Cyclin-dependent kinase 17

Overview
NameCyclin-dependent kinase 17
Smed IDSMED30001570
Length (bp)1869
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cyclin-dependent kinase 17 (SMED30001570) t-SNE clustered cells

Violin plots show distribution of expression levels for Cyclin-dependent kinase 17 (SMED30001570) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cyclin-dependent kinase 17 (SMED30001570) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cyclin-dependent kinase 17 (SMED30001570) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001570

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30001570SMESG000078466.1 SMESG000050786.1 SMESG000050790.1 dd_Smed_v4_11772_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30001570SMESG000078466.1 SMESG000050786.1 SMESG000024968.1 dd_Smed_v4_3128_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30001570SMESG000078466.1 SMESG000050786.1 SMESG000024968.1 dd_Smed_v4_3128_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001570SMESG000078466.1 SMESG000050786.1 SMESG000024968.1 dd_Smed_v4_3128_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001570SMESG000078466.1 SMESG000050786.1 SMESG000024968.1 dd_Smed_v4_3128_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30001570SMESG000078466.1 SMESG000050786.1 SMESG000024968.1 dd_Smed_v6_3128_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30001570SMESG000078466.1 SMESG000050786.1 SMESG000050790.1 dd_Smed_v6_11772_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30001570SMESG000050786.1 SMESG000050790.1 SMED30001570smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30001570SMESG000078466.1 SMESG000050786.1 SMESG000050790.1 dd_Smed_v4_11772_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001570SMESG000078466.1 SMESG000050786.1 SMESG000024968.1 dd_Smed_v4_3128_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Human
Match: CDK16 (cyclin dependent kinase 16 [Source:HGNC Symbol;Acc:HGNC:8749])

HSP 1 Score: 338.191 bits (866), Expect = 1.671e-109
Identity = 190/365 (52.05%), Postives = 254/365 (69.59%), Query Frame = 1
Query:  628 PKG--NRLSVINIISQPRMSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPK--PKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDSTYCQTSYID 1710
            P+G   +L++ + I    +SRR +R SLSE GFGKLE+Y K + LG+GTY+TVYKG+S LT + VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+ +  LTLVFEYL+K+LKQY+++  N++ +  VK F+FQLL GL +CH++K+LHRDLKPQNLLINE+ ELKLADFGLARA+SIPTK YSNEVVTLWYRPPD+LLG TDYS  ID+WG GCIF EM  G+ LFPG T + QL+ IF  LG+PT+E W  + L   +F+  ++   PK   ++LL    R++         LL   L   G  R++A +A++  +F       + L    S F L    L ++++   +S  D
Sbjct:   79 PEGYLEKLTLNSPIFDKPLSRRLRRVSLSEIGFGKLETYIKLDKLGEGTYATVYKGKSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTEKSLTLVFEYLDKDLKQYLDDCGNIINMHNVKLFLFQLLRGLAYCHRQKVLHRDLKPQNLLINERGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMATGRPLFPGSTVEEQLHFIFRILGTPTEETWPGI-LSNEEFKTYNY---PKYRAEALLSHAPRLDSDGAD----LLTKLLQFEGRNRISAEDAMKHPFFLSLGERIHKLPDTTSIFALKEIQLQKEASLRSSSMPD 435          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Human
Match: CDK16 (cyclin dependent kinase 16 [Source:HGNC Symbol;Acc:HGNC:8749])

HSP 1 Score: 338.576 bits (867), Expect = 6.505e-109
Identity = 190/365 (52.05%), Postives = 254/365 (69.59%), Query Frame = 1
Query:  628 PKG--NRLSVINIISQPRMSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPK--PKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDSTYCQTSYID 1710
            P+G   +L++ + I    +SRR +R SLSE GFGKLE+Y K + LG+GTY+TVYKG+S LT + VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+ +  LTLVFEYL+K+LKQY+++  N++ +  VK F+FQLL GL +CH++K+LHRDLKPQNLLINE+ ELKLADFGLARA+SIPTK YSNEVVTLWYRPPD+LLG TDYS  ID+WG GCIF EM  G+ LFPG T + QL+ IF  LG+PT+E W  + L   +F+  ++   PK   ++LL    R++         LL   L   G  R++A +A++  +F       + L    S F L    L ++++   +S  D
Sbjct:  133 PEGYLEKLTLNSPIFDKPLSRRLRRVSLSEIGFGKLETYIKLDKLGEGTYATVYKGKSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTEKSLTLVFEYLDKDLKQYLDDCGNIINMHNVKLFLFQLLRGLAYCHRQKVLHRDLKPQNLLINERGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMATGRPLFPGSTVEEQLHFIFRILGTPTEETWPGI-LSNEEFKTYNY---PKYRAEALLSHAPRLDSDGAD----LLTKLLQFEGRNRISAEDAMKHPFFLSLGERIHKLPDTTSIFALKEIQLQKEASLRSSSMPD 489          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Human
Match: CDK16 (cyclin dependent kinase 16 [Source:HGNC Symbol;Acc:HGNC:8749])

HSP 1 Score: 338.191 bits (866), Expect = 7.823e-109
Identity = 190/365 (52.05%), Postives = 254/365 (69.59%), Query Frame = 1
Query:  628 PKG--NRLSVINIISQPRMSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPK--PKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDSTYCQTSYID 1710
            P+G   +L++ + I    +SRR +R SLSE GFGKLE+Y K + LG+GTY+TVYKG+S LT + VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+ +  LTLVFEYL+K+LKQY+++  N++ +  VK F+FQLL GL +CH++K+LHRDLKPQNLLINE+ ELKLADFGLARA+SIPTK YSNEVVTLWYRPPD+LLG TDYS  ID+WG GCIF EM  G+ LFPG T + QL+ IF  LG+PT+E W  + L   +F+  ++   PK   ++LL    R++         LL   L   G  R++A +A++  +F       + L    S F L    L ++++   +S  D
Sbjct:  127 PEGYLEKLTLNSPIFDKPLSRRLRRVSLSEIGFGKLETYIKLDKLGEGTYATVYKGKSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTEKSLTLVFEYLDKDLKQYLDDCGNIINMHNVKLFLFQLLRGLAYCHRQKVLHRDLKPQNLLINERGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMATGRPLFPGSTVEEQLHFIFRILGTPTEETWPGI-LSNEEFKTYNY---PKYRAEALLSHAPRLDSDGAD----LLTKLLQFEGRNRISAEDAMKHPFFLSLGERIHKLPDTTSIFALKEIQLQKEASLRSSSMPD 483          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Human
Match: CDK16 (cyclin dependent kinase 16 [Source:HGNC Symbol;Acc:HGNC:8749])

HSP 1 Score: 338.191 bits (866), Expect = 7.823e-109
Identity = 190/365 (52.05%), Postives = 254/365 (69.59%), Query Frame = 1
Query:  628 PKG--NRLSVINIISQPRMSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPK--PKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDSTYCQTSYID 1710
            P+G   +L++ + I    +SRR +R SLSE GFGKLE+Y K + LG+GTY+TVYKG+S LT + VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+ +  LTLVFEYL+K+LKQY+++  N++ +  VK F+FQLL GL +CH++K+LHRDLKPQNLLINE+ ELKLADFGLARA+SIPTK YSNEVVTLWYRPPD+LLG TDYS  ID+WG GCIF EM  G+ LFPG T + QL+ IF  LG+PT+E W  + L   +F+  ++   PK   ++LL    R++         LL   L   G  R++A +A++  +F       + L    S F L    L ++++   +S  D
Sbjct:  127 PEGYLEKLTLNSPIFDKPLSRRLRRVSLSEIGFGKLETYIKLDKLGEGTYATVYKGKSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTEKSLTLVFEYLDKDLKQYLDDCGNIINMHNVKLFLFQLLRGLAYCHRQKVLHRDLKPQNLLINERGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMATGRPLFPGSTVEEQLHFIFRILGTPTEETWPGI-LSNEEFKTYNY---PKYRAEALLSHAPRLDSDGAD----LLTKLLQFEGRNRISAEDAMKHPFFLSLGERIHKLPDTTSIFALKEIQLQKEASLRSSSMPD 483          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Human
Match: CDK16 (cyclin dependent kinase 16 [Source:HGNC Symbol;Acc:HGNC:8749])

HSP 1 Score: 337.035 bits (863), Expect = 1.543e-107
Identity = 190/365 (52.05%), Postives = 254/365 (69.59%), Query Frame = 1
Query:  628 PKG--NRLSVINIISQPRMSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPK--PKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDSTYCQTSYID 1710
            P+G   +L++ + I    +SRR +R SLSE GFGKLE+Y K + LG+GTY+TVYKG+S LT + VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+ +  LTLVFEYL+K+LKQY+++  N++ +  VK F+FQLL GL +CH++K+LHRDLKPQNLLINE+ ELKLADFGLARA+SIPTK YSNEVVTLWYRPPD+LLG TDYS  ID+WG GCIF EM  G+ LFPG T + QL+ IF  LG+PT+E W  + L   +F+  ++   PK   ++LL    R++         LL   L   G  R++A +A++  +F       + L    S F L    L ++++   +S  D
Sbjct:  201 PEGYLEKLTLNSPIFDKPLSRRLRRVSLSEIGFGKLETYIKLDKLGEGTYATVYKGKSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTEKSLTLVFEYLDKDLKQYLDDCGNIINMHNVKLFLFQLLRGLAYCHRQKVLHRDLKPQNLLINERGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMATGRPLFPGSTVEEQLHFIFRILGTPTEETWPGI-LSNEEFKTYNY---PKYRAEALLSHAPRLDSDGAD----LLTKLLQFEGRNRISAEDAMKHPFFLSLGERIHKLPDTTSIFALKEIQLQKEASLRSSSMPD 557          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Celegans
Match: pct-1 (Cyclin-dependent kinase 17 [Source:UniProtKB/Swiss-Prot;Acc:Q8I7M8])

HSP 1 Score: 337.806 bits (865), Expect = 4.250e-108
Identity = 174/321 (54.21%), Postives = 233/321 (72.59%), Query Frame = 1
Query:  637 NRLSVINIISQPRMSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYF 1599
            ++L+    + QP ++R+ +R SLSE GFGKLE+Y K + LG+GTY+TV++G+S+LT  +VALKE++LE+ EGAPCTAIRE+SLLRNLRH N+VTLHDII+    LTLVFEY++++LKQYM+  NN +++  ++ F++QLL GL +CHQR++LHRDLKPQNLLI  K ELKLADFGLARA+S+PTK YSNEVVTLWYRPPD+LLG TDYS HID+WG GCI  EM+ G+ALFPG T   QL +IF  LGSP  +    +  K   +  ++    P P  L   + R++         LL  FL   G  R++A+EA++  + 
Sbjct:  206 DKLNRTPTLDQP-LTRKNRRASLSEIGFGKLETYEKLDKLGEGTYATVFRGRSILTNKFVALKEIRLEQEEGAPCTAIREVSLLRNLRHANVVTLHDIIHTDRLLTLVFEYVDRDLKQYMDSCNNAMQMNNIRLFLYQLLRGLAYCHQRRVLHRDLKPQNLLITAKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTDYSTHIDMWGVGCILFEMIAGRALFPGGTPTEQLGLIFRTLGSPRPDRHPTICEKPTFYPYANRHYNPDP--LCRQIPRIDAHGFE----LLMKFLQYEGKDRVSAAEAVKHPFL 519          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Celegans
Match: pct-1 (Cyclin-dependent kinase 17 [Source:UniProtKB/Swiss-Prot;Acc:Q8I7M8])

HSP 1 Score: 339.732 bits (870), Expect = 7.864e-108
Identity = 174/321 (54.21%), Postives = 233/321 (72.59%), Query Frame = 1
Query:  637 NRLSVINIISQPRMSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYF 1599
            ++L+    + QP ++R+ +R SLSE GFGKLE+Y K + LG+GTY+TV++G+S+LT  +VALKE++LE+ EGAPCTAIRE+SLLRNLRH N+VTLHDII+    LTLVFEY++++LKQYM+  NN +++  ++ F++QLL GL +CHQR++LHRDLKPQNLLI  K ELKLADFGLARA+S+PTK YSNEVVTLWYRPPD+LLG TDYS HID+WG GCI  EM+ G+ALFPG T   QL +IF  LGSP  +    +  K   +  ++    P P  L   + R++         LL  FL   G  R++A+EA++  + 
Sbjct:  296 DKLNRTPTLDQP-LTRKNRRASLSEIGFGKLETYEKLDKLGEGTYATVFRGRSILTNKFVALKEIRLEQEEGAPCTAIREVSLLRNLRHANVVTLHDIIHTDRLLTLVFEYVDRDLKQYMDSCNNAMQMNNIRLFLYQLLRGLAYCHQRRVLHRDLKPQNLLITAKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTDYSTHIDMWGVGCILFEMIAGRALFPGGTPTEQLGLIFRTLGSPRPDRHPTICEKPTFYPYANRHYNPDP--LCRQIPRIDAHGFE----LLMKFLQYEGKDRVSAAEAVKHPFL 609          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Celegans
Match: pct-1 (Cyclin-dependent kinase 17 [Source:UniProtKB/Swiss-Prot;Acc:Q8I7M8])

HSP 1 Score: 339.732 bits (870), Expect = 7.864e-108
Identity = 174/321 (54.21%), Postives = 233/321 (72.59%), Query Frame = 1
Query:  637 NRLSVINIISQPRMSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYF 1599
            ++L+    + QP ++R+ +R SLSE GFGKLE+Y K + LG+GTY+TV++G+S+LT  +VALKE++LE+ EGAPCTAIRE+SLLRNLRH N+VTLHDII+    LTLVFEY++++LKQYM+  NN +++  ++ F++QLL GL +CHQR++LHRDLKPQNLLI  K ELKLADFGLARA+S+PTK YSNEVVTLWYRPPD+LLG TDYS HID+WG GCI  EM+ G+ALFPG T   QL +IF  LGSP  +    +  K   +  ++    P P  L   + R++         LL  FL   G  R++A+EA++  + 
Sbjct:  296 DKLNRTPTLDQP-LTRKNRRASLSEIGFGKLETYEKLDKLGEGTYATVFRGRSILTNKFVALKEIRLEQEEGAPCTAIREVSLLRNLRHANVVTLHDIIHTDRLLTLVFEYVDRDLKQYMDSCNNAMQMNNIRLFLYQLLRGLAYCHQRRVLHRDLKPQNLLITAKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTDYSTHIDMWGVGCILFEMIAGRALFPGGTPTEQLGLIFRTLGSPRPDRHPTICEKPTFYPYANRHYNPDP--LCRQIPRIDAHGFE----LLMKFLQYEGKDRVSAAEAVKHPFL 609          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Celegans
Match: pct-1 (Cyclin-dependent kinase 17 [Source:UniProtKB/Swiss-Prot;Acc:Q8I7M8])

HSP 1 Score: 339.732 bits (870), Expect = 7.864e-108
Identity = 174/321 (54.21%), Postives = 233/321 (72.59%), Query Frame = 1
Query:  637 NRLSVINIISQPRMSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYF 1599
            ++L+    + QP ++R+ +R SLSE GFGKLE+Y K + LG+GTY+TV++G+S+LT  +VALKE++LE+ EGAPCTAIRE+SLLRNLRH N+VTLHDII+    LTLVFEY++++LKQYM+  NN +++  ++ F++QLL GL +CHQR++LHRDLKPQNLLI  K ELKLADFGLARA+S+PTK YSNEVVTLWYRPPD+LLG TDYS HID+WG GCI  EM+ G+ALFPG T   QL +IF  LGSP  +    +  K   +  ++    P P  L   + R++         LL  FL   G  R++A+EA++  + 
Sbjct:  296 DKLNRTPTLDQP-LTRKNRRASLSEIGFGKLETYEKLDKLGEGTYATVFRGRSILTNKFVALKEIRLEQEEGAPCTAIREVSLLRNLRHANVVTLHDIIHTDRLLTLVFEYVDRDLKQYMDSCNNAMQMNNIRLFLYQLLRGLAYCHQRRVLHRDLKPQNLLITAKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTDYSTHIDMWGVGCILFEMIAGRALFPGGTPTEQLGLIFRTLGSPRPDRHPTICEKPTFYPYANRHYNPDP--LCRQIPRIDAHGFE----LLMKFLQYEGKDRVSAAEAVKHPFL 609          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Celegans
Match: ZC123.4 (pep chromosome:WBcel235:I:841742:846763:-1 gene:WBGene00022519.1 transcript:ZC123.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZC123.4)

HSP 1 Score: 258.84 bits (660), Expect = 1.796e-78
Identity = 156/321 (48.60%), Postives = 208/321 (64.80%), Query Frame = 1
Query:  736 YNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDH------QLNIIFEKLGSPTDEEW---ELLDLKTPKF-----QLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNL 1656
            Y + + LG+G+Y+TVYK +S L    VALKE+KL+  EG P TAIRE SLLRNLRH NIV+LHDI YQ + LT VFEY++ +L +Y+E+    L+   +K  +FQLL GLDFCH++KILHRDLKPQNLL++E   LKLADFGLARA+S+P++ YS+EVVTLWYRPPD+L+G TDYS  +D+WG GCIF E+  G ALFPG  D H      QL++IF   G+P +++W   + L   TP+      +LS   + P    +L          KT  + LL   L +  + R++A+ A+   YF   PR  + L    S F L
Sbjct:  216 YKRIDKLGEGSYATVYKCESKLDGSIVALKEIKLQFQEGLPFTAIREASLLRNLRHANIVSLHDIFYQHHQLTFVFEYMKMDLSKYLEQNVYGLDSIDIKLLLFQLLRGLDFCHRKKILHRDLKPQNLLLDEDGVLKLADFGLARAKSVPSRTYSHEVVTLWYRPPDVLMGSTDYSTSLDMWGVGCIFAEICTGAALFPGSKDSHYPGTKDQLDMIFSIRGTPDEKKWPEVKTLPGYTPELFPRYRELSFIAVNPMFTKIL----------KTGQE-LLGMLLQLRPESRVSAASAMLHPYFASFPREVHLLAPSQSIFRL 525          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Fly
Match: Eip63E (gene:FBgn0005640 transcript:FBtr0110922)

HSP 1 Score: 291.967 bits (746), Expect = 2.838e-91
Identity = 164/332 (49.40%), Postives = 223/332 (67.17%), Query Frame = 1
Query:  691 KRHSLSEFG----FGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDH-QLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSL 1671
            +R   S FG    FGK E+Y K E LG+G+Y+TVYKG S LT   VALKE++L+E EGAP TAIRE SLL+ L+H NIVTLHDI++ +  LT VFEY+  +L QYME+    L+   V+ F+FQLL GL +CH+R++LHRD+KPQNLLI++  ELKLADFGLARA+S+P+  YS+EVVTLWYRPPD+LLG T+YS  +D+WG GCIFVEM+ G   FPG  D + QL+ IF+ LG+PT++ W  +    P ++        +P+ L H   R+   +  + + + +GFL +  + RL A +AL+  YF + P+  Y L    S F +    L
Sbjct:  165 RRKRFSAFGGDSPFGKQEAYVKLEPLGEGSYATVYKGFSKLTYQRVALKEIRLQEEEGAPFTAIREASLLKELKHSNIVTLHDIVHTRETLTFVFEYVNTDLSQYMEKHPGGLDHRNVRLFLFQLLRGLSYCHKRRVLHRDVKPQNLLISDCGELKLADFGLARAKSVPSHTYSHEVVTLWYRPPDVLLGSTEYSTSLDMWGVGCIFVEMVTGMPTFPGIRDTYDQLDKIFKLLGTPTEDTWPGV-THFPGYKPHKLGFY-RPRKLGHNFPRL--YDIIEGETIANGFLQLNPEQRLGADDALQHPYFAQLPKKLYELPDETSIFTVEGVQL 492          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Fly
Match: Eip63E (gene:FBgn0005640 transcript:FBtr0110920)

HSP 1 Score: 291.967 bits (746), Expect = 3.582e-91
Identity = 164/332 (49.40%), Postives = 223/332 (67.17%), Query Frame = 1
Query:  691 KRHSLSEFG----FGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDH-QLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSL 1671
            +R   S FG    FGK E+Y K E LG+G+Y+TVYKG S LT   VALKE++L+E EGAP TAIRE SLL+ L+H NIVTLHDI++ +  LT VFEY+  +L QYME+    L+   V+ F+FQLL GL +CH+R++LHRD+KPQNLLI++  ELKLADFGLARA+S+P+  YS+EVVTLWYRPPD+LLG T+YS  +D+WG GCIFVEM+ G   FPG  D + QL+ IF+ LG+PT++ W  +    P ++        +P+ L H   R+   +  + + + +GFL +  + RL A +AL+  YF + P+  Y L    S F +    L
Sbjct:  173 RRKRFSAFGGDSPFGKQEAYVKLEPLGEGSYATVYKGFSKLTYQRVALKEIRLQEEEGAPFTAIREASLLKELKHSNIVTLHDIVHTRETLTFVFEYVNTDLSQYMEKHPGGLDHRNVRLFLFQLLRGLSYCHKRRVLHRDVKPQNLLISDCGELKLADFGLARAKSVPSHTYSHEVVTLWYRPPDVLLGSTEYSTSLDMWGVGCIFVEMVTGMPTFPGIRDTYDQLDKIFKLLGTPTEDTWPGV-THFPGYKPHKLGFY-RPRKLGHNFPRL--YDIIEGETIANGFLQLNPEQRLGADDALQHPYFAQLPKKLYELPDETSIFTVEGVQL 500          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Fly
Match: Eip63E (gene:FBgn0005640 transcript:FBtr0302598)

HSP 1 Score: 291.967 bits (746), Expect = 3.582e-91
Identity = 164/332 (49.40%), Postives = 223/332 (67.17%), Query Frame = 1
Query:  691 KRHSLSEFG----FGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDH-QLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSL 1671
            +R   S FG    FGK E+Y K E LG+G+Y+TVYKG S LT   VALKE++L+E EGAP TAIRE SLL+ L+H NIVTLHDI++ +  LT VFEY+  +L QYME+    L+   V+ F+FQLL GL +CH+R++LHRD+KPQNLLI++  ELKLADFGLARA+S+P+  YS+EVVTLWYRPPD+LLG T+YS  +D+WG GCIFVEM+ G   FPG  D + QL+ IF+ LG+PT++ W  +    P ++        +P+ L H   R+   +  + + + +GFL +  + RL A +AL+  YF + P+  Y L    S F +    L
Sbjct:  173 RRKRFSAFGGDSPFGKQEAYVKLEPLGEGSYATVYKGFSKLTYQRVALKEIRLQEEEGAPFTAIREASLLKELKHSNIVTLHDIVHTRETLTFVFEYVNTDLSQYMEKHPGGLDHRNVRLFLFQLLRGLSYCHKRRVLHRDVKPQNLLISDCGELKLADFGLARAKSVPSHTYSHEVVTLWYRPPDVLLGSTEYSTSLDMWGVGCIFVEMVTGMPTFPGIRDTYDQLDKIFKLLGTPTEDTWPGV-THFPGYKPHKLGFY-RPRKLGHNFPRL--YDIIEGETIANGFLQLNPEQRLGADDALQHPYFAQLPKKLYELPDETSIFTVEGVQL 500          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Fly
Match: Eip63E (gene:FBgn0005640 transcript:FBtr0073131)

HSP 1 Score: 292.352 bits (747), Expect = 3.609e-91
Identity = 164/332 (49.40%), Postives = 223/332 (67.17%), Query Frame = 1
Query:  691 KRHSLSEFG----FGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDH-QLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSL 1671
            +R   S FG    FGK E+Y K E LG+G+Y+TVYKG S LT   VALKE++L+E EGAP TAIRE SLL+ L+H NIVTLHDI++ +  LT VFEY+  +L QYME+    L+   V+ F+FQLL GL +CH+R++LHRD+KPQNLLI++  ELKLADFGLARA+S+P+  YS+EVVTLWYRPPD+LLG T+YS  +D+WG GCIFVEM+ G   FPG  D + QL+ IF+ LG+PT++ W  +    P ++        +P+ L H   R+   +  + + + +GFL +  + RL A +AL+  YF + P+  Y L    S F +    L
Sbjct:  186 RRKRFSAFGGDSPFGKQEAYVKLEPLGEGSYATVYKGFSKLTYQRVALKEIRLQEEEGAPFTAIREASLLKELKHSNIVTLHDIVHTRETLTFVFEYVNTDLSQYMEKHPGGLDHRNVRLFLFQLLRGLSYCHKRRVLHRDVKPQNLLISDCGELKLADFGLARAKSVPSHTYSHEVVTLWYRPPDVLLGSTEYSTSLDMWGVGCIFVEMVTGMPTFPGIRDTYDQLDKIFKLLGTPTEDTWPGV-THFPGYKPHKLGFY-RPRKLGHNFPRL--YDIIEGETIANGFLQLNPEQRLGADDALQHPYFAQLPKKLYELPDETSIFTVEGVQL 513          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Fly
Match: Eip63E (gene:FBgn0005640 transcript:FBtr0073132)

HSP 1 Score: 292.352 bits (747), Expect = 3.609e-91
Identity = 164/332 (49.40%), Postives = 223/332 (67.17%), Query Frame = 1
Query:  691 KRHSLSEFG----FGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDH-QLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSL 1671
            +R   S FG    FGK E+Y K E LG+G+Y+TVYKG S LT   VALKE++L+E EGAP TAIRE SLL+ L+H NIVTLHDI++ +  LT VFEY+  +L QYME+    L+   V+ F+FQLL GL +CH+R++LHRD+KPQNLLI++  ELKLADFGLARA+S+P+  YS+EVVTLWYRPPD+LLG T+YS  +D+WG GCIFVEM+ G   FPG  D + QL+ IF+ LG+PT++ W  +    P ++        +P+ L H   R+   +  + + + +GFL +  + RL A +AL+  YF + P+  Y L    S F +    L
Sbjct:  186 RRKRFSAFGGDSPFGKQEAYVKLEPLGEGSYATVYKGFSKLTYQRVALKEIRLQEEEGAPFTAIREASLLKELKHSNIVTLHDIVHTRETLTFVFEYVNTDLSQYMEKHPGGLDHRNVRLFLFQLLRGLSYCHKRRVLHRDVKPQNLLISDCGELKLADFGLARAKSVPSHTYSHEVVTLWYRPPDVLLGSTEYSTSLDMWGVGCIFVEMVTGMPTFPGIRDTYDQLDKIFKLLGTPTEDTWPGV-THFPGYKPHKLGFY-RPRKLGHNFPRL--YDIIEGETIANGFLQLNPEQRLGADDALQHPYFAQLPKKLYELPDETSIFTVEGVQL 513          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Zebrafish
Match: cdk16 (cyclin-dependent kinase 16 [Source:ZFIN;Acc:ZDB-GENE-030131-2939])

HSP 1 Score: 336.65 bits (862), Expect = 8.714e-109
Identity = 179/316 (56.65%), Postives = 228/316 (72.15%), Query Frame = 1
Query:  676 MSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEW-------ELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFH 1602
            +SRR +R SLSE GFGKLE+Y K + LG+GTY+TVYKG+S LT + VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+ +  LTLVFEYL+K+LKQY+++  N + +  VK F+FQLL GL++CH+RK+LHRDLKPQNLLIN++ ELKLADFGLARA+SIPTK YSNEVVTLWYRPPD+LLG TDYS  ID+WG GCIF EM  G+ LFPG T + +L+ IF+ LG+PT+E W       E +    P++         +   L +   R++         LL   L   G  R+ A EA+R  YFH
Sbjct:  118 LSRRLRRVSLSEIGFGKLETYVKLDKLGEGTYATVYKGRSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTQKSLTLVFEYLDKDLKQYLDDCGNSIHMHNVKLFLFQLLRGLNYCHRRKVLHRDLKPQNLLINDRGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMSTGRPLFPGSTVEEELHFIFKLLGTPTEETWPGITSNEEFISYNYPRY---------RADCLHNHTPRLDNDGVE----LLSKLLQFEGKKRIAAEEAMRHPYFH 420          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Zebrafish
Match: cdk16 (cyclin-dependent kinase 16 [Source:ZFIN;Acc:ZDB-GENE-030131-2939])

HSP 1 Score: 337.421 bits (864), Expect = 1.852e-108
Identity = 179/316 (56.65%), Postives = 228/316 (72.15%), Query Frame = 1
Query:  676 MSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEW-------ELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFH 1602
            +SRR +R SLSE GFGKLE+Y K + LG+GTY+TVYKG+S LT + VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+ +  LTLVFEYL+K+LKQY+++  N + +  VK F+FQLL GL++CH+RK+LHRDLKPQNLLIN++ ELKLADFGLARA+SIPTK YSNEVVTLWYRPPD+LLG TDYS  ID+WG GCIF EM  G+ LFPG T + +L+ IF+ LG+PT+E W       E +    P++         +   L +   R++         LL   L   G  R+ A EA+R  YFH
Sbjct:  173 LSRRLRRVSLSEIGFGKLETYVKLDKLGEGTYATVYKGRSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTQKSLTLVFEYLDKDLKQYLDDCGNSIHMHNVKLFLFQLLRGLNYCHRRKVLHRDLKPQNLLINDRGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMSTGRPLFPGSTVEEELHFIFKLLGTPTEETWPGITSNEEFISYNYPRY---------RADCLHNHTPRLDNDGVE----LLSKLLQFEGKKRIAAEEAMRHPYFH 475          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Zebrafish
Match: cdk16 (cyclin-dependent kinase 16 [Source:ZFIN;Acc:ZDB-GENE-030131-2939])

HSP 1 Score: 329.717 bits (844), Expect = 1.724e-106
Identity = 163/242 (67.36%), Postives = 203/242 (83.88%), Query Frame = 1
Query:  676 MSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEW 1401
            +SRR +R SLSE GFGKLE+Y K + LG+GTY+TVYKG+S LT + VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+ +  LTLVFEYL+K+LKQY+++  N + +  VK F+FQLL GL++CH+RK+LHRDLKPQNLLIN++ ELKLADFGLARA+SIPTK YSNEVVTLWYRPPD+LLG TDYS  ID+WG GCIF EM  G+ LFPG T + +L+ IF+ LG+PT+E W
Sbjct:  173 LSRRLRRVSLSEIGFGKLETYVKLDKLGEGTYATVYKGRSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTQKSLTLVFEYLDKDLKQYLDDCGNSIHMHNVKLFLFQLLRGLNYCHRRKVLHRDLKPQNLLINDRGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMSTGRPLFPGSTVEEELHFIFKLLGTPTEETW 414          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Zebrafish
Match: cdk17 (cyclin-dependent kinase 17 [Source:ZFIN;Acc:ZDB-GENE-041210-15])

HSP 1 Score: 330.872 bits (847), Expect = 6.972e-106
Identity = 177/339 (52.21%), Postives = 237/339 (69.91%), Query Frame = 1
Query:  709 EFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEW-------ELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDSTYCQTSY 1704
            E GFGKLE+Y K + LG+GTY+TV+KG+S LT + VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDI++    LTLVFEYL+K+LKQYM++  N++ +  VK F+FQ+L GL +CH+RK+LHRDLKPQNLLINE+ ELKLADFGLARA+S+PTK YSNEVVTLWYRPPD+LLG ++YS  ID+WG GCIF EM  G+ LFPG T + +L++IF  LG+PT++ W       E      PK++       P+P     F++   + +   +++LL  FL      R++A E+++ SYF       + L   +S F L    L RD  Y  +SY
Sbjct:  186 EIGFGKLETYIKLDKLGEGTYATVFKGRSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIVHTDKSLTLVFEYLDKDLKQYMDDCGNIMSMHNVKIFLFQILRGLAYCHRRKVLHRDLKPQNLLINERGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSSEYSTQIDMWGVGCIFYEMAAGRPLFPGSTVEDELHLIFRLLGTPTEDNWPGISSIEEFKSYNFPKYK-------PQP-----FINHAPRLDTEGIELLL-SFLRYESKKRISADESMKHSYFKSLGMRIHTLPESISIFTLKEVQLQRDPGYRNSSY 511          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Zebrafish
Match: CDK18 (si:dkey-166c18.1 [Source:ZFIN;Acc:ZDB-GENE-141215-51])

HSP 1 Score: 324.324 bits (830), Expect = 4.020e-104
Identity = 174/310 (56.13%), Postives = 227/310 (73.23%), Query Frame = 1
Query:  676 MSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIP-KPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFH 1602
            +SR  +R SLS+ GFGKLE+Y K   LG+GTY+TV+KG+S LT++ VALKE++LE  EGAPCTAIRE+SLL+NL+H NIVTLHDII+    LTLVFEYL+ +LKQY++   NL+ +  VK FMFQLL GL +CH+RKILHRDLKPQNLLIN+K ELKLADFGLARA+S+PTK YSNEVVTLWYRPPD+LLG T+YS  ID+WG GCI  EM  G+ +FPG T   +L++IF  +G+PT+E W  +   T   +   ++    + ++L++ V R++    T+   LL   L      R++A  +LR SYF 
Sbjct:  115 LSRMSRRASLSDIGFGKLETYVKLGKLGEGTYATVFKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKNLKHANIVTLHDIIHTDRCLTLVFEYLDSDLKQYLDNCGNLMSMHNVKIFMFQLLRGLSYCHKRKILHRDLKPQNLLINDKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCILYEMATGRPMFPGSTVKEELHLIFRLMGTPTEESWPGI---TANEEFKSYLFPQYRAQALINHVPRLD----TEGIDLLTALLLYDTKRRISAELSLRHSYFQ 417          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Xenopus
Match: g3bp2 (G3BP stress granule assembly factor 2 [Source:Xenbase;Acc:XB-GENE-480361])

HSP 1 Score: 343.199 bits (879), Expect = 3.529e-111
Identity = 189/334 (56.59%), Postives = 242/334 (72.46%), Query Frame = 1
Query:  676 MSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPK--PKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSL 1671
            +SRR +R SLSE GFGKLE+Y K + LG+GTY+TVYKG+S LT++ VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+ +  LTLVFEYL+K+LKQY+++  NL+ L  VK F++QLL GL +CH+RK+LHRDLKPQNLLINEK ELKLADFGLARA+SIPTK YSNEVVTLWYRPPD+LLG T+YS  ID+WG GCIF EM+ G+ LFPG T + QL+ IF  LG+PT+E W  + L   +F+  ++   P+  P  +    +R++         LL   L + G  R++A EA+R  YF E     + L    S F L   SL
Sbjct:  119 LSRRLRRVSLSEIGFGKLETYIKLDKLGEGTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTERTLTLVFEYLDKDLKQYLDDCGNLINLHNVKLFLYQLLRGLSYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTEYSTQIDMWGVGCIFYEMVTGRPLFPGSTVEEQLHFIFRILGTPTEETWPGI-LSNEEFKSYNY---PRYYPDPIQKHAARLDSDGAN----LLTKLLQLEGRNRISAEEAMRHLYFQELGERIHKLPDTTSIFALKEISL 444          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Xenopus
Match: g3bp2 (G3BP stress granule assembly factor 2 [Source:Xenbase;Acc:XB-GENE-480361])

HSP 1 Score: 342.813 bits (878), Expect = 4.090e-111
Identity = 189/334 (56.59%), Postives = 242/334 (72.46%), Query Frame = 1
Query:  676 MSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPK--PKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSL 1671
            +SRR +R SLSE GFGKLE+Y K + LG+GTY+TVYKG+S LT++ VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+ +  LTLVFEYL+K+LKQY+++  NL+ L  VK F++QLL GL +CH+RK+LHRDLKPQNLLINEK ELKLADFGLARA+SIPTK YSNEVVTLWYRPPD+LLG T+YS  ID+WG GCIF EM+ G+ LFPG T + QL+ IF  LG+PT+E W  + L   +F+  ++   P+  P  +    +R++         LL   L + G  R++A EA+R  YF E     + L    S F L   SL
Sbjct:  119 LSRRLRRVSLSEIGFGKLETYIKLDKLGEGTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTERTLTLVFEYLDKDLKQYLDDCGNLINLHNVKLFLYQLLRGLSYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTEYSTQIDMWGVGCIFYEMVTGRPLFPGSTVEEQLHFIFRILGTPTEETWPGI-LSNEEFKSYNY---PRYYPDPIQKHAARLDSDGAN----LLTKLLQLEGRNRISAEEAMRHLYFQELGERIHKLPDTTSIFALKEISL 444          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Xenopus
Match: g3bp2 (G3BP stress granule assembly factor 2 [Source:Xenbase;Acc:XB-GENE-480361])

HSP 1 Score: 342.813 bits (878), Expect = 5.985e-111
Identity = 189/334 (56.59%), Postives = 242/334 (72.46%), Query Frame = 1
Query:  676 MSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPK--PKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSL 1671
            +SRR +R SLSE GFGKLE+Y K + LG+GTY+TVYKG+S LT++ VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+ +  LTLVFEYL+K+LKQY+++  NL+ L  VK F++QLL GL +CH+RK+LHRDLKPQNLLINEK ELKLADFGLARA+SIPTK YSNEVVTLWYRPPD+LLG T+YS  ID+WG GCIF EM+ G+ LFPG T + QL+ IF  LG+PT+E W  + L   +F+  ++   P+  P  +    +R++         LL   L + G  R++A EA+R  YF E     + L    S F L   SL
Sbjct:  134 LSRRLRRVSLSEIGFGKLETYIKLDKLGEGTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTERTLTLVFEYLDKDLKQYLDDCGNLINLHNVKLFLYQLLRGLSYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTEYSTQIDMWGVGCIFYEMVTGRPLFPGSTVEEQLHFIFRILGTPTEETWPGI-LSNEEFKSYNY---PRYYPDPIQKHAARLDSDGAN----LLTKLLQLEGRNRISAEEAMRHLYFQELGERIHKLPDTTSIFALKEISL 459          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Xenopus
Match: g3bp2 (G3BP stress granule assembly factor 2 [Source:Xenbase;Acc:XB-GENE-480361])

HSP 1 Score: 338.576 bits (867), Expect = 2.132e-110
Identity = 190/332 (57.23%), Postives = 241/332 (72.59%), Query Frame = 1
Query:  676 MSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSL 1671
            +SRR +R SLSE GFGKLE+Y K + LG+GTY+TVYKG+S LT++ VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+ +  LTLVFEYL+K+LKQY+++  NL+ L  VK F++QLL GL +CH+RK+LHRDLKPQNLLINEK ELKLADFGLARA+SIPTK YSNEVVTLWYRPPD+LLG T+YS  ID+WG GCIF EM+ G+ LFPG T + QL+ IF  LG+PT+E W  + L   +F+ S    +  P++       V K++      LL   L + G  R++A EA+R  YF E     + L    S F L   SL
Sbjct:   68 LSRRLRRVSLSEIGFGKLETYIKLDKLGEGTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTERTLTLVFEYLDKDLKQYLDDCGNLINLHNVKLFLYQLLRGLSYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTEYSTQIDMWGVGCIFYEMVTGRPLFPGSTVEEQLHFIFRILGTPTEETWPGI-LSNEEFK-SYLPHVTHPQA----AGSVPKAKPN----LLTKLLQLEGRNRISAEEAMRHLYFQELGERIHKLPDTTSIFALKEISL 389          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Xenopus
Match: g3bp2 (G3BP stress granule assembly factor 2 [Source:Xenbase;Acc:XB-GENE-480361])

HSP 1 Score: 342.813 bits (878), Expect = 2.189e-110
Identity = 183/312 (58.65%), Postives = 235/312 (75.32%), Query Frame = 1
Query:  676 MSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPK--PKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHE 1605
            +SRR +R SLSE GFGKLE+Y K + LG+GTY+TVYKG+S LT++ VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+ +  LTLVFEYL+K+LKQY+++  NL+ L  VK F++QLL GL +CH+RK+LHRDLKPQNLLINEK ELKLADFGLARA+SIPTK YSNEVVTLWYRPPD+LLG T+YS  ID+WG GCIF EM+ G+ LFPG T + QL+ IF  LG+PT+E W  + L   +F+  ++   P+  P  +    +R++         LL   L + G  R++A EA+R  YF E
Sbjct:  172 LSRRLRRVSLSEIGFGKLETYIKLDKLGEGTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTERTLTLVFEYLDKDLKQYLDDCGNLINLHNVKLFLYQLLRGLSYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTEYSTQIDMWGVGCIFYEMVTGRPLFPGSTVEEQLHFIFRILGTPTEETWPGI-LSNEEFKSYNY---PRYYPDPIQKHAARLDSDGAN----LLTKLLQLEGRNRISAEEAMRHLYFQE 475          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Mouse
Match: Cdk16 (cyclin-dependent kinase 16 [Source:MGI Symbol;Acc:MGI:97516])

HSP 1 Score: 337.035 bits (863), Expect = 1.350e-108
Identity = 191/365 (52.33%), Postives = 252/365 (69.04%), Query Frame = 1
Query:  628 PKG--NRLSVINIISQPRMSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPK--PKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDSTYCQTSYID 1710
            P+G   +L++ + I    +SRR +R SLSE GFGKLE+Y K + LG+GTY+TVYKG+S LT + VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+ +  LTLVFEYL+K+LKQY+++  N++ +  VK F+FQLL GL +CH++K+LHRDLKPQNLLINE+ ELKLADFGLARA+SIPTK YSNEVVTLWYRPPD+LLG TDYS  ID+WG GCIF EM  G+ LFPG T + QL+ IF  LG+PT+E W  + L   +F+  ++   PK   ++LL    R++         LL   L   G  R++A +A +  +F       + L    S F L    L +++    TS  D
Sbjct:  127 PEGYLEKLTLNSPIFDKPLSRRLRRVSLSEIGFGKLETYIKLDKLGEGTYATVYKGKSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTEKSLTLVFEYLDKDLKQYLDDCGNVINMHNVKLFLFQLLRGLAYCHRQKVLHRDLKPQNLLINERGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMATGRPLFPGSTVEEQLHFIFRILGTPTEETWPGI-LSNEEFRTYNY---PKYRAEALLSHAPRLDSDGAD----LLTKLLQFEGRNRISAEDARKHPFFLSLGERIHKLPDTTSIFALKEVQLQKEANIRSTSMPD 483          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Mouse
Match: Cdk16 (cyclin-dependent kinase 16 [Source:MGI Symbol;Acc:MGI:97516])

HSP 1 Score: 335.109 bits (858), Expect = 2.329e-108
Identity = 191/365 (52.33%), Postives = 252/365 (69.04%), Query Frame = 1
Query:  628 PKG--NRLSVINIISQPRMSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPK--PKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDSTYCQTSYID 1710
            P+G   +L++ + I    +SRR +R SLSE GFGKLE+Y K + LG+GTY+TVYKG+S LT + VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+ +  LTLVFEYL+K+LKQY+++  N++ +  VK F+FQLL GL +CH++K+LHRDLKPQNLLINE+ ELKLADFGLARA+SIPTK YSNEVVTLWYRPPD+LLG TDYS  ID+WG GCIF EM  G+ LFPG T + QL+ IF  LG+PT+E W  + L   +F+  ++   PK   ++LL    R++         LL   L   G  R++A +A +  +F       + L    S F L    L +++    TS  D
Sbjct:   92 PEGYLEKLTLNSPIFDKPLSRRLRRVSLSEIGFGKLETYIKLDKLGEGTYATVYKGKSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTEKSLTLVFEYLDKDLKQYLDDCGNVINMHNVKLFLFQLLRGLAYCHRQKVLHRDLKPQNLLINERGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMATGRPLFPGSTVEEQLHFIFRILGTPTEETWPGI-LSNEEFRTYNY---PKYRAEALLSHAPRLDSDGAD----LLTKLLQFEGRNRISAEDARKHPFFLSLGERIHKLPDTTSIFALKEVQLQKEANIRSTSMPD 448          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Mouse
Match: Cdk17 (cyclin-dependent kinase 17 [Source:MGI Symbol;Acc:MGI:97517])

HSP 1 Score: 327.02 bits (837), Expect = 5.797e-105
Identity = 177/339 (52.21%), Postives = 238/339 (70.21%), Query Frame = 1
Query:  709 EFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEW-------ELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDSTYCQTSY 1704
            E GFGK+E+Y K E LG+GTY+TVYKG+S LT++ VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDI++    LTLVFEYL+K+LKQYM++  N++ +  VK F++Q+L GL +CH+RK+LHRDLKPQNLLINE+ ELKLADFGLARA+S+PTK YSNEVVTLWYRPPD+LLG ++YS  ID+WG GCIF EM +G+ LFPG T + +L++IF  LG+P+ E W       E  +   PK+         KP+ L++   R++ SE  +   L+  FL      R+ A EA++  YF       + L   +S F+L    L +D  +  +SY
Sbjct:  150 EIGFGKMETYIKLEKLGEGTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIVHTDKSLTLVFEYLDKDLKQYMDDCGNIMSMHNVKLFLYQILRGLAYCHRRKVLHRDLKPQNLLINERGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPSQETWPGVSSNDEFKNYNFPKY---------KPQPLINHAPRLD-SEGIE---LITKFLQYESKKRVPAEEAMKHVYFRSLGPRIHALPESVSIFSLKEIQLQKDPGFRNSSY 475          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Mouse
Match: Cdk17 (cyclin-dependent kinase 17 [Source:MGI Symbol;Acc:MGI:97517])

HSP 1 Score: 327.791 bits (839), Expect = 1.159e-104
Identity = 177/339 (52.21%), Postives = 238/339 (70.21%), Query Frame = 1
Query:  709 EFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEW-------ELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDSTYCQTSY 1704
            E GFGK+E+Y K E LG+GTY+TVYKG+S LT++ VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDI++    LTLVFEYL+K+LKQYM++  N++ +  VK F++Q+L GL +CH+RK+LHRDLKPQNLLINE+ ELKLADFGLARA+S+PTK YSNEVVTLWYRPPD+LLG ++YS  ID+WG GCIF EM +G+ LFPG T + +L++IF  LG+P+ E W       E  +   PK+         KP+ L++   R++ SE  +   L+  FL      R+ A EA++  YF       + L   +S F+L    L +D  +  +SY
Sbjct:  183 EIGFGKMETYIKLEKLGEGTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIVHTDKSLTLVFEYLDKDLKQYMDDCGNIMSMHNVKLFLYQILRGLAYCHRRKVLHRDLKPQNLLINERGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPSQETWPGVSSNDEFKNYNFPKY---------KPQPLINHAPRLD-SEGIE---LITKFLQYESKKRVPAEEAMKHVYFRSLGPRIHALPESVSIFSLKEIQLQKDPGFRNSSY 508          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Mouse
Match: Cdk18 (cyclin-dependent kinase 18 [Source:MGI Symbol;Acc:MGI:97518])

HSP 1 Score: 322.398 bits (825), Expect = 1.809e-103
Identity = 181/340 (53.24%), Postives = 235/340 (69.12%), Query Frame = 1
Query:  676 MSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPK--PKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDSTY 1689
            ++R  +R SLS+ GFGKLE+Y K + LG+GTY+TV+KG+S LT++ VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHD+I+    LTLVFEYL+ +LKQY++   NL+ +  VK FMFQLL GL +CH RKILHRDLKPQNLLINE+ ELKLADFGLARA+S+PTK YSNEVVTLWYRPPD+LLG T+YS  ID+WG GCI  EM  GK LFPG T   +L++IF  LG+PT+E W  +     +F+  +F   P+  P+ LL    R++ +E   +   L  +       R++A  AL   YF       + L    S F+L    L +D  Y
Sbjct:  101 LTRMSRRASLSDIGFGKLETYVKLDKLGEGTYATVFKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDLIHTDRSLTLVFEYLDSDLKQYLDHCGNLMNMHNVKIFMFQLLRGLAYCHHRKILHRDLKPQNLLINERGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCILYEMATGKPLFPGSTVKEELHLIFRLLGTPTEESWPGVT-SISEFRAYNF---PRYLPQPLLSHAPRLD-TEGINLLSSLLLY---ESKSRMSAEAALNHPYFQSLGDRVHQLHDTASIFSLKEIQLQKDPGY 432          
BLAST of Cyclin-dependent kinase 17 vs. UniProt/SwissProt
Match: sp|Q00536|CDK16_HUMAN (Cyclin-dependent kinase 16 OS=Homo sapiens OX=9606 GN=CDK16 PE=1 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 3.757e-108
Identity = 190/365 (52.05%), Postives = 254/365 (69.59%), Query Frame = 1
Query:  628 PKG--NRLSVINIISQPRMSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPK--PKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDSTYCQTSYID 1710
            P+G   +L++ + I    +SRR +R SLSE GFGKLE+Y K + LG+GTY+TVYKG+S LT + VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+ +  LTLVFEYL+K+LKQY+++  N++ +  VK F+FQLL GL +CH++K+LHRDLKPQNLLINE+ ELKLADFGLARA+SIPTK YSNEVVTLWYRPPD+LLG TDYS  ID+WG GCIF EM  G+ LFPG T + QL+ IF  LG+PT+E W  + L   +F+  ++   PK   ++LL    R++         LL   L   G  R++A +A++  +F       + L    S F L    L ++++   +S  D
Sbjct:  127 PEGYLEKLTLNSPIFDKPLSRRLRRVSLSEIGFGKLETYIKLDKLGEGTYATVYKGKSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTEKSLTLVFEYLDKDLKQYLDDCGNIINMHNVKLFLFQLLRGLAYCHRQKVLHRDLKPQNLLINERGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMATGRPLFPGSTVEEQLHFIFRILGTPTEETWPGI-LSNEEFKTYNY---PKYRAEALLSHAPRLDSDGAD----LLTKLLQFEGRNRISAEDAMKHPFFLSLGERIHKLPDTTSIFALKEIQLQKEASLRSSSMPD 483          
BLAST of Cyclin-dependent kinase 17 vs. UniProt/SwissProt
Match: sp|Q04735|CDK16_MOUSE (Cyclin-dependent kinase 16 OS=Mus musculus OX=10090 GN=Cdk16 PE=1 SV=1)

HSP 1 Score: 337.035 bits (863), Expect = 9.442e-108
Identity = 191/365 (52.33%), Postives = 252/365 (69.04%), Query Frame = 1
Query:  628 PKG--NRLSVINIISQPRMSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPK--PKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDSTYCQTSYID 1710
            P+G   +L++ + I    +SRR +R SLSE GFGKLE+Y K + LG+GTY+TVYKG+S LT + VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+ +  LTLVFEYL+K+LKQY+++  N++ +  VK F+FQLL GL +CH++K+LHRDLKPQNLLINE+ ELKLADFGLARA+SIPTK YSNEVVTLWYRPPD+LLG TDYS  ID+WG GCIF EM  G+ LFPG T + QL+ IF  LG+PT+E W  + L   +F+  ++   PK   ++LL    R++         LL   L   G  R++A +A +  +F       + L    S F L    L +++    TS  D
Sbjct:  127 PEGYLEKLTLNSPIFDKPLSRRLRRVSLSEIGFGKLETYIKLDKLGEGTYATVYKGKSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTEKSLTLVFEYLDKDLKQYLDDCGNVINMHNVKLFLFQLLRGLAYCHRQKVLHRDLKPQNLLINERGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMATGRPLFPGSTVEEQLHFIFRILGTPTEETWPGI-LSNEEFRTYNY---PKYRAEALLSHAPRLDSDGAD----LLTKLLQFEGRNRISAEDARKHPFFLSLGERIHKLPDTTSIFALKEVQLQKEANIRSTSMPD 483          
BLAST of Cyclin-dependent kinase 17 vs. UniProt/SwissProt
Match: sp|Q63686|CDK16_RAT (Cyclin-dependent kinase 16 OS=Rattus norvegicus OX=10116 GN=Cdk16 PE=1 SV=1)

HSP 1 Score: 335.495 bits (859), Expect = 3.527e-107
Identity = 190/365 (52.05%), Postives = 252/365 (69.04%), Query Frame = 1
Query:  628 PKG--NRLSVINIISQPRMSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPK--PKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDSTYCQTSYID 1710
            P+G   +L++ + I    +SRR +  SLSE GFGKLE+Y K + LG+GTY+TVYKG+S LT + VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+ +  LTLVFEYL+K+LKQY+++  N++ +  VK F+FQLL GL +CH++K+LHRDLKPQNLLINE+ ELKLADFGLA A+SIPTK YSNEVVTLWYRPPD+LLG TDYSG ID+WG GCIF EM  G+ LFPG T + QL+ IF  LG+PT++ W  + L   +F+  ++   PK   ++LL    R+E         LL   L   G  R++A +A++  +F       + L    S F L    L +++    TS  D
Sbjct:  127 PEGYLEKLTLNSPIGDKPLSRRLRPVSLSEIGFGKLETYIKLDKLGEGTYATVYKGKSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTEKSLTLVFEYLDKDLKQYLDDCGNVINMHNVKLFLFQLLRGLAYCHRQKVLHRDLKPQNLLINERGELKLADFGLAYAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSGQIDMWGVGCIFYEMATGRPLFPGSTVEEQLHFIFRILGTPTEDTWPGI-LSNEEFRTYNY---PKYRAEALLRHAPRLECDGAD----LLTKLLQFEGRNRISAEDAMKHPFFLSLGERIHKLPDTTSIFALKEVQLQKEANIRSTSMPD 483          
BLAST of Cyclin-dependent kinase 17 vs. UniProt/SwissProt
Match: sp|Q8I7M8|CDK17_CAEEL (Cyclin-dependent kinase 17 OS=Caenorhabditis elegans OX=6239 GN=pct-1 PE=1 SV=1)

HSP 1 Score: 339.732 bits (870), Expect = 1.000e-106
Identity = 174/321 (54.21%), Postives = 233/321 (72.59%), Query Frame = 1
Query:  637 NRLSVINIISQPRMSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYF 1599
            ++L+    + QP ++R+ +R SLSE GFGKLE+Y K + LG+GTY+TV++G+S+LT  +VALKE++LE+ EGAPCTAIRE+SLLRNLRH N+VTLHDII+    LTLVFEY++++LKQYM+  NN +++  ++ F++QLL GL +CHQR++LHRDLKPQNLLI  K ELKLADFGLARA+S+PTK YSNEVVTLWYRPPD+LLG TDYS HID+WG GCI  EM+ G+ALFPG T   QL +IF  LGSP  +    +  K   +  ++    P P  L   + R++         LL  FL   G  R++A+EA++  + 
Sbjct:  296 DKLNRTPTLDQP-LTRKNRRASLSEIGFGKLETYEKLDKLGEGTYATVFRGRSILTNKFVALKEIRLEQEEGAPCTAIREVSLLRNLRHANVVTLHDIIHTDRLLTLVFEYVDRDLKQYMDSCNNAMQMNNIRLFLYQLLRGLAYCHQRRVLHRDLKPQNLLITAKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTDYSTHIDMWGVGCILFEMIAGRALFPGGTPTEQLGLIFRTLGSPRPDRHPTICEKPTFYPYANRHYNPDP--LCRQIPRIDAHGFE----LLMKFLQYEGKDRVSAAEAVKHPFL 609          
BLAST of Cyclin-dependent kinase 17 vs. UniProt/SwissProt
Match: sp|O35832|CDK18_RAT (Cyclin-dependent kinase 18 OS=Rattus norvegicus OX=10116 GN=Cdk18 PE=1 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 3.304e-105
Identity = 183/340 (53.82%), Postives = 236/340 (69.41%), Query Frame = 1
Query:  676 MSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPK--PKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDSTY 1689
            ++R  +R SLS+ GFGKLE+Y K + LG+GTY+TV+KG+S LT++ VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHD+I+    LTLVFEYL+ +LKQY++   NL+ +  VK FMFQLL GL +CH+RKILHRDLKPQNLLINE+ ELKLADFGLARA+S+PTK YSNEVVTLWYRPPD+LLG T+YS  ID+WG GCI  EM  GK LFPG T   +L++IF  LG+PT+E W  +     +F+  +F   P+  P+ LL    R++    T+   LL   L      R++A  AL   YF       + L    S F+L    L +D  Y
Sbjct:  101 LTRMSRRASLSDIGFGKLETYVKLDKLGEGTYATVFKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDLIHTDRSLTLVFEYLDSDLKQYLDHCGNLMNMHNVKIFMFQLLRGLAYCHRRKILHRDLKPQNLLINERGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCILYEMATGKPLFPGSTVKEELHLIFRLLGTPTEESWPGVT-SISEFRAYNF---PRYLPQPLLSHAPRLD----TEGINLLTSLLLYESKSRMSAEAALSHPYFQSLGERVHQLDDTASIFSLKEIQLQKDPGY 432          
BLAST of Cyclin-dependent kinase 17 vs. TrEMBL
Match: A0A016X3E8 (Protein kinase domain-containing protein OS=Ancylostoma ceylanicum OX=53326 GN=Acey_s0410.g941 PE=4 SV=1)

HSP 1 Score: 357.836 bits (917), Expect = 6.871e-113
Identity = 185/348 (53.16%), Postives = 247/348 (70.98%), Query Frame = 1
Query:  640 RLSVINIISQPRMSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDS 1683
            +L+    + QP ++R+ +R SLSE GFGKLE+Y K E LG+GTY+TVY+G+SLLT  +VALKE++LE+ EGAPCTAIRE+SLLRNLRH N+VTLHDII+    LTLVFEY++++LKQYM+  NN+L +  ++ F+FQLL GL +CHQR++LHRDLKPQNLLI  K ELKLADFGLARA+S+PTK YSNEVVTLWYRPPD+LLG TDYS HID+WG GCI  EM+ G+ALFPG T D QL +IF  LGSP  +    +  +      +  V  P+P      + ++ + +    ++LL  FL   G  R++A EA+  ++    P    +LR   S  ++   SL+R++
Sbjct:  167 KLNRTPTLDQP-LTRKNRRASLSEIGFGKLETYEKLEKLGEGTYATVYRGRSLLTNKFVALKEIRLEQEEGAPCTAIREVSLLRNLRHANVVTLHDIIHTDRLLTLVFEYVDRDLKQYMDACNNVLSMNNIRLFLFQLLRGLAYCHQRRVLHRDLKPQNLLITSKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTDYSTHIDMWGVGCILFEMVAGRALFPGSTTDEQLGLIFRTLGSPRSDRHATICARPAYAPFAQKVYHPEP-----LIRQIPRLDSNGYELLLK-FLQYEGRDRISAQEAMHHNFLKTLPPKVMSLRDDESVMDVGGVSLDRET 507          
BLAST of Cyclin-dependent kinase 17 vs. TrEMBL
Match: A0A016X2K1 (Protein kinase domain-containing protein OS=Ancylostoma ceylanicum OX=53326 GN=Acey_s0410.g941 PE=4 SV=1)

HSP 1 Score: 356.295 bits (913), Expect = 5.011e-112
Identity = 185/348 (53.16%), Postives = 247/348 (70.98%), Query Frame = 1
Query:  640 RLSVINIISQPRMSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDS 1683
            +L+    + QP ++R+ +R SLSE GFGKLE+Y K E LG+GTY+TVY+G+SLLT  +VALKE++LE+ EGAPCTAIRE+SLLRNLRH N+VTLHDII+    LTLVFEY++++LKQYM+  NN+L +  ++ F+FQLL GL +CHQR++LHRDLKPQNLLI  K ELKLADFGLARA+S+PTK YSNEVVTLWYRPPD+LLG TDYS HID+WG GCI  EM+ G+ALFPG T D QL +IF  LGSP  +    +  +      +  V  P+P      + ++ + +    ++LL  FL   G  R++A EA+  ++    P    +LR   S  ++   SL+R++
Sbjct:  188 KLNRTPTLDQP-LTRKNRRASLSEIGFGKLETYEKLEKLGEGTYATVYRGRSLLTNKFVALKEIRLEQEEGAPCTAIREVSLLRNLRHANVVTLHDIIHTDRLLTLVFEYVDRDLKQYMDACNNVLSMNNIRLFLFQLLRGLAYCHQRRVLHRDLKPQNLLITSKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTDYSTHIDMWGVGCILFEMVAGRALFPGSTTDEQLGLIFRTLGSPRSDRHATICARPAYAPFAQKVYHPEP-----LIRQIPRLDSNGYELLLK-FLQYEGRDRISAQEAMHHNFLKTLPPKVMSLRDDESVMDVGGVSLDRET 528          
BLAST of Cyclin-dependent kinase 17 vs. TrEMBL
Match: A0A016X2D3 (Protein kinase domain-containing protein OS=Ancylostoma ceylanicum OX=53326 GN=Acey_s0410.g941 PE=4 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 7.892e-112
Identity = 185/348 (53.16%), Postives = 247/348 (70.98%), Query Frame = 1
Query:  640 RLSVINIISQPRMSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDS 1683
            +L+    + QP ++R+ +R SLSE GFGKLE+Y K E LG+GTY+TVY+G+SLLT  +VALKE++LE+ EGAPCTAIRE+SLLRNLRH N+VTLHDII+    LTLVFEY++++LKQYM+  NN+L +  ++ F+FQLL GL +CHQR++LHRDLKPQNLLI  K ELKLADFGLARA+S+PTK YSNEVVTLWYRPPD+LLG TDYS HID+WG GCI  EM+ G+ALFPG T D QL +IF  LGSP  +    +  +      +  V  P+P      + ++ + +    ++LL  FL   G  R++A EA+  ++    P    +LR   S  ++   SL+R++
Sbjct:  222 KLNRTPTLDQP-LTRKNRRASLSEIGFGKLETYEKLEKLGEGTYATVYRGRSLLTNKFVALKEIRLEQEEGAPCTAIREVSLLRNLRHANVVTLHDIIHTDRLLTLVFEYVDRDLKQYMDACNNVLSMNNIRLFLFQLLRGLAYCHQRRVLHRDLKPQNLLITSKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTDYSTHIDMWGVGCILFEMVAGRALFPGSTTDEQLGLIFRTLGSPRSDRHATICARPAYAPFAQKVYHPEP-----LIRQIPRLDSNGYELLLK-FLQYEGRDRISAQEAMHHNFLKTLPPKVMSLRDDESVMDVGGVSLDRET 562          
BLAST of Cyclin-dependent kinase 17 vs. TrEMBL
Match: A0A3Q2R1G4 (Cyclin-dependent kinase 16 OS=Fundulus heteroclitus OX=8078 PE=3 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 4.880e-111
Identity = 195/357 (54.62%), Postives = 254/357 (71.15%), Query Frame = 1
Query:  640 RLSVIN--IISQPRMSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEW-------ELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDS 1683
            + SVI   +  QP +SRR +R SLSE GFGKLE+Y K + LG+GTY+TVYKG+S LT++ VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+ +  LTLVFEYL+K+LKQY+++  N++ +  VK F+FQLL GL +CHQRK+LHRDLKPQNLLINE+ ELKLADFGLARA+SIPTK YSNEVVTLWYRPPD+LLG TDYS HID+WG GCIF EM+ G+ LFPG T + +L+ IF+ LGSPT+  W       E +    P++         + + L +   R+  SE  +   LL  FL   G  R++A E+++ SYF    +   +L    S F+LS   L ++S
Sbjct:  102 KFSVIGPALFEQP-ISRRLRRVSLSEIGFGKLETYVKLDKLGEGTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTQKSLTLVFEYLDKDLKQYLDDCGNIIHVHNVKLFLFQLLRGLSYCHQRKVLHRDLKPQNLLINERGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTHIDMWGVGCIFYEMVTGRPLFPGSTVEEELHFIFKLLGSPTERSWPGITSNEEFVGFNFPQY---------RAERLSNHTPRL-SSEGVE---LLSKFLQFEGKKRISADESMKHSYFSNLGKRVMSLPDTASIFSLSEIQLEKES 444          
BLAST of Cyclin-dependent kinase 17 vs. TrEMBL
Match: A0A3Q2Q340 (Cyclin-dependent kinase 16 OS=Fundulus heteroclitus OX=8078 PE=3 SV=1)

HSP 1 Score: 350.132 bits (897), Expect = 1.409e-110
Identity = 195/357 (54.62%), Postives = 254/357 (71.15%), Query Frame = 1
Query:  640 RLSVIN--IISQPRMSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEW-------ELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDS 1683
            + SVI   +  QP +SRR +R SLSE GFGKLE+Y K + LG+GTY+TVYKG+S LT++ VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+ +  LTLVFEYL+K+LKQY+++  N++ +  VK F+FQLL GL +CHQRK+LHRDLKPQNLLINE+ ELKLADFGLARA+SIPTK YSNEVVTLWYRPPD+LLG TDYS HID+WG GCIF EM+ G+ LFPG T + +L+ IF+ LGSPT+  W       E +    P++         + + L +   R+  SE  +   LL  FL   G  R++A E+++ SYF    +   +L    S F+LS   L ++S
Sbjct:  102 KFSVIGPALFEQP-ISRRLRRVSLSEIGFGKLETYVKLDKLGEGTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTQKSLTLVFEYLDKDLKQYLDDCGNIIHVHNVKLFLFQLLRGLSYCHQRKVLHRDLKPQNLLINERGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTHIDMWGVGCIFYEMVTGRPLFPGSTVEEELHFIFKLLGSPTERSWPGITSNEEFVGFNFPQY---------RAERLSNHTPRL-SSEGVE---LLSKFLQFEGKKRISADESMKHSYFSNLGKRVMSLPDTASIFSLSEIQLEKES 444          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Cavefish
Match: cdk16 (cyclin-dependent kinase 16 [Source:ZFIN;Acc:ZDB-GENE-030131-2939])

HSP 1 Score: 341.658 bits (875), Expect = 8.479e-111
Identity = 181/316 (57.28%), Postives = 232/316 (73.42%), Query Frame = 1
Query:  676 MSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEW-------ELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFH 1602
            +SRR +R SLSE GFGKLE+Y K + LG+GTY+TVYKG+S LT + VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+ +  LTLVFEYL+K+LKQY+++  N + +  VK F+FQLL GL++CH+RK+LHRDLKPQNLLIN++ ELKLADFGLARA+SIPTK YSNEVVTLWYRPPD+LLG TDYS  ID+WG GCIF EM  G+ LFPG T + +L+ IF+ LG+PT+E W       E +    P+++             LH  +   + +   +D LL   L   G  R++A EA+R SYFH
Sbjct:  129 LSRRLRRVSLSEIGFGKLETYVKLDKLGEGTYATVYKGRSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTQKSLTLVFEYLDKDLKQYLDDCGNCIHMHNVKLFLFQLLRGLNYCHRRKVLHRDLKPQNLLINDRGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMATGRPLFPGSTVEEELHFIFKLLGTPTEETWPGITSNEEFISYNYPRYR----------ADCLH--NHTPRLDNDGVD-LLSKLLQFEGKKRISAEEAMRHSYFH 431          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Cavefish
Match: ENSAMXT00000030743.1 (cyclin-dependent kinase 17-like [Source:NCBI gene;Acc:103047068])

HSP 1 Score: 338.576 bits (867), Expect = 2.431e-109
Identity = 183/343 (53.35%), Postives = 241/343 (70.26%), Query Frame = 1
Query:  676 MSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDSTYCQTSY 1704
            +SRR +R SLSE GFGKLE+Y K + LG+GTY+TV+KG+S LT   VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+    LTLVFEYLEK+LKQYM++  N++ +  VK F+FQLL GL +CH+RK+LHRDLKPQNLLIN+K ELKLADFGLARA+S+PTK YSNEVVTLWYRPPD+LLG T+YS  ID+WG GCIF EM+ G+ LFPG T + +L++IF  LG+PT+E W  +   + +F+  +F    + + L++   R++         L++  L      R++A EALR  YF         L    S F++    L +D      +Y
Sbjct:  121 LSRRLRRASLSEIGFGKLETYIKLDKLGEGTYATVFKGRSKLTDSLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTDKCLTLVFEYLEKDLKQYMDDCGNIMSVHNVKIFLFQLLRGLAYCHRRKVLHRDLKPQNLLINDKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCIFYEMITGRPLFPGSTVEDELHLIFRILGTPTEESWPGVS-TSEEFRTYNFPRY-RTEPLVNHAPRIDSDGHD----LINQLLQFEAKRRVSAEEALRHPYFRSLGEQVQGLADTASIFSVKEIQLQKDPGKRSVAY 457          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Cavefish
Match: ENSAMXT00000015072.2 (cyclin-dependent kinase 17-like [Source:NCBI gene;Acc:103047068])

HSP 1 Score: 336.265 bits (861), Expect = 5.360e-109
Identity = 185/345 (53.62%), Postives = 243/345 (70.43%), Query Frame = 1
Query:  676 MSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKS--LLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDSTYCQTSY 1704
            +SRR +R SLSE GFGKLE+Y K + LG+GTY+TV+KG+S LT   VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+    LTLVFEYLEK+LKQYM++  N++ +  VK F+FQLL GL +CH+RK+LHRDLKPQNLLIN+K ELKLADFGLARA+S+PTK YSNEVVTLWYRPPD+LLG T+YS  ID+WG GCIF EM+ G+ LFPG T + +L++IF  LG+PT+E W  +   + +F+  +F   P+ ++  L++   R    +    D L++  L      R++A EALR  YF         L    S F++    L +D      +Y
Sbjct:  108 LSRRLRRASLSEIGFGKLETYIKLDKLGEGTYATVFKGRSKLTDSLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTDKCLTLVFEYLEKDLKQYMDDCGNIMSVHNVKIFLFQLLRGLAYCHRRKVLHRDLKPQNLLINDKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCIFYEMITGRPLFPGSTVEDELHLIFRILGTPTEESWPGVS-TSEEFRTYNF---PRYRTEPLVNHAPRSVLIDSDGHD-LINQLLQFEAKRRVSAEEALRHPYFRSLGEQVQGLADTASIFSVKEIQLQKDPGKRSVAY 447          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Cavefish
Match: ENSAMXT00000039233.1 (cyclin-dependent kinase 17-like [Source:NCBI gene;Acc:103047068])

HSP 1 Score: 337.806 bits (865), Expect = 1.099e-108
Identity = 183/343 (53.35%), Postives = 241/343 (70.26%), Query Frame = 1
Query:  676 MSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDSTYCQTSY 1704
            +SRR +R SLSE GFGKLE+Y K + LG+GTY+TV+KG+S LT   VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+    LTLVFEYLEK+LKQYM++  N++ +  VK F+FQLL GL +CH+RK+LHRDLKPQNLLIN+K ELKLADFGLARA+S+PTK YSNEVVTLWYRPPD+LLG T+YS  ID+WG GCIF EM+ G+ LFPG T + +L++IF  LG+PT+E W  +   + +F+  +F    + + L++   R++         L++  L      R++A EALR  YF         L    S F++    L +D      +Y
Sbjct:  170 LSRRLRRASLSEIGFGKLETYIKLDKLGEGTYATVFKGRSKLTDSLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTDKCLTLVFEYLEKDLKQYMDDCGNIMSVHNVKIFLFQLLRGLAYCHRRKVLHRDLKPQNLLINDKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCIFYEMITGRPLFPGSTVEDELHLIFRILGTPTEESWPGVS-TSEEFRTYNFPRY-RTEPLVNHAPRIDSDGHD----LINQLLQFEAKRRVSAEEALRHPYFRSLGEQVQGLADTASIFSVKEIQLQKDPGKRSVAY 506          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Cavefish
Match: ENSAMXT00000048139.1 (cyclin-dependent kinase 17-like [Source:NCBI gene;Acc:103047068])

HSP 1 Score: 337.806 bits (865), Expect = 1.884e-108
Identity = 183/343 (53.35%), Postives = 241/343 (70.26%), Query Frame = 1
Query:  676 MSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDSTYCQTSY 1704
            +SRR +R SLSE GFGKLE+Y K + LG+GTY+TV+KG+S LT   VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+    LTLVFEYLEK+LKQYM++  N++ +  VK F+FQLL GL +CH+RK+LHRDLKPQNLLIN+K ELKLADFGLARA+S+PTK YSNEVVTLWYRPPD+LLG T+YS  ID+WG GCIF EM+ G+ LFPG T + +L++IF  LG+PT+E W  +   + +F+  +F    + + L++   R++         L++  L      R++A EALR  YF         L    S F++    L +D      +Y
Sbjct:  170 LSRRLRRASLSEIGFGKLETYIKLDKLGEGTYATVFKGRSKLTDSLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTDKCLTLVFEYLEKDLKQYMDDCGNIMSVHNVKIFLFQLLRGLAYCHRRKVLHRDLKPQNLLINDKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCIFYEMITGRPLFPGSTVEDELHLIFRILGTPTEESWPGVS-TSEEFRTYNFPRY-RTEPLVNHAPRIDSDGHD----LINQLLQFEAKRRVSAEEALRHPYFRSLGEQVQGLADTASIFSVKEIQLQKDPGKRSVAY 506          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008013.1 (pep scaffold:Pmarinus_7.0:GL478839:10839:40406:1 gene:ENSPMAG00000007231.1 transcript:ENSPMAT00000008013.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 330.872 bits (847), Expect = 5.114e-107
Identity = 175/308 (56.82%), Postives = 230/308 (74.68%), Query Frame = 1
Query:  676 MSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYF 1599
            +SRR +R SLSE GFGKLE+Y K + LG+GTY+TVYKG+S LT + VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDI++    LTLVFEYLEK+LKQYM++  N++ +  VK F+ QLL GL +CH+R++LHRDLKPQNLLIN+K ELKLADFGLARA+S+PTK YSNEVVTLWYRPPD+LLG T+YS  ID+WG GCIF EM  G+ LFPG T + +L++IF  LGSP ++ W  +     +++  +F   PK +S    ++   + +   +D LL  FL      R++A +AL+  YF
Sbjct:  178 LSRRLRRASLSEIGFGKLETYTKLDKLGEGTYATVYKGRSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIVHTDKSLTLVFEYLEKDLKQYMDDCGNIMSMHNVKIFLLQLLRGLAYCHKRRVLHRDLKPQNLLINDKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTQIDMWGVGCIFFEMAAGRPLFPGSTVEDELHLIFRMLGSPREDMWPGIS-SNEEYKSYNF---PKYRS-EPMITHAPRLDVDGLD-LLSKFLLYEAKARISAEDALKRPYF 479          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005451.1 (pep scaffold:Pmarinus_7.0:GL478132:187045:200874:-1 gene:ENSPMAG00000004949.1 transcript:ENSPMAT00000005451.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 246.128 bits (627), Expect = 6.027e-77
Identity = 150/304 (49.34%), Postives = 194/304 (63.82%), Query Frame = 1
Query:  718 FGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDH-QLNIIFEKLGSPTDEEW-ELLDLKTPKFQLSDFV----IIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDP 1611
            FG    Y + + +G+G+Y+TV+KG S +T  +VALK V + E EGAP   IRE+SLL+ L+H NIV LHDI+Y ++ LTLVFEYLE +L QYME     L    VK F+ QLL GL + H R ILHRD+KP NLL+    ELKLADFG+ARAQS+P+++YS+EV TLWYRPPD+LLG T YS  +D+W  GCIFVEML G  +FPG      QL  +++ LG+P +EEW E+  L  P ++  +F     I+PK    L  V R+   +    D L    L      RL A  ALR SYF + P
Sbjct:    6 FGGEALYVRLQKIGQGSYATVFKGISRVTWQFVALKVVYIHEEEGAPFNTIREVSLLKTLKHANIVLLHDIVYTQHALTLVFEYLETDLHQYMERHPGGLNAHNVKLFLLQLLRGLAYTHSRGILHRDVKPHNLLLGVSGELKLADFGMARAQSVPSRSYSSEVATLWYRPPDVLLGSTRYSSGLDMWAVGCIFVEMLQGMVIFPGVPGVWDQLERVWQVLGTPNEEEWPEVTSL--PLYKPGEFCLETSIVPKKPRQLGRVWRMLGCDPHAED-LARSLLQCCPSRRLPAHAALRHSYFSDLP 306          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005447.1 (pep scaffold:Pmarinus_7.0:GL478132:187042:200850:-1 gene:ENSPMAG00000004949.1 transcript:ENSPMAT00000005447.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 237.654 bits (605), Expect = 9.511e-74
Identity = 143/298 (47.99%), Postives = 188/298 (63.09%), Query Frame = 1
Query:  736 YNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDH-QLNIIFEKLGSPTDEEW-ELLDL----KTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDP 1611
            Y + + +G+G+Y+TV+KG S +T  +VALK V + E EGAP   IRE+SLL+ L+H NIV LHDI+Y ++ LTLVFEYLE +L QYME     L    VK F+ QLL GL + H R ILHRD+KP NLL+    ELKLADFG+ARAQS+P+++YS+EV TLWYRPPD+LLG T YS  +D+W  GCIFVEML G  +FPG      QL  +++ LG+P +EEW E+  L      P    +    +   +++L  + RV        + L    L      RL A  ALR SYF + P
Sbjct:    4 YVRLQKIGQGSYATVFKGISRVTWQFVALKVVYIHEEEGAPFNTIREVSLLKTLKHANIVLLHDIVYTQHALTLVFEYLETDLHQYMERHPGGLNAHNVKLFLLQLLRGLAYTHSRGILHRDVKPHNLLLGVSGELKLADFGMARAQSVPSRSYSSEVATLWYRPPDVLLGSTRYSSGLDMWAVGCIFVEMLQGMVIFPGVPGVWDQLERVWQVLGTPNEEEWPEVTSLPLYKPGPVHPTAGSAAVLPTRAIL--LLRVRLGCDPHAEDLARSLLQCCPSRRLPAHAALRHSYFSDLP 299          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Sea Lamprey
Match: cdk2 (cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2741])

HSP 1 Score: 236.884 bits (603), Expect = 1.764e-73
Identity = 139/305 (45.57%), Postives = 191/305 (62.62%), Query Frame = 1
Query:  727 LESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLE-EAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNL-LELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPK-PKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLR 1632
            ++ + K E +G+GTY  VYK +  +T D VALK+++L+ E EG P TAIREI+LLR L HPNIV L D+I+ +  L LVFE+L+++LK+YM+    L + L +VKS+M QLL G+ FCH ++ LHRDLKPQNLLIN    +KLADFGLARA  +P + Y++EVVTLWYR P++LLG   YS  +D+W  GCIF EML  +ALFPG ++  QL  IF  LG+P +  W+ +       QL D+   P  P+     +++V          LL   L      R++A  AL   +FH    H   L+
Sbjct:    1 MDLFQKVEKIGEGTYGVVYKARHKMTGDTVALKKIRLDTETEGVPSTAIREIALLRELNHPNIVRLLDVIHSETKLYLVFEFLDQDLKKYMDNAPPLGISLPLVKSYMHQLLQGIAFCHAQRTLHRDLKPQNLLINADGAIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGCKYYSTAVDVWSLGCIFAEMLTRRALFPGDSEIDQLFRIFRTLGTPDETVWQGIT------QLPDYK--PSFPRWCAQDLTKVVPLLDAAGHDLLMQMLQYDPTRRVSAKAALNHHFFHNLEHHVPTLK 297          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005452.1 (pep scaffold:Pmarinus_7.0:GL478132:187054:200850:-1 gene:ENSPMAG00000004949.1 transcript:ENSPMAT00000005452.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 236.498 bits (602), Expect = 2.277e-73
Identity = 144/299 (48.16%), Postives = 192/299 (64.21%), Query Frame = 1
Query:  736 YNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDH-QLNIIFEKLGSPTDEEW-ELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKT-----QMDILLHGFLHIVGDCRLTASEALRESYFHEDP 1611
            Y + + +G+G+Y+TV+KG S +T  +VALK V + E EGAP   IRE+SLL+ L+H NIV LHDI+Y ++ LTLVFEYLE +L QYME     L    VK F+ QLL GL + H R ILHRD+KP NLL+    ELKLADFG+ARAQS+P+++YS+EV TLWYRPPD+LLG T YS  +D+W  GCIFVEML G  +FPG      QL  +++ LG+P +EEW E+  L  P ++  +F +    ++++ F   + K   T       + L    L      RL A  ALR SYF + P
Sbjct:    4 YVRLQKIGQGSYATVFKGISRVTWQFVALKVVYIHEEEGAPFNTIREVSLLKTLKHANIVLLHDIVYTQHALTLVFEYLETDLHQYMERHPGGLNAHNVKLFLLQLLRGLAYTHSRGILHRDVKPHNLLLGVSGELKLADFGMARAQSVPSRSYSSEVATLWYRPPDVLLGSTRYSSGLDMWAVGCIFVEMLQGMVIFPGVPGVWDQLERVWQVLGTPNEEEWPEVTSL--PLYKPGEFCL----ETIITFNEFLNKLLNTLGCDPHAEDLARSLLQCCPSRRLPAHAALRHSYFSDLP 296          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Yeast
Match: PHO85 (Cyclin-dependent kinase; has ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle; human lissencephaly-associated homolog CDK5 functionally complements null mutation [Source:SGD;Acc:S000005952])

HSP 1 Score: 271.166 bits (692), Expect = 1.078e-86
Identity = 153/302 (50.66%), Postives = 200/302 (66.23%), Query Frame = 1
Query:  736 YNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERN-----NLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDIL--LHGFLHIVGDCRLTASEALRESYFHEDPRHA 1620
            + + E LG GTY+TVYKG +  T  YVALKEVKL+  EG P TAIREISL++ L+H NIV L+D+I+ +N LTLVFE+++ +LK+YM+ R        LEL +VK F +QLL GL FCH+ KILHRDLKPQNLLIN++ +LKL DFGLARA  IP   +S+EVVTLWYR PD+L+G   YS  IDIW  GCI  EM+ GK LFPG  D+ QL +IF+ +G+P +  W  +  K PK+  +   I  +P   L  V +    E    +++  LHG L +  D RL+A +AL   +F E   HA
Sbjct:    7 FKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHENIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVT-KLPKYNPN---IQQRPPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQALHHPWFAEYYHHA 304          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Yeast
Match: CDC28 (Cyclin-dependent kinase (CDK) catalytic subunit; master regulator of mitotic and meiotic cell cycles; alternately associates with G1, S, G2/M phase cyclins, which provide substrate specificity; regulates metabolism, basal transcription, chromosome dynamics, growth and morphogenesis; transcript induction in osmostress involves antisense RNA; human homologs CDK1, CDK2, CDK3 can complement yeast conditional cdc28 mutants; human CDK1, CDK2 can complement yeast cdc28 null mutant [Source:SGD;Acc:S000000364])

HSP 1 Score: 210.305 bits (534), Expect = 1.227e-63
Identity = 119/234 (50.85%), Postives = 158/234 (67.52%), Query Frame = 1
Query:  721 GKLESYNKYEILGKGTYSTVYKGQSL---LTKDYVALKEVKLE-EAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNY-LTLVFEYLEKNLKQYME--ERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEW 1401
            G+L +Y + E +G+GTY  VYK   L     +  VALK+++LE E EG P TAIREISLL+ L+  NIV L+DI++   + L LVFE+L+ +LK+YME   ++  L   IVK FM QL  G+ +CH  +ILHRDLKPQNLLIN+   LKL DFGLARA  +P +AY++E+VTLWYR P++LLG   YS  +D W  GCIF EM N K +F G ++  Q+  IF  LG+P +  W
Sbjct:    3 GELANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREISLLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQLCKGIAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIW 236          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Yeast
Match: CTK1 (Catalytic (alpha) subunit of C-terminal domain kinase I (CTDK-I); phosphorylates both RNA pol II subunit Rpo21p to affect transcription and pre-mRNA 3' end processing, and ribosomal protein Rps2p to increase translational fidelity; required for H3K36 trimethylation but not dimethylation by Set2p; suggested stimulatory role in 80S formation during translation initiation; similar to the Drosophila dCDK12 and human CDK12 and probably CDK13 [Source:SGD;Acc:S000001622])

HSP 1 Score: 185.652 bits (470), Expect = 4.716e-52
Identity = 113/296 (38.18%), Postives = 177/296 (59.80%), Query Frame = 1
Query:  754 LGKGTYSTVYKGQSLLTKDYVALKEVKLE-EAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQ-KNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKA-YSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLL------HFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPR 1614
            +G+GTY  VYK ++  T+  VALK+++L+ E EG P T+IREI LL++  HPN+ T+ +I+ + +  + ++FEY + +L   +  +   +     K    QLL G+++ H  KILHRD+K  N+LI+ +  LK+ DFGLAR  +  ++A Y+N V+TLWYRPP+LLLG T+Y   +D+WG GC+ VE+ N  A+F G  +  Q+  IF+ +G+PT   W  L    P F    F+I+P+  +         F S +  S+  Q+ I L  +       R +A+EAL+  YF E+P+
Sbjct:  189 VGEGTYGKVYKAKNTNTEKLVALKKLRLQGEREGFPITSIREIKLLQSFDHPNVSTIKEIMVESQKTVYMIFEYADNDLSGLLLNKEVQISHSQCKHLFKQLLLGMEYLHDNKILHRDVKGSNILIDNQGNLKITDFGLARKMN--SRADYTNRVITLWYRPPELLLGTTNYGTEVDMWGCGCLLVELFNKTAIFQGSNELEQIESIFKIMGTPTINSWPTL-YDMPWF----FMIMPQQTTKYVNNFSEKFKSVLPSSKCLQLAINLLCYDQTK---RFSATEALQSDYFKEEPK 474          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Yeast
Match: KIN28 (Serine/threonine protein kinase, subunit of transcription factor TFIIH; involved in transcription initiation at RNA polymerase II promoters; phosphorylates Ser5 residue of the PolII C-terminal domain (CTD) at gene promoters; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000002266])

HSP 1 Score: 179.104 bits (453), Expect = 7.077e-52
Identity = 107/293 (36.52%), Postives = 160/293 (54.61%), Query Frame = 1
Query:  736 YNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEE-AEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDP 1611
            Y K + +G+GTY+ VY G    T   +A+KE+K  E  +G   +AIRE+  L+ ++HPN++ L DI    + L LV E+L  +L+  +++++ L     +K++M   L G+  CH+  ILHRDLKP NLL +   ++K+ADFGLARA   P +  ++ VVT WYR P+LL G   Y+  IDIW  G IF E++      PG  D  Q+ + F  LG+PTD +W     +   F   + + I  P S      R   + +  +D +  G L +    R TA + L   YF E P
Sbjct:    7 YTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWP----EVSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMC-GMLTMNPQKRWTAVQCLESDYFKELP 294          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Yeast
Match: SGV1 (Cyclin (Bur2p)-dependent protein kinase; part of the BUR kinase complex which functions in transcriptional regulation; phosphorylates the carboxy-terminal domain (CTD) of Rpo21p and the C-terminal repeat domain of Spt5p; recruits Spt6p to the CTD at the onset of transcription; regulated by Cak1p; similar to metazoan CDK9 proteins [Source:SGD;Acc:S000006365])

HSP 1 Score: 156.762 bits (395), Expect = 4.512e-41
Identity = 114/345 (33.04%), Postives = 177/345 (51.30%), Query Frame = 1
Query:  688 QKRHSLSEFGFGKLES-YNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLE-EAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKN-------------YLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLAR------------AQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLD-LKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLP 1638
            +KR S   +G    ++ Y + E LG+GT+  VYKG  L T+  VA+K++ +  E +  P TA REI++L+ L H NI+ L +++Y  +                ++  Y+  +L   +      LE+  +K+ M Q+L GL++ H  K +HRD+K  N+LI+    LKLADFGLAR              +     Y++ VVT WYR P+L+LG   Y+  +DIWG GC+F E    K +  G TD  Q ++IF+ LG+PT+E+W +   L   +   +++    KP     F   +    +T +D L    L +    RLTA  A    +F EDP  +  + LP
Sbjct:   43 RKRSSEKVYGCTVFQNHYREDEKLGQGTFGEVYKGIHLETQRQVAMKKIIVSVEKDLFPITAQREITILKRLNHKNIIKLIEMVYDHSPDITNAASSNLHKSFYMILPYMVADLSGVLHNPRINLEMCDIKNMMLQILEGLNYIHCAKFMHRDIKTANILIDHNGVLKLADFGLARLYYGCPPNLKYPGGAGSGAKYTSVVVTRWYRAPELVLGDKQYTTAVDIWGVGCVFAEFFEKKPILQGKTDIDQGHVIFKLLGTPTEEDWAVARYLPGAELTTTNY----KPTLRERFGKYL---SETGLDFLGQ-LLALDPYKRLTAMSAKHHPWFKEDPLPSEKITLP 379          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Nematostella
Match: EDO48117 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK70])

HSP 1 Score: 322.398 bits (825), Expect = 8.336e-106
Identity = 175/328 (53.35%), Postives = 229/328 (69.82%), Query Frame = 1
Query:  706 SEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDSTY 1689
            SE G+GK+E+Y K + LG+GTY+TV+KG+S LT + VALKE++LE  EGAPCTAIRE+SLL+ L+H NIVTLHD ++ +  LTLVFEYLEK+LKQYM++   ++ +  V+ F+FQLL GLD+CH+RK+LHRDLKPQNLLIN+K ELKLADFGLARA+S+PTK YSNEVVTLWYRPPD+LLG T YS  ID+WG GCIF EM  G+ LFPG T + +L +IF+ LG+P++E W  +      F    F   P+   ++H   R++ S       LL  FL      R++A +A+R  YF+       NL    S F+L    L +D  Y
Sbjct:    1 SELGYGKMETYTKLDKLGEGTYATVFKGKSKLTDNIVALKEIRLEHEEGAPCTAIREVSLLKGLKHANIVTLHDTVHTQKSLTLVFEYLEKDLKQYMDDCGGIMSMNNVRIFLFQLLRGLDYCHKRKVLHRDLKPQNLLINDKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTAYSTQIDMWGVGCIFFEMATGRPLFPGSTVEDELLLIFKVLGTPSEEVWPGIS-ANEAFIAGKFPDYPRENLIIH-APRLDNSGLE----LLEKFLEYTVKDRVSAHDAMRHDYFYSLGTRCLNLGDLDSLFSLEEIRLTKDPGY 322          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Nematostella
Match: EDO43819 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXQ4])

HSP 1 Score: 282.337 bits (721), Expect = 7.008e-89
Identity = 158/324 (48.77%), Postives = 221/324 (68.21%), Query Frame = 1
Query:  718 FGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFP---GHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRD 1680
            +G+LESY K E LG+G+Y+TV+KG     K  VALK+++L+E EGAP TAIRE SLL+ L+H NIV LHDII+ K+ L  VFE+L+ +L  Y+E+ +  +     + F FQLL GL + H RKILHRD+KPQNLLI+E+ ELKLADFGLARA+S+P++ YS+EVVTLWYRPPD+LLG  +Y+  +DIWGAGCIFVEML G ALFP   GH D  QLN I++ LG+PTDE W  +  K P++   D  I  +P+ +   + R+   E  +   L+   + +    R++A EA+R +YF   P+  Y +R   + +++S   + ++
Sbjct:  118 YGRLESYQKLEPLGEGSYATVFKGLCTANKKIVALKQIRLQEEEGAPFTAIREASLLKQLKHGNIVKLHDIIHTKDTLMFVFEFLDTDLNCYLEKYSRGICPHNTQLFCFQLLRGLAYIHDRKILHRDIKPQNLLISERGELKLADFGLARAKSVPSQTYSHEVVTLWYRPPDVLLGSKNYTTSLDIWGAGCIFVEMLTGIALFPGLNGHID--QLNKIWQVLGTPTDETWPGVS-KLPEYD-PDIFINFRPRRIGQCIPRLVPIEGAEQ--LVIRMIQLDPKNRISAREAMRSTYFSNLPKEIYTIRDEDTIYSVSGVEIQKE 435          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Nematostella
Match: EDO49420 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGF7])

HSP 1 Score: 250.751 bits (639), Expect = 1.584e-78
Identity = 141/295 (47.80%), Postives = 196/295 (66.44%), Query Frame = 1
Query:  727 LESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEA-EGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLN-GKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHE 1605
            ++ Y+K E +G+GTY TV+KG++  T++ +ALK V+L++  EG P +A+REI LL+ L+H NIV L+D+++ +  LTLVFE+ +++LK+Y +     ++  +VKSFMFQLL GL FCH   +LHRDLKPQNLLIN+  ELKLADFGLARA  IP + +S EVVTLWYRPPD+L+G   YS  ID+W AGCIF EM N G+ LFPG+  D QL  IF+ LG+PT+E W  +       +L D+   P     +     V K   T  D LL   L      R++A +A++ +YF +
Sbjct:    1 MQKYDKLEKIGEGTYGTVFKGKNKETREILALKRVRLDDDDEGVPSSALREICLLKELKHNNIVRLYDVLHSEKKLTLVFEFCDQDLKKYFDSCQGEVDASVVKSFMFQLLRGLAFCHSHNVLHRDLKPQNLLINKDGELKLADFGLARAFGIPVRCFSAEVVTLWYRPPDVLMGAKLYSTSIDMWSAGCIFAEMANGGRPLFPGNDVDDQLRRIFKILGTPTEESWPNVS------KLPDYKEFPPQGPSVSLGMVVPKLSSTGRD-LLQKLLVSNPAHRISAEDAMKHAYFAD 288          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Nematostella
Match: EDO41403 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4F0])

HSP 1 Score: 236.113 bits (601), Expect = 6.185e-73
Identity = 134/304 (44.08%), Postives = 199/304 (65.46%), Query Frame = 1
Query:  727 LESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLE-EAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYME-ERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEW----ELLDLKT--PKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPR 1614
            +E++ K E +G+GTY  VYK +   T   VALK+++L+ E+EG P TAIREISLL+ L HPN+V+L D+++ +  L LVFE+L ++LK+YM+    + +   ++KS+++QLLSG+ +CH  ++LHRDLKPQNLLI++   +KLADFGLARA  +P ++Y++EVVTLWYR P++LLG   Y+  +D+W  GCIF EM   +ALFPG ++  QL  IF  LG+P D+ W    EL D KT  PK+ +         +S+ H +  +   + T +D LL   L    + R++A  AL   +F +  R
Sbjct:    1 MENFEKVEKIGEGTYGVVYKARDKTTGRMVALKKIRLDTESEGVPSTAIREISLLKELNHPNVVSLLDVVHNQKSLYLVFEFLSQDLKKYMDCLPPSGISTSLIKSYVYQLLSGVAYCHSHRVLHRDLKPQNLLIDKNGAIKLADFGLARAFGVPVRSYTHEVVTLWYRAPEILLGSRYYATPVDVWSIGCIFAEMKTRRALFPGDSEIDQLFRIFRTLGTPDDKVWPGVSELPDYKTSFPKWPV---------QSIRHVLPTL---DNTAID-LLQKMLTYQPNARISAKAALSHEFFKDVQR 291          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Nematostella
Match: EDO43671 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXS1])

HSP 1 Score: 226.098 bits (575), Expect = 4.659e-69
Identity = 135/306 (44.12%), Postives = 193/306 (63.07%), Query Frame = 1
Query:  727 LESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLE-EAEGAPCTAIREISLLRNLRH-PNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDI----LLHGFLHIVGDCRLTASEALRESYFHEDPRHAYN 1626
            ++ ++K E +G+GTY  VYK ++L T  + ALK+++LE E EG P TA+REISLL+ LRH PN+V L  I++Q+  L LVFEYL  +LK++++    +L+  +VKS+++Q+ + + FCH R+ILHRDLKPQNLLI+ K  +KLADFGL RA  IP +AY++EVVTLWYR P++LLG   YS  ID+W  G IF EM+  + LF G ++  QL  IF  LG+PT+E W+ +        L D+    KP +   +     K    Q+D     LL   L      R++A  +L+  YF  DP+   N
Sbjct:    1 MDDFSKIEKIGEGTYGVVYKAKNLKTGGFAALKKIRLEVEDEGIPSTAVREISLLKELRHHPNVVELQHILHQEPKLYLVFEYLTCDLKKHLDTTRGMLDKTLVKSYLYQITNAIYFCHARRILHRDLKPQNLLIDSKGLIKLADFGLGRAFGIPVRAYTHEVVTLWYRAPEVLLGGQRYSCPIDVWSIGTIFAEMVTKRPLFHGDSEIDQLFRIFRILGTPTEETWKGVT------SLPDY----KP-TFPKWAGDGLKKAVPQLDSDGLDLLKKMLIYDPALRISAKTSLKHPYFLNDPKFDIN 295          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Medaka
Match: ENSORLT00000011316.2 (cyclin-dependent kinase 17 [Source:NCBI gene;Acc:101161555])

HSP 1 Score: 338.191 bits (866), Expect = 1.761e-109
Identity = 181/335 (54.03%), Postives = 241/335 (71.94%), Query Frame = 1
Query:  676 MSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRD 1680
            MSRR +R SLSE GFGKLE+Y K + LG+GTY+TV+KG+S LT + VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+    LTLVFEYLEK+LKQYM++  N++ +  VK F++QLL GL +CH+RK+LHRDLKPQNLLI+EK ELKLADFGLARA+S+PTK YSNEVVTLWYRPPD+LLG T+YS  ID+WG GCIF EM+ G+ LFPG T + +L++IF  LG+PT++ W  +   + +F+  +F +  + + L++   R++         LL   L      R++A +AL+ SYF         L    S F++    L +D
Sbjct:  121 MSRRLRRASLSEIGFGKLETYIKLDKLGEGTYATVFKGRSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTDKCLTLVFEYLEKDLKQYMDDCGNIMSVNNVKIFLYQLLRGLAYCHRRKVLHRDLKPQNLLISEKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCIFYEMITGRPLFPGSTVEDELHLIFRVLGTPTEKTWPGMP-TSEEFKTYNFPLY-RAEPLVNHAPRIDSDGHD----LLSKLLQFDAKKRVSAEDALKHSYFRSLGEQVQTLPDTASIFSVKGIQLQKD 449          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Medaka
Match: ENSORLT00000011319.2 (cyclin-dependent kinase 17 [Source:NCBI gene;Acc:101161555])

HSP 1 Score: 337.806 bits (865), Expect = 5.202e-109
Identity = 181/335 (54.03%), Postives = 241/335 (71.94%), Query Frame = 1
Query:  676 MSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRD 1680
            MSRR +R SLSE GFGKLE+Y K + LG+GTY+TV+KG+S LT + VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+    LTLVFEYLEK+LKQYM++  N++ +  VK F++QLL GL +CH+RK+LHRDLKPQNLLI+EK ELKLADFGLARA+S+PTK YSNEVVTLWYRPPD+LLG T+YS  ID+WG GCIF EM+ G+ LFPG T + +L++IF  LG+PT++ W  +   + +F+  +F +  + + L++   R++         LL   L      R++A +AL+ SYF         L    S F++    L +D
Sbjct:  139 MSRRLRRASLSEIGFGKLETYIKLDKLGEGTYATVFKGRSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTDKCLTLVFEYLEKDLKQYMDDCGNIMSVNNVKIFLYQLLRGLAYCHRRKVLHRDLKPQNLLISEKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCIFYEMITGRPLFPGSTVEDELHLIFRVLGTPTEKTWPGMP-TSEEFKTYNFPLY-RAEPLVNHAPRIDSDGHD----LLSKLLQFDAKKRVSAEDALKHSYFRSLGEQVQTLPDTASIFSVKGIQLQKD 467          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Medaka
Match: ENSORLT00000011315.2 (cyclin-dependent kinase 17 [Source:NCBI gene;Acc:101161555])

HSP 1 Score: 337.421 bits (864), Expect = 9.398e-109
Identity = 181/335 (54.03%), Postives = 241/335 (71.94%), Query Frame = 1
Query:  676 MSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRD 1680
            MSRR +R SLSE GFGKLE+Y K + LG+GTY+TV+KG+S LT + VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+    LTLVFEYLEK+LKQYM++  N++ +  VK F++QLL GL +CH+RK+LHRDLKPQNLLI+EK ELKLADFGLARA+S+PTK YSNEVVTLWYRPPD+LLG T+YS  ID+WG GCIF EM+ G+ LFPG T + +L++IF  LG+PT++ W  +   + +F+  +F +  + + L++   R++         LL   L      R++A +AL+ SYF         L    S F++    L +D
Sbjct:  131 MSRRLRRASLSEIGFGKLETYIKLDKLGEGTYATVFKGRSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTDKCLTLVFEYLEKDLKQYMDDCGNIMSVNNVKIFLYQLLRGLAYCHRRKVLHRDLKPQNLLISEKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCIFYEMITGRPLFPGSTVEDELHLIFRVLGTPTEKTWPGMP-TSEEFKTYNFPLY-RAEPLVNHAPRIDSDGHD----LLSKLLQFDAKKRVSAEDALKHSYFRSLGEQVQTLPDTASIFSVKGIQLQKD 459          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Medaka
Match: ENSORLT00000036083.1 (cyclin-dependent kinase 17 [Source:NCBI gene;Acc:101161555])

HSP 1 Score: 337.421 bits (864), Expect = 9.398e-109
Identity = 181/335 (54.03%), Postives = 241/335 (71.94%), Query Frame = 1
Query:  676 MSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRD 1680
            MSRR +R SLSE GFGKLE+Y K + LG+GTY+TV+KG+S LT + VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDII+    LTLVFEYLEK+LKQYM++  N++ +  VK F++QLL GL +CH+RK+LHRDLKPQNLLI+EK ELKLADFGLARA+S+PTK YSNEVVTLWYRPPD+LLG T+YS  ID+WG GCIF EM+ G+ LFPG T + +L++IF  LG+PT++ W  +   + +F+  +F +  + + L++   R++         LL   L      R++A +AL+ SYF         L    S F++    L +D
Sbjct:  131 MSRRLRRASLSEIGFGKLETYIKLDKLGEGTYATVFKGRSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTDKCLTLVFEYLEKDLKQYMDDCGNIMSVNNVKIFLYQLLRGLAYCHRRKVLHRDLKPQNLLISEKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCIFYEMITGRPLFPGSTVEDELHLIFRVLGTPTEKTWPGMP-TSEEFKTYNFPLY-RAEPLVNHAPRIDSDGHD----LLSKLLQFDAKKRVSAEDALKHSYFRSLGEQVQTLPDTASIFSVKGIQLQKD 459          
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Medaka
Match: ENSORLT00000011705.2 (cyclin-dependent kinase 17 [Source:NCBI gene;Acc:101161849])

HSP 1 Score: 336.65 bits (862), Expect = 3.134e-108
Identity = 179/332 (53.92%), Postives = 243/332 (73.19%), Query Frame = 1
Query:  709 EFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNLSCSSLNRDSTYCQTSY 1704
            E GFGKLE+Y K + LG+GTY+TV+KG+S LT + VALKE++LE  EGAPCTAIRE+SLL++L+H NIVTLHDI++ +  LTLVFEYL+K+LKQYM++  N++ +  VK F+FQ+L GL +CH+RK+LHRDLKPQNLLINEK ELKLADFGLARA+S+PTK YSNEVVTLWYRPPD+LLG ++YS  ID+WG GCIF EM  G+ LFPG T + +L++IF  LG+PT+++W  +     +F+  +F    KP+ L++   R++      +++LL  FL      R++A EA+++SYF +     + L   +S F L    L RD  Y  +SY
Sbjct:  186 EIGFGKLETYIKLDKLGEGTYATVFKGRSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIVHTEKSLTLVFEYLDKDLKQYMDDCGNIMSMHNVKVFLFQILRGLSYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSSEYSTQIDMWGVGCIFYEMAAGRPLFPGSTVEDELHLIFRLLGTPTEDKWPGIS-SIEEFKSYNFPKY-KPQPLINHAPRLDGD---GIELLL-SFLKYESKARISADEAMKQSYFRQLGTRVHALPENVSIFTLKEVQLQRDPGYRNSSY 511          
BLAST of Cyclin-dependent kinase 17 vs. Planmine SMEST
Match: SMESG000050786.1 (SMESG000050786.1)

HSP 1 Score: 764.992 bits (1974), Expect = 0.000e+0
Identity = 422/423 (99.76%), Postives = 422/423 (99.76%), Query Frame = 1
Query:  112 MKKTLKKLSLYPXXXXXXXXXXXXXXXXSKNELRLSAENNCKLELENITTPTMKYRTKNYLTKKRKYSVPTKLFNKITIFHPRHRKRSLSLSGENVVVNKSDHDEATLSKSHDNFDINIKGGMIQNLEFNIDTMNDSSSDLTVPCRRFSEINXXXXXXXXXXXXXXXYLYNHPKGNRLSVINIISQPRMSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLG 1380
            MKKTLKKLSLYPLNNKLEKEFENLNQLKSKNELRLSAENNCKLELENITTPTMKYRTKNYLTKKRKYSVPTKLFNKITIFHPRHRKRSLSLSGENVVVNKSDHDEATLSKSHDNFDINIKGGMIQNLEFNIDTMNDSSSDLTVPCRRFSEINLSSTSTSSPLLTPPPYL NHPKGNRLSVINIISQPRMSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQNLLINEKNELKLADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLG
Sbjct:    1 MKKTLKKLSLYPLNNKLEKEFENLNQLKSKNELRLSAENNCKLELENITTPTMKYRTKNYLTKKRKYSVPTKLFNKITIFHPRHRKRSLSLSGENVVVNKSDHDEATLSKSHDNFDINIKGGMIQNLEFNIDTMNDSSSDLTVPCRRFSEINLSSTSTSSPLLTPPPYLCNHPKGNRLSVINIISQPRMSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQNLLINEKNELKLADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLG 423          
BLAST of Cyclin-dependent kinase 17 vs. Planmine SMEST
Match: SMESG000023149.1 (SMESG000023149.1)

HSP 1 Score: 333.954 bits (855), Expect = 4.882e-106
Identity = 171/309 (55.34%), Postives = 226/309 (73.14%), Query Frame = 1
Query:  676 MSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXX-XXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYF 1599
            M+++ +R+SL+E GFGKLESY K + LG+GTY+TV+KG+S LT+  VALKE++LE  EGAPCTAIRE+SLLRNL H N+VTLHDII+    LTLVFEYL K+LKQYME+  N++ +  V+ F++Q+L GL +CH+R+ILHRDLKPQNLLIN  + +LKLADFGLARA+SIP K YSNEVVTLWYRPPD+LLG T+YS  ID+WG GCI  EM  G+ +FPG T D +L +IF+ LG P++  W  +     +F    F     P+SL + V R++ +  +    LL G L   G  R++A +A++  YF
Sbjct:  260 MTKKDRRYSLAEIGFGKLESYTKLDKLGQGTYATVFKGRSRLTESLVALKEIRLEHEEGAPCTAIREVSLLRNLHHANVVTLHDIIHTVKSLTLVFEYLHKDLKQYMEDCANIMSMNNVQIFLYQILRGLAYCHRRRILHRDLKPQNLLINPVRGDLKLADFGLARAKSIPIKTYSNEVVTLWYRPPDVLLGSTNYSTQIDMWGVGCILFEMAAGRPMFPGSTVDEELQLIFKTLGVPSEATWPGIS-SNKEFTSRQFNASESPQSLFNLVPRLQFTGVS----LLTGLLEYQGKKRISAEDAMQHDYF 563          
BLAST of Cyclin-dependent kinase 17 vs. Planmine SMEST
Match: SMESG000023149.1 (SMESG000023149.1)

HSP 1 Score: 333.569 bits (854), Expect = 5.287e-106
Identity = 171/309 (55.34%), Postives = 226/309 (73.14%), Query Frame = 1
Query:  676 MSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXX-XXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYF 1599
            M+++ +R+SL+E GFGKLESY K + LG+GTY+TV+KG+S LT+  VALKE++LE  EGAPCTAIRE+SLLRNL H N+VTLHDII+    LTLVFEYL K+LKQYME+  N++ +  V+ F++Q+L GL +CH+R+ILHRDLKPQNLLIN  + +LKLADFGLARA+SIP K YSNEVVTLWYRPPD+LLG T+YS  ID+WG GCI  EM  G+ +FPG T D +L +IF+ LG P++  W  +     +F    F     P+SL + V R++ +  +    LL G L   G  R++A +A++  YF
Sbjct:  259 MTKKDRRYSLAEIGFGKLESYTKLDKLGQGTYATVFKGRSRLTESLVALKEIRLEHEEGAPCTAIREVSLLRNLHHANVVTLHDIIHTVKSLTLVFEYLHKDLKQYMEDCANIMSMNNVQIFLYQILRGLAYCHRRRILHRDLKPQNLLINPVRGDLKLADFGLARAKSIPIKTYSNEVVTLWYRPPDVLLGSTNYSTQIDMWGVGCILFEMAAGRPMFPGSTVDEELQLIFKTLGVPSEATWPGIS-SNKEFTSRQFNASESPQSLFNLVPRLQFTGVS----LLTGLLEYQGKKRISAEDAMQHDYF 562          
BLAST of Cyclin-dependent kinase 17 vs. Planmine SMEST
Match: SMESG000023149.1 (SMESG000023149.1)

HSP 1 Score: 333.569 bits (854), Expect = 8.272e-106
Identity = 171/309 (55.34%), Postives = 226/309 (73.14%), Query Frame = 1
Query:  676 MSRRQKRHSLSEFGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXX-XXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYF 1599
            M+++ +R+SL+E GFGKLESY K + LG+GTY+TV+KG+S LT+  VALKE++LE  EGAPCTAIRE+SLLRNL H N+VTLHDII+    LTLVFEYL K+LKQYME+  N++ +  V+ F++Q+L GL +CH+R+ILHRDLKPQNLLIN  + +LKLADFGLARA+SIP K YSNEVVTLWYRPPD+LLG T+YS  ID+WG GCI  EM  G+ +FPG T D +L +IF+ LG P++  W  +     +F    F     P+SL + V R++ +  +    LL G L   G  R++A +A++  YF
Sbjct:  275 MTKKDRRYSLAEIGFGKLESYTKLDKLGQGTYATVFKGRSRLTESLVALKEIRLEHEEGAPCTAIREVSLLRNLHHANVVTLHDIIHTVKSLTLVFEYLHKDLKQYMEDCANIMSMNNVQIFLYQILRGLAYCHRRRILHRDLKPQNLLINPVRGDLKLADFGLARAKSIPIKTYSNEVVTLWYRPPDVLLGSTNYSTQIDMWGVGCILFEMAAGRPMFPGSTVDEELQLIFKTLGVPSEATWPGIS-SNKEFTSRQFNASESPQSLFNLVPRLQFTGVS----LLTGLLEYQGKKRISAEDAMQHDYF 578          
BLAST of Cyclin-dependent kinase 17 vs. Planmine SMEST
Match: SMESG000048066.1 (SMESG000048066.1)

HSP 1 Score: 284.648 bits (727), Expect = 1.559e-86
Identity = 159/319 (49.84%), Postives = 212/319 (66.46%), Query Frame = 1
Query:  718 FGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPCTAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNNLLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQXXXXXXXXXXXXADFGLARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEMLNGKALFPGHTD-DHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFV-----IIPKPKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDPRHAYNLRLPMSNFNL 1656
            FGK +SY K ++LG+G+Y+TV+KG S LT   VALKE+++   EG P TAIRE SLL+NLRH NIV LHDI++ K  LT VFEY+  +L +Y+E   + ++   +K F+FQLL GL FCH+R+ILHRDLKPQNLLI+E  ELKLADFGLARA+S+P++ YSNEVVTLWYRPPD+LLG TDY+  +D+WG GCIFVEM+ G A+FPG  D D QL  IF+ +GSP ++ W  +    P +QL  F+     +  K + L   V R+        + L   FL I  + R+    A+   YF +  +    L   MS F++
Sbjct:  313 FGKSDSYQKLDMLGEGSYATVFKGYSNLTNQTVALKEIRINSEEGVPFTAIREASLLKNLRHANIVILHDIVHAKETLTFVFEYVHSDLSKYIERHPHGIKPHNIKLFLFQLLRGLGFCHERRILHRDLKPQNLLISEIGELKLADFGLARAKSVPSRTYSNEVVTLWYRPPDVLLGSTDYNAALDMWGVGCIFVEMIGGSAIFPGLKDTDDQLEKIFKVMGSPNEKVWPGVST-LPNYQL--FIMNRGNVCYKGRPLHRHVQRL--FTIPHAESLALAFLQIRPELRVLTRAAMSHPYFDDLSKQLLYLPHNMSVFSV 626          
The following BLAST results are available for this feature:
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CDK161.671e-10952.05cyclin dependent kinase 16 [Source:HGNC Symbol;Acc... [more]
CDK166.505e-10952.05cyclin dependent kinase 16 [Source:HGNC Symbol;Acc... [more]
CDK167.823e-10952.05cyclin dependent kinase 16 [Source:HGNC Symbol;Acc... [more]
CDK167.823e-10952.05cyclin dependent kinase 16 [Source:HGNC Symbol;Acc... [more]
CDK161.543e-10752.05cyclin dependent kinase 16 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pct-14.250e-10854.21Cyclin-dependent kinase 17 [Source:UniProtKB/Swis... [more]
pct-17.864e-10854.21Cyclin-dependent kinase 17 [Source:UniProtKB/Swis... [more]
pct-17.864e-10854.21Cyclin-dependent kinase 17 [Source:UniProtKB/Swis... [more]
pct-17.864e-10854.21Cyclin-dependent kinase 17 [Source:UniProtKB/Swis... [more]
ZC123.41.796e-7848.60pep chromosome:WBcel235:I:841742:846763:-1 gene:WB... [more]
back to top
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eip63E2.838e-9149.40gene:FBgn0005640 transcript:FBtr0110922[more]
Eip63E3.582e-9149.40gene:FBgn0005640 transcript:FBtr0110920[more]
Eip63E3.582e-9149.40gene:FBgn0005640 transcript:FBtr0302598[more]
Eip63E3.609e-9149.40gene:FBgn0005640 transcript:FBtr0073131[more]
Eip63E3.609e-9149.40gene:FBgn0005640 transcript:FBtr0073132[more]
back to top
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk168.714e-10956.65cyclin-dependent kinase 16 [Source:ZFIN;Acc:ZDB-GE... [more]
cdk161.852e-10856.65cyclin-dependent kinase 16 [Source:ZFIN;Acc:ZDB-GE... [more]
cdk161.724e-10667.36cyclin-dependent kinase 16 [Source:ZFIN;Acc:ZDB-GE... [more]
cdk176.972e-10652.21cyclin-dependent kinase 17 [Source:ZFIN;Acc:ZDB-GE... [more]
CDK184.020e-10456.13si:dkey-166c18.1 [Source:ZFIN;Acc:ZDB-GENE-141215-... [more]
back to top
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
g3bp23.529e-11156.59G3BP stress granule assembly factor 2 [Source:Xenb... [more]
g3bp24.090e-11156.59G3BP stress granule assembly factor 2 [Source:Xenb... [more]
g3bp25.985e-11156.59G3BP stress granule assembly factor 2 [Source:Xenb... [more]
g3bp22.132e-11057.23G3BP stress granule assembly factor 2 [Source:Xenb... [more]
g3bp22.189e-11058.65G3BP stress granule assembly factor 2 [Source:Xenb... [more]
back to top
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cdk161.350e-10852.33cyclin-dependent kinase 16 [Source:MGI Symbol;Acc:... [more]
Cdk162.329e-10852.33cyclin-dependent kinase 16 [Source:MGI Symbol;Acc:... [more]
Cdk175.797e-10552.21cyclin-dependent kinase 17 [Source:MGI Symbol;Acc:... [more]
Cdk171.159e-10452.21cyclin-dependent kinase 17 [Source:MGI Symbol;Acc:... [more]
Cdk181.809e-10353.24cyclin-dependent kinase 18 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Cyclin-dependent kinase 17 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q00536|CDK16_HUMAN3.757e-10852.05Cyclin-dependent kinase 16 OS=Homo sapiens OX=9606... [more]
sp|Q04735|CDK16_MOUSE9.442e-10852.33Cyclin-dependent kinase 16 OS=Mus musculus OX=1009... [more]
sp|Q63686|CDK16_RAT3.527e-10752.05Cyclin-dependent kinase 16 OS=Rattus norvegicus OX... [more]
sp|Q8I7M8|CDK17_CAEEL1.000e-10654.21Cyclin-dependent kinase 17 OS=Caenorhabditis elega... [more]
sp|O35832|CDK18_RAT3.304e-10553.82Cyclin-dependent kinase 18 OS=Rattus norvegicus OX... [more]
back to top
BLAST of Cyclin-dependent kinase 17 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A016X3E86.871e-11353.16Protein kinase domain-containing protein OS=Ancylo... [more]
A0A016X2K15.011e-11253.16Protein kinase domain-containing protein OS=Ancylo... [more]
A0A016X2D37.892e-11253.16Protein kinase domain-containing protein OS=Ancylo... [more]
A0A3Q2R1G44.880e-11154.62Cyclin-dependent kinase 16 OS=Fundulus heteroclitu... [more]
A0A3Q2Q3401.409e-11054.62Cyclin-dependent kinase 16 OS=Fundulus heteroclitu... [more]
back to top
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk168.479e-11157.28cyclin-dependent kinase 16 [Source:ZFIN;Acc:ZDB-GE... [more]
ENSAMXT00000030743.12.431e-10953.35cyclin-dependent kinase 17-like [Source:NCBI gene;... [more]
ENSAMXT00000015072.25.360e-10953.62cyclin-dependent kinase 17-like [Source:NCBI gene;... [more]
ENSAMXT00000039233.11.099e-10853.35cyclin-dependent kinase 17-like [Source:NCBI gene;... [more]
ENSAMXT00000048139.11.884e-10853.35cyclin-dependent kinase 17-like [Source:NCBI gene;... [more]
back to top
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008013.15.114e-10756.82pep scaffold:Pmarinus_7.0:GL478839:10839:40406:1 g... [more]
ENSPMAT00000005451.16.027e-7749.34pep scaffold:Pmarinus_7.0:GL478132:187045:200874:-... [more]
ENSPMAT00000005447.19.511e-7447.99pep scaffold:Pmarinus_7.0:GL478132:187042:200850:-... [more]
cdk21.764e-7345.57cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSPMAT00000005452.12.277e-7348.16pep scaffold:Pmarinus_7.0:GL478132:187054:200850:-... [more]
back to top
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PHO851.078e-8650.66Cyclin-dependent kinase; has ten cyclin partners; ... [more]
CDC281.227e-6350.85Cyclin-dependent kinase (CDK) catalytic subunit; m... [more]
CTK14.716e-5238.18Catalytic (alpha) subunit of C-terminal domain kin... [more]
KIN287.077e-5236.52Serine/threonine protein kinase, subunit of transc... [more]
SGV14.512e-4133.04Cyclin (Bur2p)-dependent protein kinase; part of t... [more]
back to top
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO481178.336e-10653.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438197.008e-8948.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494201.584e-7847.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414036.185e-7344.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436714.659e-6944.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cyclin-dependent kinase 17 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000011316.21.761e-10954.03cyclin-dependent kinase 17 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000011319.25.202e-10954.03cyclin-dependent kinase 17 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000011315.29.398e-10954.03cyclin-dependent kinase 17 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000036083.19.398e-10954.03cyclin-dependent kinase 17 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000011705.23.134e-10853.92cyclin-dependent kinase 17 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Cyclin-dependent kinase 17 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050786.10.000e+099.76SMESG000050786.1[more]
SMESG000023149.14.882e-10655.34SMESG000023149.1[more]
SMESG000023149.15.287e-10655.34SMESG000023149.1[more]
SMESG000023149.18.272e-10655.34SMESG000023149.1[more]
SMESG000048066.11.559e-8649.84SMESG000048066.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001570 ID=SMED30001570|Name=Cyclin-dependent kinase 17|organism=Schmidtea mediterranea sexual|type=transcript|length=1869bp
TGATATTGAAAAATATATTCTTAAAATAATATTTTTAAAAACATCTTATG
TAAGCTAATTTACGCTCTATAAATTTAAAAATGTGTTTTGATTCATAAAT
TATAAAATCAAATGAAAAAAACTCTGAAAAAACTTTCACTTTATCCACTG
AATAATAAATTGGAAAAGGAATTTGAAAACCTTAACCAACTCAAATCTAA
AAATGAGCTTAGATTATCGGCTGAAAATAATTGTAAACTGGAATTAGAAA
ACATTACAACTCCTACTATGAAATATCGAACAAAAAACTATCTGACAAAA
AAAAGAAAATACTCAGTTCCTACAAAGCTTTTCAACAAAATTACTATATT
TCATCCAAGACACAGAAAACGTTCACTAAGTTTATCCGGTGAGAATGTCG
TTGTAAATAAATCAGATCACGACGAGGCAACGTTGAGCAAAAGCCATGAT
AATTTTGACATAAACATCAAAGGAGGAATGATTCAAAATCTCGAGTTTAA
TATTGACACAATGAATGATTCTTCCTCAGATCTCACAGTGCCCTGTCGAA
GATTTAGTGAAATCAATTTGTCAAGTACTAGCACTTCTAGTCCTCTTTTG
ACTCCTCCGCCATATTTATACAACCACCCAAAAGGTAACAGATTATCTGT
AATAAATATTATTTCTCAACCAAGAATGTCTCGGCGGCAAAAACGACACT
CACTCTCAGAATTCGGATTTGGAAAATTGGAATCATACAATAAATACGAG
ATATTGGGCAAAGGAACATATTCAACAGTTTATAAAGGACAAAGCCTTCT
TACCAAGGATTATGTCGCATTGAAAGAAGTAAAACTCGAGGAAGCAGAAG
GAGCTCCATGTACAGCCATCCGAGAAATATCTCTACTTCGCAATCTGAGA
CATCCGAATATTGTCACTTTACATGATATAATTTATCAGAAAAACTATCT
CACTTTGGTATTTGAGTATTTAGAAAAGAATCTCAAGCAATACATGGAAG
AAAGAAATAACCTATTAGAGTTATTTATAGTAAAAAGCTTTATGTTTCAA
TTACTAAGCGGTTTGGATTTCTGTCATCAACGCAAAATACTCCACCGGGA
TTTGAAACCACAAAATTTATTAATCAACGAAAAAAATGAATTGAAATTAG
CGGATTTTGGATTAGCCAGAGCTCAATCTATACCTACTAAAGCTTATTCC
AATGAAGTGGTAACTTTGTGGTACCGCCCGCCAGATTTACTTTTGGGAAA
AACTGATTATTCAGGTCACATTGACATTTGGGGAGCTGGATGCATTTTTG
TAGAAATGTTAAACGGTAAAGCTTTATTCCCTGGTCACACTGATGACCAT
CAGCTTAATATCATCTTTGAAAAATTAGGTTCACCAACAGATGAAGAATG
GGAGCTATTAGATTTAAAAACTCCGAAATTTCAATTAAGCGACTTCGTTA
TTATTCCGAAACCGAAATCATTACTCCATTTTGTTTCAAGGGTTGAAAAA
TCTGAGAAGACCCAAATGGATATATTATTACACGGCTTCTTACATATTGT
TGGTGATTGTAGATTAACCGCAAGTGAAGCTCTTCGAGAGTCTTATTTTC
ATGAAGATCCAAGGCATGCATATAATCTCAGACTTCCAATGTCAAACTTC
AATCTATCTTGTTCTTCATTGAATCGAGACTCAACATATTGTCAGACCTC
TTACATTGACTGATTATCTAAACCTAACTGTCCAAGCCAAGATGTTATCA
TGTCATTACTGGATTAAAGGGCACCCCTAATAAAAATCAGCTTTTATGAA
AATCATTACGAAATGATAAATATTATGTTCTTTGGTCGTTTCTGTCATAT
TCAATTAATTAGTGCAATC
back to top

protein sequence of SMED30001570-orf-1

>SMED30001570-orf-1 ID=SMED30001570-orf-1|Name=SMED30001570-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=534bp
MKKTLKKLSLYPLNNKLEKEFENLNQLKSKNELRLSAENNCKLELENITT
PTMKYRTKNYLTKKRKYSVPTKLFNKITIFHPRHRKRSLSLSGENVVVNK
SDHDEATLSKSHDNFDINIKGGMIQNLEFNIDTMNDSSSDLTVPCRRFSE
INLSSTSTSSPLLTPPPYLYNHPKGNRLSVINIISQPRMSRRQKRHSLSE
FGFGKLESYNKYEILGKGTYSTVYKGQSLLTKDYVALKEVKLEEAEGAPC
TAIREISLLRNLRHPNIVTLHDIIYQKNYLTLVFEYLEKNLKQYMEERNN
LLELFIVKSFMFQLLSGLDFCHQRKILHRDLKPQNLLINEKNELKLADFG
LARAQSIPTKAYSNEVVTLWYRPPDLLLGKTDYSGHIDIWGAGCIFVEML
NGKALFPGHTDDHQLNIIFEKLGSPTDEEWELLDLKTPKFQLSDFVIIPK
PKSLLHFVSRVEKSEKTQMDILLHGFLHIVGDCRLTASEALRESYFHEDP
RHAYNLRLPMSNFNLSCSSLNRDSTYCQTSYID*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000017photoreceptor neuron
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0005515protein binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 14..34
NoneNo IPR availableCOILSCoilCoilcoord: 284..304
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 289..528
e-value: 2.6E-56
score: 192.6
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 206..288
e-value: 1.2E-29
score: 104.1
NoneNo IPR availablePANTHERPTHR24056CELL DIVISION PROTEIN KINASEcoord: 186..516
NoneNo IPR availablePANTHERPTHR24056:SF246CYCLIN-DEPENDENT KINASE 17coord: 186..516
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 209..496
e-value: 6.0E-84
score: 294.9
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 209..496
e-value: 2.3E-65
score: 220.6
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 209..496
score: 41.234
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 326..338
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 215..238
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 204..500