++   +   E EKLWLK+D    G+I + K + ++GI   P     +  + R      K+ L+   IE+ LK K REGF+ ++  F + D ++TG +   DF +VL+E DLKL  +  + +FL+RC +T T +  +PYKEFL RFQDRS+ G+ HK+L ++ ++   S+  S+ +  S VE +L++LFQ+DFL +L  F   D+   G +  + F+  +E +  +  ++ +++  +  +P+N +  V Y++F+ +FDT  F   + N + + SSVL   +P+     +E                       Q G++  E+K ++K    + F D E+ F +LDE N K LTPE+M +L+K  DV  +++R +I+ +W TFI +++  L++ +F RHF Y+  +A+FPNAK++PP +GD+D M RS KLN+  D+L D L++K+D  ++ L  EF   DP N G +S E F+EI+++L I LTD+E+  VT+KF   N N+++Y++ L+P+   + +    N         ++  +D    K +        KL+  +      + +  +K+D  N G++SI E R++L L    L EDE+++L++  D  ++G++NY+  L  + S
Sbjct:    2 AATTNLPAIQHPLSRMGNPANLNVRGTSRDGPRVASRQSLNLGESKLRPITADQMPWRLTKSSNGHNQRSPRDDLNL-----GNIPEGIEVRRAEDPSKPTIPIFGDRADMASRVESRMSRLSSAAASSRGPDKASVDEFEYLLREKMKTGYFTIKNLFKQRDPENKGIVSRESLSQILTTFVGKPISLSQFNKLMVRLNL-DHKKMIAYDEFYAAFRPPKKADEGPAWLELEKPNMR---------TMTASQVHAHLKEKAKQRFLDVAELIPQMNPGGSGRILRPELRNVLNQMGFYMDDDEFEKLWLKYDTENVGTIRAEKLMGKLGISIKPGSTGDMPRSPRKLEVERKVQLD---IERWLKRKFREGFSDMKHAFMELDLDRTGRVRKDDFRKVLAEFDLKLSTDKQVEDFLARCGVTLTSDDLVPYKEFLRRFQDRSQDGMPHKILANQLHRYHHSDQGSQFSTTSAVEARLMDLFQRDFLALLGTFHNIDRKDCGLLTQQQFRAAIEGRFELGMSDEEYEDFLTRVPINNDGMVKYVEFMSKFDT-TFDRDN-NSLFDRSSVLGAPEPMPPIREKESPPGSPRKHRRPRPVKTVDSYDSQDGRSAEELKRVIKNVLVNNFQDFEQAFYDLDELNSKRLTPEMMRKLLKKFDV--DVNRNEIKKLWDTFITDQRGHLEYLQFVRHFGYSIGSAAFPNAKVSPPKRGDNDFMMRSNKLNSDVDMLFDQLKSKVDFHWDRLRGEFAAADPNNAGFVSREAFKEILQDLCIELTDYELSYVTNKFDPKNENRVSYVKFLEPYAKRRRRYFSNNMGTVMNHPQAELPMDDIVPKPNKGLSGITAKLRQKLSGEWKNLRKAFRKLDLQNDGYLSIPEFRSVLRLCNTVLEEDEIYHLLSELDSGMSGNVNYREFLTKVSS 900          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Nematostella
Match: EDO36810 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHJ6])

HSP 1 Score: 142.124 bits (357), Expect = 2.535e-35
Identity = 120/499 (24.05%), Postives = 224/499 (44.89%), Query Frame = 1
Query:  442 LFGNRSNIQSRNSTTSRHGSAKEAV-KLSLEEISEILQNKLEKNYYEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCEITTSCLNSLFEMWGIKSEKQMLSFNEIYTIFVNKSKEKSETSFFDPVNR------------------------------HKAKAIVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGIIS----------YPIA---------SLTPNVRASNDSFKLNLNASF---------IEKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNIDSELNPVSLV--EFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVI---VDNLPLNRNQTVPYLDFLKQFD 1746
              G +   Q +N   +  GS+ +++ + ++EE+ E++++KL   ++ VR+ F  NDP  +G+V +EA   I+  + G  ++ S ++SL +  G++S    +SF++  + F  +  E  +  + DPV R                                 +  +P   TA   F  +K K +          PDS       + K  L+ +L+ + I +   E +K+W + D++  G++DS  F   +G+             PI          S+ P   A  DS K  +  +          I  +L  K +EG+  + + F + D   TG +S  +  QVL+ + L L    +  FLSR       E +PY++ L   QDR++ G+  K++ D  ++ + + DS++   + V  E +L++L   DFL +L  F+  D+   G ++   FK++LE +  +   + Q   I   + + P   +  VPY  FL++F+
Sbjct:   14 FIGPKQRGQEKNLGRTDGGSSTQSLTRRTVEELEELIKDKLTTGFFGVRQAFRANDPRGRGSVSREAFTTILYHLCG-YVSPSLVSSLLQRIGVESPSS-ISFDDFISHF--RDNEVVQKEWLDPVLRPVRQGAHLPANQLRDSQRERSNVEQHEKRKQGLRKTLPVFYTALQVFPLLKRKAQGGLGEFARFLPDSCFDVDGMVLKPQLRQALFLMDIHMYDDEFDKVWDRIDRSGLGTVDSRTFFLTLGLGGNEGKEKQHQKSPIKEQVLEDKPDSVQPASCAKQDSPKTVIPVTVDECQEEKEDIMAVLSNKFKEGYNGIVEMFSRYDPENTGKVSKHELRQVLASYRLTLGPIEVEHFLSR-FGCRHDEMVPYRKILDMCQDRTDKGLLQKIMEDPKHRFNKSRDSQIGTTTAVDAEARLLDLLHSDFLSLLGAFKSLDRENMGVVKKYQFKELLEARFGIRLNKEQLAAIRLRIGDDPA--SGLVPYPRFLEEFN 505          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Nematostella
Match: EDO28675 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5T7])

HSP 1 Score: 119.398 bits (298), Expect = 1.174e-27
Identity = 64/176 (36.36%), Postives = 111/176 (63.07%), Query Frame = 1
Query: 1183 IEKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLE-ESNLGEFLSRCIITPTKEG-IPYKEFLIRFQDRSEAGITHKLLTDRDNK-KSSNIDSELNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLN 1701
            IE+ LK K REGF+ ++  F + D ++TG +   DF +VL+E DLKL  +  + +FL+RC +T T +  +PYKEFL RFQDRS+ G+ HK+L ++ ++   S+  S+ +  S VE +L++LFQ+DFL +L  F   D+   G +  + F+  +E +  +  ++ +++  +  +P+N
Sbjct:  472 IERWLKRKFREGFSDMKHAFMELDLDRTGRVRKDDFRKVLAEFDLKLSTDKQVEDFLARCGVTLTSDDLVPYKEFLRRFQDRSQDGMPHKILANQLHRYHHSDQGSQFSTTSAVEARLMDLFQRDFLALLGTFHNIDRKDCGLLTQQQFRAAIEGRFELGMSDEEYEDFLTRVPIN 647          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Nematostella
Match: EDO28210 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T743])

HSP 1 Score: 85.1149 bits (209), Expect = 2.675e-17
Identity = 85/356 (23.88%), Postives = 158/356 (44.38%), Query Frame = 1
Query:  772 NKSKEKSETSFFDPVN--RHKAKAIVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQG-SIDSMKFLKQIGIISYP-------------------IASLTPNVR-----ASNDSFKLNLNASFIEKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNIDSELNPVSLVEFKLVNLFQK---DFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNL-PLNRNQTVPYLDFLKQFD 1746
            N++K   E SF D     R K    + A + A   FDY ++                       I + +L+  +      L   + ++LW K+D T+ G ++D M FLK++G+ ++P                   +  L  N R     +S D     +    +E+ L+ K+ E F  +++ F   D    GF+++    ++L+     + +S   + + RC I  + + I Y++FL +FQD   +G    +    ++K +   ++E  P +   +K   LF K    F  + + F  FD  ++G I  +DF+++LE+      TE QF  ++  + P+NR   + YL+FL +F+
Sbjct:    2 NQTKSPKEQSFADIEQQLRTKIAGQLQAVLKAIRLFDYNRDG---------------------QIQRHELRRVVENFCFRLTNEQFDRLWCKYDLTRNGHTLDYMDFLKRLGVNTHPKRRPSTANRLNQGNGTENKVKFLATNKRPLSGSSSRDGSPAVMTVKDLERKLRAKMVENFENIQRAFVAFDRRCDGFVTLDQLKRILTHFVFPMSDSLFEDLMRRCGIRASHK-IGYEQFLEKFQDPRVSGNGQTIPIKPNHKFNPVREAEDMPTTEDIWKF--LFSKVTDSFTSVKQAFLVFDDNKDGRITRRDFRRILES-FCFRMTEEQFHELMAKIDPMNRG-YISYLEFLDRFE 331          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Nematostella
Match: EDO46549 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPQ2])

HSP 1 Score: 69.707 bits (169), Expect = 2.541e-13
Identity = 62/217 (28.57%), Postives = 101/217 (46.54%), Query Frame = 1
Query:  148 TAVNKMLAIEHPLSKMAKENTFDNTVNNFLTPADEGRSLAFEDEQKYKP----KKXXXXXXXXXXXXXXXXMDNLNLHGTFLTNIPESIAVVGG-DANLTRMPLFGNRSNIQSR-NSTTSR----HGSAKEAVKLSLEEISEILQNKLEKNYYEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCEITTSCLNSLFEMWGIKSEKQMLSFNEIYTIF 768
             A   + AI+HPLS+M      +    +   P    R      E K +P    +       SS      +  D+LN     L NIPE I V    D +   +P+FG+R+++ SR  S  SR      S++   K S++E   +L+ K++  Y+ ++  F   DP+ KG V +E+L +I+   VG  I+ S  N L     +   K+M++++E Y  F
Sbjct:    2 AATTNLPAIQHPLSRMGNPANLNVRGTSRDGPRVASRQSLNLGESKLRPITADQMPWRLTKSSNGHNQRSPRDDLN-----LGNIPEGIEVRRAEDPSKPTIPIFGSRADMASRVESRMSRLSSAAASSRGPDKASVDEFEYLLREKMKTGYFTIKNLFKQRDPENKGIVSRESLSQILTTFVGKPISLSQFNKLMVRLNL-DHKKMIAYDEFYAAF 212          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Planmine SMEST
Match: SMESG000009107.1 (SMESG000009107.1)

HSP 1 Score: 1731.84 bits (4484), Expect = 0.000e+0
Identity = 882/885 (99.66%), Postives = 884/885 (99.89%), Query Frame = 1
Query:  124 MSRPASVKTAVNKMLAIEHPLSKMAKENTFDNTVNNFLTPADEGRSLAFEDEQKYKPKKXXXXXXXXXXXXXXXXMDNLNLHGTFLTNIPESIAVVGGDANLTRMPLFGNRSNIQSRNSTTSRHGSAKEAVKLSLEEISEILQNKLEKNYYEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCEITTSCLNSLFEMWGIKSEKQMLSFNEIYTIFVNKSKEKSETSFFDPVNRHKAKAIVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGIISYPIASLTPNVRASNDSFKLNLNASFIEKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNIDSELNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETSSVLNEADPVTDYNIEEIQSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFMYNKSTASFPNAKLNPPVKGDSDLMQRSRKLNAATDILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTPNNKIAYLELLKPFCSHKSQQILENXXXXXXXXXXXXIDQFNGKDSNSFHFFHKLQAVIQSAMIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQDLQSKF 2778
            MSRPASVKTAVNKMLAIEHPLSKMAKENTFDNTVNNFLTPADEGRSLAFEDEQKYKPKKSMGSRSSSRVSRSDTSMDNLNLHGTFLTNIPESIAVVGGDANLTRMPLFGNRSNIQSRNSTTSRHGSAKEAVKLSLEEISEILQ+KLEKNYYEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCEITTSCLNSLFEMWGIKSEKQMLSFNEIYTIFVNKSKEKSETSFFDPVNRHKAKAIVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGIISYPIASLTPNVRASNDSFKLNLNASFIEKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNIDS+LNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETSSVLNEA PVTDYNIEEIQSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFMYNKSTASFPNAKLNPPVKGDSDLMQRSRKLNAATDILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTPNNKIAYLELLKPFCSHKSQQILENSSDKKKKLYSKKIDQFNGKDSNSFHFFHKLQAVIQSAMIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQDLQSKF
Sbjct:    1 MSRPASVKTAVNKMLAIEHPLSKMAKENTFDNTVNNFLTPADEGRSLAFEDEQKYKPKKSMGSRSSSRVSRSDTSMDNLNLHGTFLTNIPESIAVVGGDANLTRMPLFGNRSNIQSRNSTTSRHGSAKEAVKLSLEEISEILQSKLEKNYYEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCEITTSCLNSLFEMWGIKSEKQMLSFNEIYTIFVNKSKEKSETSFFDPVNRHKAKAIVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGIISYPIASLTPNVRASNDSFKLNLNASFIEKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNIDSDLNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETSSVLNEAVPVTDYNIEEIQSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFMYNKSTASFPNAKLNPPVKGDSDLMQRSRKLNAATDILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTPNNKIAYLELLKPFCSHKSQQILENSSDKKKKLYSKKIDQFNGKDSNSFHFFHKLQAVIQSAMIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQDLQSKF 885          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Planmine SMEST
Match: SMESG000009107.1 (SMESG000009107.1)

HSP 1 Score: 1704.88 bits (4414), Expect = 0.000e+0
Identity = 869/872 (99.66%), Postives = 871/872 (99.89%), Query Frame = 1
Query:  163 MLAIEHPLSKMAKENTFDNTVNNFLTPADEGRSLAFEDEQKYKPKKXXXXXXXXXXXXXXXXMDNLNLHGTFLTNIPESIAVVGGDANLTRMPLFGNRSNIQSRNSTTSRHGSAKEAVKLSLEEISEILQNKLEKNYYEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCEITTSCLNSLFEMWGIKSEKQMLSFNEIYTIFVNKSKEKSETSFFDPVNRHKAKAIVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGIISYPIASLTPNVRASNDSFKLNLNASFIEKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNIDSELNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETSSVLNEADPVTDYNIEEIQSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFMYNKSTASFPNAKLNPPVKGDSDLMQRSRKLNAATDILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTPNNKIAYLELLKPFCSHKSQQILENXXXXXXXXXXXXIDQFNGKDSNSFHFFHKLQAVIQSAMIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQDLQSKF 2778
            MLAIEHPLSKMAKENTFDNTVNNFLTPADEGRSLAFEDEQKYKPKKSMGSRSSSRVSRSDTSMDNLNLHGTFLTNIPESIAVVGGDANLTRMPLFGNRSNIQSRNSTTSRHGSAKEAVKLSLEEISEILQ+KLEKNYYEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCEITTSCLNSLFEMWGIKSEKQMLSFNEIYTIFVNKSKEKSETSFFDPVNRHKAKAIVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGIISYPIASLTPNVRASNDSFKLNLNASFIEKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNIDS+LNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETSSVLNEA PVTDYNIEEIQSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFMYNKSTASFPNAKLNPPVKGDSDLMQRSRKLNAATDILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTPNNKIAYLELLKPFCSHKSQQILENSSDKKKKLYSKKIDQFNGKDSNSFHFFHKLQAVIQSAMIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQDLQSKF
Sbjct:    1 MLAIEHPLSKMAKENTFDNTVNNFLTPADEGRSLAFEDEQKYKPKKSMGSRSSSRVSRSDTSMDNLNLHGTFLTNIPESIAVVGGDANLTRMPLFGNRSNIQSRNSTTSRHGSAKEAVKLSLEEISEILQSKLEKNYYEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCEITTSCLNSLFEMWGIKSEKQMLSFNEIYTIFVNKSKEKSETSFFDPVNRHKAKAIVPAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGIISYPIASLTPNVRASNDSFKLNLNASFIEKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKKSSNIDSDLNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSFNDIHETSSVLNEAVPVTDYNIEEIQSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKLLDFKEFTRHFMYNKSTASFPNAKLNPPVKGDSDLMQRSRKLNAATDILMDNLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTPNNKIAYLELLKPFCSHKSQQILENSSDKKKKLYSKKIDQFNGKDSNSFHFFHKLQAVIQSAMIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNSYDKNLNGSINYKMLLQDLQSKF 872          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Planmine SMEST
Match: SMESG000058629.1 (SMESG000058629.1)

HSP 1 Score: 60.8474 bits (146), Expect = 5.317e-9
Identity = 115/610 (18.85%), Postives = 244/610 (40.00%), Query Frame = 1
Query: 1096 GIISYP---IASLTPNVRASNDSFKLNLNASFIEKLLKTK----------------LREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKLEESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTD--RDNKKSSNIDSELNPVSL--VEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFKKVLENQMNVEFTESQFKVIVDNL----PLNR------NQTVPYLDFLKQFD--TGNFSSLSFNDIHETSSVLNEADPVTDYNIEEIQSGKTVAEIKTIMKQAFDSKFGDIEKRFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEK-KLLDFKEFTRHFMYN-------------KSTASFPNAKLNPPVK-----GDSDLMQRS-RKLNAA---TDILMDN---------LRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIRIVTDKFKTP-NNKIAYLELLKPFCSHKSQQILENXXXXXXXXXXXXIDQFNGKDSNSFHFFHKLQAVI---QSAMIRNIKKIDSGNTGFISIAELRALLLLEGVSLSEDEVFNLMNS 2712
            G +S+P   I    P     +D ++      F++ L K +                  E F  L   F+  DT  +GF+S+   +++LSE+   +E  NL +FL++        G+ YK  L   Q +      +K+++   +   +S+ + S L  +S+  +E ++     KDF+       K     N   E  + +K++EN +    T+ Q+K +        PL+       N+ + +  FL +F   TG       +D+ +     N    V ++        +  A +  ++      +F  I+K++          LT  ++F+L+ +   K  L+  ++  +W     +     L +++  +H M N              +TA  PN ++    K       S L+    +K+  A    D ++D+         +   +  ++  + K+   +D      I   + +E++ +    LT  E+  +   F    N +  Y+E L  F   +  +          ++  + +++  G        + +++  +     ++IR  +KID+  TG I  ++L  +LL  G+ LS+D+++++ + 
Sbjct:  322 GGVSFPLIRIPKWKPKGPGGSDEYEFGKGIQFVKGLQKLRDNRPEFSQIMDRLSYIFEEPFQALFTVFRHYDTKNSGFVSLDTGLKILSEYGFVIEIENLIKFLNKINCLDLNSGMNYKRMLTDIQTKGPGTCVNKVISQIIKAESQSTGLKS-LRTMSVDEIEQEVYKTLHKDFMSFQSQLEKASATSNLICE-NEARKIIENIIGHSMTKEQWKELQFQFDYCQPLSGKEEKDVNRLIDFRKFLNKFSKPTGICRYRFKSDLDKPIDWSNRNKKVKEF----YDPPRHHAYLCRMVADVLKFRFHAIDKQYKSFPIKEQGTLTKPILFELLNS--QKCSLTLQEMEIIWAVVESHPHYSSLHYRQVLKHLMMNLYKRAEEINIENRVTTAEDPNIEVLKEFKKTHKDDKSQLLDYCDKKIFMALLKKDFVVDSEKLQKTVEKMSPVLGSMWVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHEFLKFRPDEGTAKPVLHFDRVRHQLLNEKTGGKLTVVKAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSG 923          

HSP 2 Score: 56.225 bits (134), Expect = 1.155e-7
Identity = 58/256 (22.66%), Postives = 110/256 (42.97%), Query Frame = 1
Query:  463 IQSRNSTTSRHGSAKEAVKLSLEEISEILQNKLEKNYYEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCE-ITTSCLNSLFEMWGIKSEKQMLSFNEIYTIFVNKSKEKSETSFFDPVNRHKAKAIV-----PAKMTATDAFDYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEMEKLWLKFDQTKQGSIDSMKFLKQIGII--SYPIASLTPNVRASNDSFKLNLNASFIEKLLKTK 1206
            I S+  T   HG      +++++EI  I++ K     + +++ F   D  + G V KEALM+I   I  C+ +       L E + + +EK +++F+++  +F              P  ++ A  I      P  ++A      ++E    ++  L  L P+S   +   I  A  + +L K+ I L   +  +LW KFD    GS+   + L  + +     P+  + P          + L    IE++++TK
Sbjct:   71 IFSKKITPRAHGD-----RMTVDEIDLIIREKFINERFSIQELFKVADEHKNGFVTKEALMKIFYTI--CDGLKVDHFYKLLERYKL-NEKPVIAFSDVEKVFG-----------LPPTGKYPAPQIFHGMGHPYNVSAGFGLQLLREAALDKDFDLKALLPESCFEEGGVILMAQFREALKKLKITLCAEDFIRLWRKFDIKGVGSVSQRQLLWILNLQDNGKPMCGIRPTF--------IPLKRPKIERVVRTK 299          
The following BLAST results are available for this feature:
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
EFCAB62.309e-2622.08EF-hand calcium binding domain 6 [Source:HGNC Symb... [more]
EFCAB62.787e-2622.08EF-hand calcium binding domain 6 [Source:HGNC Symb... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:dkey-256e7.53.078e-4333.22si:dkey-256e7.5 [Source:ZFIN;Acc:ZDB-GENE-090313-2... [more]
si:dkey-256e7.51.764e-2140.60si:dkey-256e7.5 [Source:ZFIN;Acc:ZDB-GENE-090313-2... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
immp2l2.851e-3121.99inner mitochondrial membrane peptidase subunit 2 [... [more]
immp2l3.877e-3121.99inner mitochondrial membrane peptidase subunit 2 [... [more]
immp2l8.036e-2222.34inner mitochondrial membrane peptidase subunit 2 [... [more]
ENSXETT00000007484.13.736e-841.51pep primary_assembly:Xenopus_tropicalis_v9.1:1:354... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Efcab61.884e-1820.50EF-hand calcium binding domain 6 [Source:MGI Symbo... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q4R8T1|EFCB6_MACFA7.592e-2722.36EF-hand calcium-binding domain-containing protein ... [more]
sp|Q5THR3|EFCB6_HUMAN1.109e-2522.08EF-hand calcium-binding domain-containing protein ... [more]
sp|Q6P1E8|EFCB6_MOUSE1.318e-1720.50EF-hand calcium-binding domain-containing protein ... [more]
sp|Q5RE62|EFCB6_PONAB6.216e-1123.69EF-hand calcium-binding domain-containing protein ... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|181980149.958e-16934.37tr|A0A267DVA3|A0A267DVA3_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182707814.577e-16633.87tr|A0A267GEM4|A0A267GEM4_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|238464461.220e-16434.52tr|V4AX16|V4AX16_LOTGI Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|202701444.975e-16434.52tr|A0A1S3I399|A0A1S3I399_LINUN EF-hand calcium-bin... [more]
gnl|BL_ORD_ID|239200221.337e-16233.09tr|K1PYF0|K1PYF0_CRAGI EF-hand calcium-binding dom... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkey-256e7.53.106e-4530.16si:dkey-256e7.5 [Source:ZFIN;Acc:ZDB-GENE-090313-2... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000004536.11.850e-2920.64pep scaffold:Pmarinus_7.0:GL477109:94389:131012:-1... [more]
ENSPMAT00000004547.19.451e-2820.15pep scaffold:Pmarinus_7.0:GL477109:94389:129511:-1... [more]
ENSPMAT00000004557.15.209e-2219.85pep scaffold:Pmarinus_7.0:GL477109:94389:108111:-1... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO465481.240e-13130.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368102.535e-3524.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286751.174e-2736.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO282102.675e-1723.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465492.541e-1328.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000009107.10.000e+099.66SMESG000009107.1[more]
SMESG000009107.10.000e+099.66SMESG000009107.1[more]
SMESG000058629.15.317e-918.85SMESG000058629.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001575 ID=SMED30001575|Name=EF-hand calcium-binding domain-containing protein 6|organism=Schmidtea mediterranea sexual|type=transcript|length=2902bp
GAATACGTCAGCTGTAACTATACAGTGTATAGTATACAGTTACTATAGCA
GTTATAAGCTGAAACCGTTACCACTAGCTTGATAAAATCATTGACAGTTT
CATTAAAATTGCTTTTGTTGCTCATGTCGCGACCTGCCTCCGTTAAAACT
GCAGTGAACAAAATGCTTGCAATTGAACATCCTTTATCGAAAATGGCTAA
AGAAAATACATTCGACAATACTGTGAATAATTTCCTCACTCCTGCAGACG
AAGGTCGTTCTCTGGCCTTTGAAGATGAGCAAAAGTACAAGCCAAAAAAG
TCAATGGGATCAAGATCATCGAGTCGAGTTTCAAGATCCGACACTTCAAT
GGACAACCTGAATTTGCATGGAACATTTTTAACGAATATTCCTGAATCAA
TTGCTGTAGTTGGTGGGGACGCAAATTTAACAAGAATGCCTTTATTTGGC
AATCGTTCAAATATTCAATCAAGAAATTCTACAACTTCTCGACATGGTAG
TGCAAAGGAAGCTGTAAAACTGAGCCTAGAAGAGATATCAGAAATCCTAC
AAAATAAGCTTGAGAAAAACTACTATGAAGTTCGAAAAAAGTTTATTGAC
AACGATCCTGATCGAAAGGGAAATGTGCAAAAGGAGGCATTGATGAGGAT
AATTCAGCAAATCGTCGGCTGCGAGATTACAACTAGTTGTTTGAATAGCT
TATTCGAAATGTGGGGAATCAAATCTGAAAAACAGATGCTTTCATTCAAT
GAGATATACACAATTTTTGTAAATAAATCAAAAGAAAAGTCTGAAACAAG
TTTTTTCGATCCGGTAAATCGTCATAAAGCCAAGGCAATCGTTCCGGCAA
AAATGACAGCCACAGATGCATTTGATTATATCAAAGAGAAATTCCGGTCG
AGAGAAATGTACCTTACGGATCTTTTTCCTGATTCTGTAGAATCTCAAGC
GTTTTCAATCACAAAAGCCGATTTAAAGAATTCTTTATACAAAATAATGA
TTGACCTTCTACCACCTGAAATGGAAAAACTTTGGTTAAAATTTGATCAA
ACGAAGCAAGGATCAATTGATTCTATGAAATTTCTCAAGCAAATCGGAAT
CATTTCTTATCCTATTGCCTCCTTGACTCCAAACGTTCGAGCATCAAATG
ATTCCTTTAAATTAAACTTGAACGCCAGTTTTATTGAAAAGCTGTTAAAA
ACCAAATTGAGAGAAGGTTTCACTACTCTTCGTCAAGATTTTCAAAAGAA
GGACACAAATCAAACGGGATTTCTGTCAATTTCTGACTTTATTCAAGTAT
TGTCCGAACATGATTTAAAATTGGAAGAAAGCAATTTGGGTGAATTCCTA
TCAAGATGTATAATCACTCCTACAAAAGAAGGAATACCATATAAAGAATT
TTTAATTAGATTTCAAGACCGATCGGAAGCTGGAATAACTCATAAATTGT
TGACAGATCGAGACAACAAGAAATCTTCAAATATTGATAGTGAATTAAAC
CCGGTCTCTTTGGTAGAGTTTAAACTTGTAAATCTCTTTCAAAAGGATTT
TTTGGAGATACTTGAAAATTTCAGAAAATTTGATAAATATCAAAATGGAT
CTATAGAACTCAAAGATTTTAAAAAGGTTTTAGAGAACCAAATGAATGTT
GAATTCACCGAATCCCAATTCAAAGTGATTGTTGATAATTTGCCATTAAA
TCGAAACCAAACAGTCCCATATTTAGATTTTCTCAAACAATTCGACACCG
GAAATTTCAGTTCTTTATCATTTAATGACATTCATGAAACTTCGTCAGTT
TTGAATGAGGCAGACCCGGTAACTGATTATAATATCGAAGAGATACAATC
TGGTAAAACGGTGGCTGAAATAAAAACTATTATGAAGCAAGCTTTTGACT
CTAAATTTGGAGACATAGAGAAGAGATTCAATGAGCTGGACGAGTACAAC
GGCAAGGTTCTAACCCCTGAACTGATGTTCCAGTTGATGAAAACGCTGGA
TGTTAAGCCGGAATTAAGTCGTGGAGACATTCGGTCTGTGTGGAAAACAT
TCATATTAAATGAAAAGAAATTATTAGATTTCAAAGAATTTACAAGACAT
TTCATGTATAATAAATCTACAGCCTCATTTCCAAATGCAAAGCTCAATCC
TCCAGTCAAAGGCGATTCTGACTTAATGCAGAGGTCCAGGAAATTAAATG
CAGCAACTGATATTCTTATGGACAATTTACGCGCAAAGATTGACTTATTG
TACAATGACCTACTCAAGGAATTCACTCATTTGGATCCAGAAAATAACGG
TGCAATTTCTGTAGAAGATTTTCAAGAGATTATCAAGGAACTCAGCATCC
ACCTCACAGACCATGAAATTCGAATAGTTACTGATAAATTTAAAACACCA
AACAACAAGATTGCATATCTCGAACTTTTAAAGCCTTTCTGCTCTCACAA
ATCACAACAAATTTTAGAAAACAGTTCAGATAAAAAGAAAAAACTTTATT
CTAAAAAGATTGATCAGTTTAACGGAAAAGATTCGAACAGTTTTCATTTT
TTTCACAAATTACAGGCTGTCATCCAGTCTGCAATGATACGAAACATCAA
AAAAATAGATTCCGGAAATACCGGTTTTATTTCGATAGCCGAATTGCGAG
CATTGCTCTTGTTGGAAGGAGTCTCCCTCTCCGAAGATGAAGTATTTAAT
CTGATGAATTCGTATGATAAAAATTTGAATGGTTCCATAAATTACAAAAT
GTTACTTCAGGATTTGCAATCGAAATTTTGATGTGTTTATTTTTTATTTT
GTTAGGAATTTGTTTTGGAACAAGATTTTATATATATTTACACGTTTTGA
TTTGCTGTGATGAAATTTCATGAAAATAAAGTTTGTTTTGTTTTAAAAAA
AA
back to top

protein sequence of SMED30001575-orf-1

>SMED30001575-orf-1 ID=SMED30001575-orf-1|Name=SMED30001575-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=886bp
MSRPASVKTAVNKMLAIEHPLSKMAKENTFDNTVNNFLTPADEGRSLAFE
DEQKYKPKKSMGSRSSSRVSRSDTSMDNLNLHGTFLTNIPESIAVVGGDA
NLTRMPLFGNRSNIQSRNSTTSRHGSAKEAVKLSLEEISEILQNKLEKNY
YEVRKKFIDNDPDRKGNVQKEALMRIIQQIVGCEITTSCLNSLFEMWGIK
SEKQMLSFNEIYTIFVNKSKEKSETSFFDPVNRHKAKAIVPAKMTATDAF
DYIKEKFRSREMYLTDLFPDSVESQAFSITKADLKNSLYKIMIDLLPPEM
EKLWLKFDQTKQGSIDSMKFLKQIGIISYPIASLTPNVRASNDSFKLNLN
ASFIEKLLKTKLREGFTTLRQDFQKKDTNQTGFLSISDFIQVLSEHDLKL
EESNLGEFLSRCIITPTKEGIPYKEFLIRFQDRSEAGITHKLLTDRDNKK
SSNIDSELNPVSLVEFKLVNLFQKDFLEILENFRKFDKYQNGSIELKDFK
KVLENQMNVEFTESQFKVIVDNLPLNRNQTVPYLDFLKQFDTGNFSSLSF
NDIHETSSVLNEADPVTDYNIEEIQSGKTVAEIKTIMKQAFDSKFGDIEK
RFNELDEYNGKVLTPELMFQLMKTLDVKPELSRGDIRSVWKTFILNEKKL
LDFKEFTRHFMYNKSTASFPNAKLNPPVKGDSDLMQRSRKLNAATDILMD
NLRAKIDLLYNDLLKEFTHLDPENNGAISVEDFQEIIKELSIHLTDHEIR
IVTDKFKTPNNKIAYLELLKPFCSHKSQQILENSSDKKKKLYSKKIDQFN
GKDSNSFHFFHKLQAVIQSAMIRNIKKIDSGNTGFISIAELRALLLLEGV
SLSEDEVFNLMNSYDKNLNGSINYKMLLQDLQSKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR002048EF_hand_dom
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002048EF-hand domainSMARTSM00054efh_1coord: 478..506
e-value: 1.8
score: 15.8
coord: 712..740
e-value: 0.78
score: 18.6
coord: 152..180
e-value: 9.7
score: 9.8
coord: 856..884
e-value: 13.0
score: 8.9
coord: 368..396
e-value: 3.2
score: 13.7
coord: 820..848
e-value: 53.0
score: 3.8
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 825..851
score: 7.595
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 152..183
score: 5.224
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 708..743
score: 9.66
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 295..330
score: 5.838
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 593..628
score: 5.336
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 852..885
score: 8.376
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 474..509
score: 8.795
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 364..399
score: 9.074
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 581..660
e-value: 3.0E-5
score: 25.8
coord: 696..772
e-value: 1.8E-9
score: 39.3
coord: 812..881
e-value: 9.4E-9
score: 37.0
coord: 464..541
e-value: 1.1E-9
score: 40.0
coord: 353..430
e-value: 5.1E-7
score: 31.5
NoneNo IPR availablePFAMPF13833EF-hand_8coord: 833..882
e-value: 0.0012
score: 18.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 60..75
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 48..75
NoneNo IPR availablePANTHERPTHR20875FAMILY NOT NAMEDcoord: 132..882
NoneNo IPR availablePANTHERPTHR20875:SF5coord: 132..882
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 377..389
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 369..539
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 596..661
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 712..881
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 150..324