RING-type domain-containing protein

Overview
NameRING-type domain-containing protein
Smed IDSMED30001548
Length (bp)2170
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RING-type domain-containing protein (SMED30001548) t-SNE clustered cells

Violin plots show distribution of expression levels for RING-type domain-containing protein (SMED30001548) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RING-type domain-containing protein (SMED30001548) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RING-type domain-containing protein (SMED30001548) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001548

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30001548SMESG000020467.1 Contig2029GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30001548SMESG000020467.1 dd_Smed_v4_2039_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001548SMESG000020467.1 dd_Smed_v4_2039_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: AC079594.2 (TRIM59 and iFT80 readthrough)

HSP 1 Score: 58.5362 bits (140), Expect = 4.041e-8
Identity = 29/84 (34.52%), Postives = 41/84 (48.81%), Query Frame = 1
Query:  388 MSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCL-------IRMSISVNFSCPVCRRYCEIDQKTVCLLPPSIATKQLTD 618
            M   E+ + CPI   + EDPR+LPC H FC NCL + L       I   + +   CP CR   EI    +  LP + A + + +
Sbjct:    1 MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENILQASGNFYIWRPLRIPLKCPNCRSITEIAPTGIESLPVNFALRAIIE 84          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: TRIM59 (tripartite motif containing 59 [Source:HGNC Symbol;Acc:HGNC:30834])

HSP 1 Score: 56.9954 bits (136), Expect = 6.840e-8
Identity = 29/84 (34.52%), Postives = 41/84 (48.81%), Query Frame = 1
Query:  388 MSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCL-------IRMSISVNFSCPVCRRYCEIDQKTVCLLPPSIATKQLTD 618
            M   E+ + CPI   + EDPR+LPC H FC NCL + L       I   + +   CP CR   EI    +  LP + A + + +
Sbjct:    1 MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENILQASGNFYIWRPLRIPLKCPNCRSITEIAPTGIESLPVNFALRAIIE 84          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: TRIM59 (tripartite motif containing 59 [Source:HGNC Symbol;Acc:HGNC:30834])

HSP 1 Score: 56.225 bits (134), Expect = 7.957e-8
Identity = 29/84 (34.52%), Postives = 41/84 (48.81%), Query Frame = 1
Query:  388 MSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCL-------IRMSISVNFSCPVCRRYCEIDQKTVCLLPPSIATKQLTD 618
            M   E+ + CPI   + EDPR+LPC H FC NCL + L       I   + +   CP CR   EI    +  LP + A + + +
Sbjct:    1 MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENILQASGNFYIWRPLRIPLKCPNCRSITEIAPTGIESLPVNFALRAIIE 84          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: TRIM59 (tripartite motif containing 59 [Source:HGNC Symbol;Acc:HGNC:30834])

HSP 1 Score: 52.373 bits (124), Expect = 1.061e-7
Identity = 29/84 (34.52%), Postives = 41/84 (48.81%), Query Frame = 1
Query:  388 MSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCL-------IRMSISVNFSCPVCRRYCEIDQKTVCLLPPSIATKQLTD 618
            M   E+ + CPI   + EDPR+LPC H FC NCL + L       I   + +   CP CR   EI    +  LP + A + + +
Sbjct:    1 MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENILQASGNFYIWRPLRIPLKCPNCRSITEIAPTGIESLPVNFALRAIIE 84          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: TRIM59 (tripartite motif containing 59 [Source:HGNC Symbol;Acc:HGNC:30834])

HSP 1 Score: 53.9138 bits (128), Expect = 1.067e-7
Identity = 29/84 (34.52%), Postives = 41/84 (48.81%), Query Frame = 1
Query:  388 MSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCL-------IRMSISVNFSCPVCRRYCEIDQKTVCLLPPSIATKQLTD 618
            M   E+ + CPI   + EDPR+LPC H FC NCL + L       I   + +   CP CR   EI    +  LP + A + + +
Sbjct:    1 MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENILQASGNFYIWRPLRIPLKCPNCRSITEIAPTGIESLPVNFALRAIIE 84          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: nhl-1 (RING finger protein nhl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q03601])

HSP 1 Score: 53.9138 bits (128), Expect = 4.718e-7
Identity = 23/53 (43.40%), Postives = 31/53 (58.49%), Query Frame = 1
Query:  388 MSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVNFSCPVCR 546
            + K+E L+ CPI L   + P++LPC H FC  CL SC    ++  N  CP CR
Sbjct:   34 LEKIEQLLTCPICLDRYKQPKLLPCQHTFCYPCLESCAD--TLHRNLKCPECR 84          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: nhl-1 (RING finger protein nhl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q03601])

HSP 1 Score: 53.5286 bits (127), Expect = 4.770e-7
Identity = 23/53 (43.40%), Postives = 31/53 (58.49%), Query Frame = 1
Query:  388 MSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVNFSCPVCR 546
            + K+E L+ CPI L   + P++LPC H FC  CL SC    ++  N  CP CR
Sbjct:   34 LEKIEQLLTCPICLDRYKQPKLLPCQHTFCYPCLESCAD--TLHRNLKCPECR 84          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: ftr43 (finTRIM family, member 43 [Source:ZFIN;Acc:ZDB-GENE-090507-8])

HSP 1 Score: 57.3806 bits (137), Expect = 3.644e-8
Identity = 18/50 (36.00%), Postives = 34/50 (68.00%), Query Frame = 1
Query:  400 EDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVNFSCPVCRR 549
            +D  MCP+ L +++DP  +PCGH++C++C+  C  +      +SCP+C++
Sbjct:   10 QDQFMCPVCLNLLQDPVTIPCGHSYCMSCITDCWNQEEQKRIYSCPLCKQ 59          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: ftr43 (finTRIM family, member 43 [Source:ZFIN;Acc:ZDB-GENE-090507-8])

HSP 1 Score: 57.3806 bits (137), Expect = 3.644e-8
Identity = 18/50 (36.00%), Postives = 34/50 (68.00%), Query Frame = 1
Query:  400 EDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVNFSCPVCRR 549
            +D  MCP+ L +++DP  +PCGH++C++C+  C  +      +SCP+C++
Sbjct:   10 QDQFMCPVCLNLLQDPVTIPCGHSYCMSCITDCWNQEEQKRIYSCPLCKQ 59          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: ftr64 (finTRIM family, member 64 [Source:ZFIN;Acc:ZDB-GENE-090508-8])

HSP 1 Score: 57.7658 bits (138), Expect = 3.722e-8
Identity = 20/58 (34.48%), Postives = 37/58 (63.79%), Query Frame = 1
Query:  376 SRMSMSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVNFSCPVCRR 549
            +  S+S  +D   CP+ L +++DP  +PCGH++C+ C+  C  +  ++  +SCP CR+
Sbjct:    2 AEASISVAQDQFSCPVCLDLLKDPVTIPCGHSYCMRCITDCWNQEDLTGVYSCPQCRQ 59          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: ftr50 (finTRIM family, member 50 [Source:ZFIN;Acc:ZDB-GENE-080215-17])

HSP 1 Score: 56.9954 bits (136), Expect = 4.296e-8
Identity = 20/55 (36.36%), Postives = 36/55 (65.45%), Query Frame = 1
Query:  385 SMSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVNFSCPVCRR 549
            S+S  ED   CP+ L +++DP  +PCGH++C++C+  C  +      +SCP+C++
Sbjct:    5 SVSWAEDQFTCPVCLDVLQDPVTIPCGHSYCMSCITDCWNQEEQKRIYSCPLCKQ 59          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: ftr50 (finTRIM family, member 50 [Source:ZFIN;Acc:ZDB-GENE-080215-17])

HSP 1 Score: 55.4546 bits (132), Expect = 1.153e-7
Identity = 19/55 (34.55%), Postives = 35/55 (63.64%), Query Frame = 1
Query:  385 SMSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVNFSCPVCRR 549
             +S  ED  MCP+ L +++ P  +PCGH++C++C+  C  +      +SCP+C++
Sbjct:    5 GVSWAEDQFMCPVCLDLLKSPVTIPCGHSYCMSCITDCWNQEEQKRIYSCPLCKQ 59          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000037685.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:96816:98381:-1 gene:ENSXETG00000014555.1 transcript:ENSXETT00000037685.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 1.213e-7
Identity = 23/55 (41.82%), Postives = 31/55 (56.36%), Query Frame = 1
Query:  382 MSMSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVNFSCPVCR 546
            M+ + L+D + C I L +  DP +LPCGH FC  C+   L     S  +SCP CR
Sbjct:    1 MATADLQDELSCSICLSIYTDPVMLPCGHNFCRGCIGGVLDAQGGSGGYSCPECR 55          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000037681.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:96816:98381:-1 gene:ENSXETG00000014555.1 transcript:ENSXETT00000037681.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 1.485e-7
Identity = 23/55 (41.82%), Postives = 31/55 (56.36%), Query Frame = 1
Query:  382 MSMSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVNFSCPVCR 546
            M+ + L+D + C I L +  DP +LPCGH FC  C+   L     S  +SCP CR
Sbjct:    1 MATADLQDELSCSICLSIYTDPVMLPCGHNFCRGCIGGVLDAQGGSGGYSCPECR 55          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000026455.1 (tripartite motif containing 59 [Source:NCBI gene;Acc:100493536])

HSP 1 Score: 54.299 bits (129), Expect = 4.152e-7
Identity = 30/84 (35.71%), Postives = 39/84 (46.43%), Query Frame = 1
Query:  388 MSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCL-------YSCLIRMSISVNFSCPVCRRYCEIDQKTVCLLPPSIATKQLTD 618
            M   ED + C +   + +DPRILPC H FC NCL        S L R S +    CP CR   E+       LP + A K + +
Sbjct:    1 MDNFEDELTCSVCYNIFDDPRILPCSHTFCRNCLEKVIHSSGSGLWRTS-AAWLKCPSCRNTSELTMSGTLALPINFALKSIVE 83          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: pitrm1 (pitrilysin metallopeptidase 1 [Source:Xenbase;Acc:XB-GENE-952658])

HSP 1 Score: 54.299 bits (129), Expect = 6.819e-7
Identity = 26/68 (38.24%), Postives = 35/68 (51.47%), Query Frame = 1
Query:  364 LKRNSRMSMSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSIS-------VNFSCPVCR 546
            LK N +++M  LE  + CPI L + EDP +LPC H+ C +C +  L     S         F CP CR
Sbjct:    6 LKPNVQLNMETLESELTCPICLELFEDPLLLPCAHSLCFSCAHRILTSGCASNEIAEPVPAFQCPTCR 73          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000011866.1 (tripartite motif-containing protein 7 [Source:NCBI gene;Acc:100489697])

HSP 1 Score: 53.9138 bits (128), Expect = 8.301e-7
Identity = 23/55 (41.82%), Postives = 30/55 (54.55%), Query Frame = 1
Query:  382 MSMSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVNFSCPVCR 546
            M+ + L D + C I L +  DP +LPCGH FC  C+   L     S  +SCP CR
Sbjct:    1 MAAADLRDELSCSICLSIYTDPVMLPCGHNFCRGCIGGVLGTQEGSGRYSCPECR 55          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Trim59 (tripartite motif-containing 59 [Source:MGI Symbol;Acc:MGI:1914199])

HSP 1 Score: 56.9954 bits (136), Expect = 5.403e-8
Identity = 29/84 (34.52%), Postives = 41/84 (48.81%), Query Frame = 1
Query:  388 MSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCL-------IRMSISVNFSCPVCRRYCEIDQKTVCLLPPSIATKQLTD 618
            M   E+ + CPI   + EDPR+LPC H FC NCL + L       I   + +   CP CR   EI    +  LP + A + + +
Sbjct:    1 MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENVLQASGNFYIWRPLRIPLKCPNCRSIIEIASTGIESLPVNFALRAIIE 84          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Trim59 (tripartite motif-containing 59 [Source:MGI Symbol;Acc:MGI:1914199])

HSP 1 Score: 56.6102 bits (135), Expect = 5.846e-8
Identity = 29/84 (34.52%), Postives = 41/84 (48.81%), Query Frame = 1
Query:  388 MSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCL-------IRMSISVNFSCPVCRRYCEIDQKTVCLLPPSIATKQLTD 618
            M   E+ + CPI   + EDPR+LPC H FC NCL + L       I   + +   CP CR   EI    +  LP + A + + +
Sbjct:    1 MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENVLQASGNFYIWRPLRIPLKCPNCRSIIEIASTGIESLPVNFALRAIIE 84          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Mid1 (midline 1 [Source:MGI Symbol;Acc:MGI:1100537])

HSP 1 Score: 54.299 bits (129), Expect = 4.605e-7
Identity = 28/84 (33.33%), Postives = 42/84 (50.00%), Query Frame = 1
Query:  388 MSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSI------SVN-FSCPVCRRYCEIDQKTVCLLPPSIATKQLTD 618
            M  LE  + CPI L + EDP +LPC H+ C NC +  L+          S+N F CP CR    + Q+ +  L  ++  + + D
Sbjct:    1 METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCATNEPVESINAFQCPTCRHVITLSQRGLDGLKRNVTLQNIID 84          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rnf135 (ring finger protein 135 [Source:MGI Symbol;Acc:MGI:1919206])

HSP 1 Score: 53.9138 bits (128), Expect = 5.354e-7
Identity = 21/53 (39.62%), Postives = 34/53 (64.15%), Query Frame = 1
Query:  400 EDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVN---FSCPVCRR 549
            ED + C I  G+++ P  LPCGH+FCL CL+   +    +V+   ++CP+CR+
Sbjct:   16 EDDLSCIICQGLLDQPTTLPCGHSFCLRCLHDLWVSKRGAVDGCPWACPICRK 68          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Mid1 (midline 1 [Source:MGI Symbol;Acc:MGI:1100537])

HSP 1 Score: 54.299 bits (129), Expect = 5.426e-7
Identity = 28/84 (33.33%), Postives = 42/84 (50.00%), Query Frame = 1
Query:  388 MSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSI------SVN-FSCPVCRRYCEIDQKTVCLLPPSIATKQLTD 618
            M  LE  + CPI L + EDP +LPC H+ C NC +  L+          S+N F CP CR    + Q+ +  L  ++  + + D
Sbjct:    1 METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCATNEPVESINAFQCPTCRHVITLSQRGLDGLKRNVTLQNIID 84          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8IWR1|TRI59_HUMAN (Tripartite motif-containing protein 59 OS=Homo sapiens OX=9606 GN=TRIM59 PE=1 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 3.285e-7
Identity = 29/84 (34.52%), Postives = 41/84 (48.81%), Query Frame = 1
Query:  388 MSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCL-------IRMSISVNFSCPVCRRYCEIDQKTVCLLPPSIATKQLTD 618
            M   E+ + CPI   + EDPR+LPC H FC NCL + L       I   + +   CP CR   EI    +  LP + A + + +
Sbjct:    1 MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENILQASGNFYIWRPLRIPLKCPNCRSITEIAPTGIESLPVNFALRAIIE 84          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q922Y2|TRI59_MOUSE (Tripartite motif-containing protein 59 OS=Mus musculus OX=10090 GN=Trim59 PE=1 SV=2)

HSP 1 Score: 56.9954 bits (136), Expect = 3.779e-7
Identity = 29/84 (34.52%), Postives = 41/84 (48.81%), Query Frame = 1
Query:  388 MSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCL-------IRMSISVNFSCPVCRRYCEIDQKTVCLLPPSIATKQLTD 618
            M   E+ + CPI   + EDPR+LPC H FC NCL + L       I   + +   CP CR   EI    +  LP + A + + +
Sbjct:    1 MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENVLQASGNFYIWRPLRIPLKCPNCRSIIEIASTGIESLPVNFALRAIIE 84          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q32L60|TRI13_BOVIN (E3 ubiquitin-protein ligase TRIM13 OS=Bos taurus OX=9913 GN=TRIM13 PE=2 SV=2)

HSP 1 Score: 54.299 bits (129), Expect = 2.836e-6
Identity = 26/59 (44.07%), Postives = 34/59 (57.63%), Query Frame = 1
Query:  388 MSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCL---IRMSI--SVNFSCPVCRR 549
            M  LE+ + CPI   + +DPR+LPC H FC  CL   L   +R S+  S  F CP CR+
Sbjct:    1 MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGNVRNSLWRSSPFKCPTCRK 59          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|P82458|TRI18_RAT (E3 ubiquitin-protein ligase Midline-1 OS=Rattus norvegicus OX=10116 GN=Mid1 PE=2 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 3.115e-6
Identity = 28/84 (33.33%), Postives = 42/84 (50.00%), Query Frame = 1
Query:  388 MSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSI------SVN-FSCPVCRRYCEIDQKTVCLLPPSIATKQLTD 618
            M  LE  + CPI L + EDP +LPC H+ C NC +  L+          S+N F CP CR    + Q+ +  L  ++  + + D
Sbjct:    1 METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCATNEPVESINAFQCPTCRHVITLSQRGLDGLKRNVTLQNIID 84          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|O15344|TRI18_HUMAN (E3 ubiquitin-protein ligase Midline-1 OS=Homo sapiens OX=9606 GN=MID1 PE=1 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 3.308e-6
Identity = 26/84 (30.95%), Postives = 40/84 (47.62%), Query Frame = 1
Query:  388 MSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSIS-------VNFSCPVCRRYCEIDQKTVCLLPPSIATKQLTD 618
            M  LE  + CPI L + EDP +LPC H+ C NC +  L+    +         F CP CR    + Q+ +  L  ++  + + D
Sbjct:    1 METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCATNESVESITAFQCPTCRHVITLSQRGLDGLKRNVTLQNIID 84          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A267ECL9 (RING-type domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004309g1 PE=4 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 2.300e-35
Identity = 85/323 (26.32%), Postives = 165/323 (51.08%), Query Frame = 1
Query:  934 IRENMRKYSEYKLLRDVNHSIVNFHSSGRNKMIIADIKLLNHEAEV--IVWTSVHGNLIAVKTPDHSVHDFTIQIDSCEVKPIFLKIYNNELFLSGYIENSATKEKHYYLIQSSLTGELIH-----TSVFNSSHDITTKIAGFHIDPGSGKILLAIPDACKIAIMTSNLVETSHGYHFTDLHPSFITQNQDTAEIWASCPQDGRIIIIDEETGSYRQLGTDQIYNAIPSHITISGDNRVMFLDCRQNRVFWVRKRNDFILIQRINFIGHHNKQLNGKMTAMVAISGTDTLG--RLLFVIGSNAYLVRPAKAIGGQNHKLCNIL 1875
            IR NMR++S YKL +++    ++    G    I A   + + E +V  I+  S   +L+   + D  + DF + +    ++  ++   N  +++SG + + +       ++   L G +I       +   S   +    AGFH+D   G++++A P   K+  +T  L  T H + F +LHP  +T  ++   +W SCP +G I+I+++ TG YR+L T QI++++P+HI  + D R++F D ++ RVFW+ +R++FI +QR+ F           +  +  I+G   LG  ++L       Y ++P + +  +    C+++
Sbjct:  308 IRHNMRRHSSYKL-KEIETGFLDLQHPGAGLEIGAAGLIADPEDQVDMILLNSCSHSLLLYSSQDGRLKDFPVVLGGHRMRCYYMTFSNGLVYVSGVVPSDSATRWTSAIVCVQLDGLVIRRLERPGAAAGSDEPL---FAGFHVDERRGELVVAQPADQKVEFLTPALARTGHWFTFENLHPHHVTWTRERRMLWVSCPSEGHILIVNDRTGVYRKLTTTQIFDSVPAHIITTSDKRIIFTDNQRQRVFWIIRRSEFIFVQRLEF-----------LQELADITGIAPLGEDKILVCTKRKLYFLKPTRKLRRRRRPRCDLM 615          

HSP 2 Score: 66.2402 bits (160), Expect = 2.085e-7
Identity = 34/100 (34.00%), Postives = 48/100 (48.00%), Query Frame = 1
Query:  373 NSRMSMSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISV----------NFSCPVCRRYCEIDQKTVCLLPPSIATKQLTDYIVETKSR 642
            +S  S+ +LE+L  C IHLG +  PR+LPC H FCL CL     +               + +CP+CR    +    V  LP + A + + DYI E   R
Sbjct:   64 DSSGSVEQLEELTTCAIHLGQLSQPRLLPCSHVFCLACLARWESQQQQKKQQQQVPASHGSLACPLCRVSVRLPPDGVRALPTAAAHQSIADYIAERHCR 163          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A267DTD7 (RING-type domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004309g2 PE=4 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 7.432e-35
Identity = 85/323 (26.32%), Postives = 164/323 (50.77%), Query Frame = 1
Query:  934 IRENMRKYSEYKLLRDVNHSIVNFHSSGRNKMIIADIKLLNHEAEV--IVWTSVHGNLIAVKTPDHSVHDFTIQIDSCEVKPIFLKIYNNELFLSGYIENSATKEKHYYLIQSSLTGELIH-----TSVFNSSHDITTKIAGFHIDPGSGKILLAIPDACKIAIMTSNLVETSHGYHFTDLHPSFITQNQDTAEIWASCPQDGRIIIIDEETGSYRQLGTDQIYNAIPSHITISGDNRVMFLDCRQNRVFWVRKRNDFILIQRINFIGHHNKQLNGKMTAMVAISGTDTLG--RLLFVIGSNAYLVRPAKAIGGQNHKLCNIL 1875
            IR NMR++S YKL +++    ++    G    I A   + + E +V  I+  S   +L+   + D  + DF + +    ++  ++   N  +++SG + + +       +    L G +I       +   S   +    AGFH+D   G++++A P   K+  +T  L  T H + F +LHP  +T  ++   +W SCP +G I+I+++ TG YR+L T QI++++P+HI  + D R++F D ++ RVFW+ +R++FI +QR+ F           +  +  I+G   LG  ++L       Y ++P + +  +    C+++
Sbjct:  308 IRHNMRRHSSYKL-KEIETGFLDLQHPGAGLEIGAAGLIADPEDQVDMILLNSCSHSLLLYSSQDGRLKDFPVVLGGHRMRCYYMTFTNGLVYVSGVVPSDSATRWTSAIACVQLDGLVIRRLERPGAAAGSDEPL---FAGFHVDERRGELVVAQPADQKVEFLTPALARTGHWFTFENLHPHHVTWTRERRMLWVSCPSEGHILIVNDRTGVYRKLTTTQIFDSVPAHIITTSDKRIIFTDNQRQRVFWIIRRSEFIFVQRLEF-----------LQELADITGIAPLGEDKILVCTKRKLYFLKPTRKLRRRRRPRCDLM 615          

HSP 2 Score: 66.2402 bits (160), Expect = 2.139e-7
Identity = 34/100 (34.00%), Postives = 48/100 (48.00%), Query Frame = 1
Query:  373 NSRMSMSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISV----------NFSCPVCRRYCEIDQKTVCLLPPSIATKQLTDYIVETKSR 642
            +S  S+ +LE+L  C IHLG +  PR+LPC H FCL CL     +               + +CP+CR    +    V  LP + A + + DYI E   R
Sbjct:   64 DSSGSVEQLEELTTCAIHLGQLSQPRLLPCSHVFCLACLARWESQQQQKKQQQQVPASHGSLACPLCRVSVRLPPDGVRALPTAAAHQSIADYIAERHCR 163          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A267FRC4 (RING-type domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004309g3 PE=4 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 8.006e-35
Identity = 85/323 (26.32%), Postives = 164/323 (50.77%), Query Frame = 1
Query:  934 IRENMRKYSEYKLLRDVNHSIVNFHSSGRNKMIIADIKLLNHEAEV--IVWTSVHGNLIAVKTPDHSVHDFTIQIDSCEVKPIFLKIYNNELFLSGYIENSATKEKHYYLIQSSLTGELIH-----TSVFNSSHDITTKIAGFHIDPGSGKILLAIPDACKIAIMTSNLVETSHGYHFTDLHPSFITQNQDTAEIWASCPQDGRIIIIDEETGSYRQLGTDQIYNAIPSHITISGDNRVMFLDCRQNRVFWVRKRNDFILIQRINFIGHHNKQLNGKMTAMVAISGTDTLG--RLLFVIGSNAYLVRPAKAIGGQNHKLCNIL 1875
            IR NMR++S YKL +++    ++    G    I A   + + E +V  I+  S   +L+   + D  + DF + +    ++  ++   N  +++SG + + +       +    L G +I       +   S   +    AGFH+D   G++++A P   K+  +T  L  T H + F +LHP  +T  ++   +W SCP +G I+I+++ TG YR+L T QI++++P+HI  + D R++F D ++ RVFW+ +R++FI +QR+ F           +  +  I+G   LG  ++L       Y ++P + +  +    C+++
Sbjct:  308 IRHNMRRHSSYKL-KEIETGFLDLQHPGAGLEIGAAGLIADPEDQVDMILLNSCSHSLLLYSSQDGRLKDFPVVLGGHRMRCYYMTFSNGLVYVSGVVPSDSATRWTSAIACVQLDGLVIRRLERPGAAAGSDEPL---FAGFHVDERRGELVVAQPADQKVEFLTPALARTGHWFTFENLHPHHVTWTRERRMLWVSCPSEGHILIVNDRTGVYRKLTTTQIFDSVPAHIITTSDKRIIFTDNQRQRVFWIIRRSEFIFVQRLEF-----------LQELADITGIAPLGEDKILVCTKRKLYFLKPTRKLRRRRRPRCDLM 615          

HSP 2 Score: 66.2402 bits (160), Expect = 2.139e-7
Identity = 34/100 (34.00%), Postives = 48/100 (48.00%), Query Frame = 1
Query:  373 NSRMSMSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISV----------NFSCPVCRRYCEIDQKTVCLLPPSIATKQLTDYIVETKSR 642
            +S  S+ +LE+L  C IHLG +  PR+LPC H FCL CL     +               + +CP+CR    +    V  LP + A + + DYI E   R
Sbjct:   64 DSSGSVEQLEELTTCAIHLGQLSQPRLLPCSHVFCLACLARWESQQQQKKQQQQVPASHGSLACPLCRVSVRLPPDGVRALPTAAAHQSIADYIAERHCR 163          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A1I8IQ65 (RING-type domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 1.075e-34
Identity = 86/328 (26.22%), Postives = 167/328 (50.91%), Query Frame = 1
Query:  919 MDVETIRENMRKYSEYKLLRDVNHSIVNFHSSGRNKMIIADIKLLNHEAEV--IVWTSVHGNLIAVKTPDHSVHDFTIQIDSCEVKPIFLKIYNNELFLSGYIENSATKEKHYYLIQSSLTGELIH-----TSVFNSSHDITTKIAGFHIDPGSGKILLAIPDACKIAIMTSNLVETSHGYHFTDLHPSFITQNQDTAEIWASCPQDGRIIIIDEETGSYRQLGTDQIYNAIPSHITISGDNRVMFLDCRQNRVFWVRKRNDFILIQRINFIGHHNKQLNGKMTAMVAISGTDTLG--RLLFVIGSNAYLVRPAKAIGGQNHKLCNIL 1875
            +D+  IR NMR++S YKL +++    ++    G    I A   + + E +V  I+  S   +L+   + D  + DF + +    ++  ++   N  +++SG + + +       +    L G +I       +   S   +    AGFH+D   G++++A P   K+  +T  L  T H + F +LHP  +T  ++   +W SCP +G I+I+++ TG YR+L T QI++++P+HI  + D R++F D ++ RVFW+ +R++FI +QR+ F+             +  I+G   LG  ++L       Y ++P + +  +    C+++
Sbjct: 1452 LDLSFIRHNMRRHSSYKL-KEIETGFLDLQHPGAGLEIGAAGLIADPEDQVDMILLNSCSHSLLLYSSQDGRLKDFPVVLGGHRMRCYYMTFSNGLVYVSGVVPSDSATRWTSAIACVQLDGLVIRRLERPGAAAGSDEPL---FAGFHVDERRGELVVAQPADQKVEFLTPALARTGHWFTFENLHPHHVTWTRERRMLWVSCPSEGHILIVNDRTGVYRKLTTTQIFDSVPAHIITTSDKRIIFTDNQRQRVFWIIRRSEFIFVQRLEFLQE-----------LADITGIAPLGEDKILVCTKRKLYFLKPTRKLRRRRRPRCDLM 1764          

HSP 2 Score: 67.0106 bits (162), Expect = 1.666e-7
Identity = 34/100 (34.00%), Postives = 48/100 (48.00%), Query Frame = 1
Query:  373 NSRMSMSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISV----------NFSCPVCRRYCEIDQKTVCLLPPSIATKQLTDYIVETKSR 642
            +S  S+ +LE+L  C IHLG +  PR+LPC H FCL CL     +               + +CP+CR    +    V  LP + A + + DYI E   R
Sbjct: 1227 DSSGSVEQLEELTTCAIHLGQLSQPRLLPCSHVFCLACLARWESQQQQKKQQQQVPASHGSLACPLCRVSVRLPPDGVRALPTAAAHQSIADYIAERHCR 1326          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A267GNM7 (RING-type domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015500g1 PE=4 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 2.758e-29
Identity = 75/289 (25.95%), Postives = 146/289 (50.52%), Query Frame = 1
Query:  913 ELMDVETIRENMRKYSEYKLLRDVNHSIVNFHSSGRNKMIIADIKLL------NHEAEVIVWTSVHGNLIAVKTPDHSVHDFTIQID----SCEVKPIFLKIYNNELFLSGYIENSATKEKHYYLIQSSLTGELIHTSVFNSSHDITTKI------------AGFHIDPGSGKILLAIPDACKIAIMTSNLVETSHGYHFTDLHPSFITQNQDTAEIWASCPQDGRIIIIDEETGSYRQLGTDQIYNAIPSHITISGDNRVMFLDCRQNRVFWVRKRNDFILIQRINFI 1713
            + +D+  IR NM++ S YK+      +  +   S R ++ I    LL        +AE+++  S   +L+   + +  + D  + I        ++   +++ N  +++SG +     +++       + TG L   +       +  +I            AGF +D   G +++A P   K+   T  L  T H + F +LHP ++T  ++   +W SCP +G I+I+++ TG YR+L T QI++++P+HI  + D R++F D ++ R+FWV +R++FI +QR+ F+
Sbjct:  317 DALDLSFIRHNMKRNSSYKMKEIDMGACADLLQSTRGELEIGAAGLLADADGSTDQAELVLLNSCSRSLLVYSSQEGQIKDLPVLIGDSNPGGRLQCHHMRLVNGLVYVSG-VAQQQQQQQQAADSTGAPTGWLSVVACLQLDGQVVKRIERPGGSRDEPLFAGFFVDSRRGDMVVAQPSDQKVEFFTPCLGRTGHWFTFENLHPQYVTWTRERKMLWVSCPAEGHILIVNDRTGVYRKLTTTQIFDSVPAHIITTSDKRIIFTDNQRQRLFWVIRRSEFIFVQRLQFL 604          

HSP 2 Score: 68.1662 bits (165), Expect = 4.876e-8
Identity = 31/82 (37.80%), Postives = 44/82 (53.66%), Query Frame = 1
Query:  397 LEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVNFSCPVCRRYCEIDQKTVCLLPPSIATKQLTDYIVETKSR 642
            LEDL  CPIHLG + +P++L C H FCL CL     +      F CP+CR    +    +  LPP+   + +  YIV+ + R
Sbjct:   38 LEDLTTCPIHLGRLHEPKLLNCSHVFCLTCLEKWDSQQPSRDRFPCPLCRVEARLPAGGLRCLPPAHVHQSIIKYIVDRQCR 119          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000035312.1 (pep primary_assembly:Astyanax_mexicanus-2.0:17:4121266:4123083:1 gene:ENSAMXG00000038784.1 transcript:ENSAMXT00000035312.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 1.074e-8
Identity = 25/59 (42.37%), Postives = 34/59 (57.63%), Query Frame = 1
Query:  370 RNSRMSMSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVNFSCPVCR 546
            RN   +  K  D + CPI L ++ DP  +PCGH+FCL+C+  C  R      +SCP CR
Sbjct:   17 RNMADAAVKTLDSLTCPICLDLLRDPVAIPCGHSFCLDCIKDCWHRDDQRGVYSCPQCR 75          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000005684.2 (tripartite motif-containing protein 16-like [Source:NCBI gene;Acc:103027621])

HSP 1 Score: 58.5362 bits (140), Expect = 1.124e-8
Identity = 23/59 (38.98%), Postives = 33/59 (55.93%), Query Frame = 1
Query:  370 RNSRMSMSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVNFSCPVCR 546
            R    +  K +D + CPI L +++DP  +PCGH+FCL C+  C         +SCP CR
Sbjct:    1 RAQHQAALKTQDSLSCPICLDLLKDPVTIPCGHSFCLGCIKDCWAGDDQRKVYSCPQCR 59          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000041324.1 (tripartite motif-containing protein 16-like [Source:NCBI gene;Acc:103027621])

HSP 1 Score: 57.3806 bits (137), Expect = 3.880e-8
Identity = 22/51 (43.14%), Postives = 31/51 (60.78%), Query Frame = 1
Query:  394 KLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVNFSCPVCR 546
            K +D + CPI L +++DP  +PCGH+FCL C+  C         +SCP CR
Sbjct:    7 KTQDSLSCPICLDLLKDPVTIPCGHSFCLGCIKDCWAGDDQRKVYSCPQCR 57          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000009928.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:10038151:10044079:-1 gene:ENSAMXG00000029758.1 transcript:ENSAMXT00000009928.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 4.431e-8
Identity = 22/51 (43.14%), Postives = 31/51 (60.78%), Query Frame = 1
Query:  394 KLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVNFSCPVCR 546
            K +D + CPI L +++DP  +PCGH+FCL C+  C         +SCP CR
Sbjct:    7 KTQDSLTCPICLDLLKDPVTIPCGHSFCLGCIKHCWAGDDQRKVYSCPQCR 57          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000040376.1 (pep primary_assembly:Astyanax_mexicanus-2.0:6:10033678:10044079:-1 gene:ENSAMXG00000029758.1 transcript:ENSAMXT00000040376.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 4.500e-8
Identity = 22/51 (43.14%), Postives = 31/51 (60.78%), Query Frame = 1
Query:  394 KLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVNFSCPVCR 546
            K +D + CPI L +++DP  +PCGH+FCL C+  C         +SCP CR
Sbjct:    7 KTQDSLTCPICLDLLKDPVTIPCGHSFCLGCIKHCWAGDDQRKVYSCPQCR 57          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010730.1 (pep scaffold:Pmarinus_7.0:GL485872:9458:10706:1 gene:ENSPMAG00000009719.1 transcript:ENSPMAT00000010730.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 5.187e-9
Identity = 29/84 (34.52%), Postives = 43/84 (51.19%), Query Frame = 1
Query:  388 MSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCL---IRMS----ISVNFSCPVCRRYCEIDQKTVCLLPPSIATKQLTD 618
            M+ LE+ + CP+   + EDPR+LPC H FC  CL   L   + +S    +   F CP CR  CE+       LP + + + + D
Sbjct:    1 MNFLEEELTCPVCYSLFEDPRVLPCSHTFCRGCLEDILQGSLHLSPWRPLRTPFKCPSCRHVCELPLTGFTSLPVNFSLRNIVD 84          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: trim59 (tripartite motif containing 59 [Source:ZFIN;Acc:ZDB-GENE-060724-2])

HSP 1 Score: 51.9878 bits (123), Expect = 2.117e-7
Identity = 25/75 (33.33%), Postives = 37/75 (49.33%), Query Frame = 1
Query:  388 MSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCL--------IRMSISVNFSCPVCRRYCEIDQKTVCLLP 588
            M  LE+ + CP+   + E+PR+LPC H FC  CL S L        +  ++ V   CP CR   ++    +  LP
Sbjct:    1 MEHLEEDLTCPVCFSLFEEPRVLPCSHTFCRRCLESVLQATVEQFPLWRALRVPLKCPSCRHMFDMPSAGLSYLP 75          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO27124 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TA48])

HSP 1 Score: 47.7506 bits (112), Expect = 8.096e-6
Identity = 20/53 (37.74%), Postives = 28/53 (52.83%), Query Frame = 1
Query:  388 MSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVNFSCPVCR 546
            + +L+  + CPI L   +DPR+LPC H FC  CL     R      + CP C+
Sbjct:    7 VERLQKEVECPICLERFKDPRVLPCLHTFCYECLVGLASRYKTEGKWPCPQCK 59          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO45801 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRQ3])

HSP 1 Score: 47.3654 bits (111), Expect = 8.469e-6
Identity = 20/51 (39.22%), Postives = 27/51 (52.94%), Query Frame = 1
Query:  394 KLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVNFSCPVCR 546
            +L+  + CPI L   +DPR+LPC H FC  CL     R      + CP C+
Sbjct:    9 RLQKEVECPICLERFKDPRVLPCLHTFCYECLVGLASRYKTEGKWPCPQCK 59          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000028079.1 (pep primary_assembly:ASM223467v1:18:3187730:3194930:1 gene:ENSORLG00000030336.1 transcript:ENSORLT00000028079.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 2.561e-8
Identity = 20/50 (40.00%), Postives = 35/50 (70.00%), Query Frame = 1
Query:  400 EDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVNFSCPVCRR 549
            E+ + C + LG++EDP  LPCGH++C++C+ +   + +  ++ SCP CRR
Sbjct:   12 EEALSCSVCLGLLEDPTTLPCGHSYCMSCIRTYWSKGNQRISPSCPQCRR 61          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000019661.2 (pep primary_assembly:ASM223467v1:13:32568675:32574156:1 gene:ENSORLG00000015701.2 transcript:ENSORLT00000019661.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 7.125e-8
Identity = 21/50 (42.00%), Postives = 32/50 (64.00%), Query Frame = 1
Query:  400 EDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVNFSCPVCRR 549
            ED   CP+ L +++DP  LPCGH++CL+C+ S   +      +SCP CR+
Sbjct:   18 EDSFACPVCLDVLKDPTTLPCGHSYCLSCIQSHWDKELSKGQYSCPQCRQ 67          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: mid1 (E3 ubiquitin-protein ligase Midline-1 [Source:NCBI gene;Acc:101168755])

HSP 1 Score: 55.4546 bits (132), Expect = 1.751e-7
Identity = 29/85 (34.12%), Postives = 43/85 (50.59%), Query Frame = 1
Query:  388 MSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIR--------MSISVNFSCPVCRRYCEIDQKTVCLLPPSIATKQLTD 618
            M  LE  + CPI L + EDP +LPC H+ C NC +  L+          SIS  F CP CR    ++Q+ +  L  ++  + + D
Sbjct:    1 METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCTPSEPIQSISA-FQCPTCRYVISLNQRGLEGLKRNVTLQNIID 84          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000015094.2 (pep primary_assembly:ASM223467v1:17:17654645:17656708:1 gene:ENSORLG00000012054.2 transcript:ENSORLT00000015094.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 1.764e-7
Identity = 24/52 (46.15%), Postives = 33/52 (63.46%), Query Frame = 1
Query:  391 SKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVNFSCPVCR 546
            S+LE+L+ CP+   +  DPR LPCGH+ CL+CL + L+  S      CP CR
Sbjct:    7 SRLEELLTCPVCQDIFSDPRQLPCGHSMCLSCLNN-LLDHSSDSPLRCPDCR 57          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: mid1 (E3 ubiquitin-protein ligase Midline-1 [Source:NCBI gene;Acc:101168755])

HSP 1 Score: 55.0694 bits (131), Expect = 2.257e-7
Identity = 29/85 (34.12%), Postives = 43/85 (50.59%), Query Frame = 1
Query:  388 MSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIR--------MSISVNFSCPVCRRYCEIDQKTVCLLPPSIATKQLTD 618
            M  LE  + CPI L + EDP +LPC H+ C NC +  L+          SIS  F CP CR    ++Q+ +  L  ++  + + D
Sbjct:    1 METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCTPSEPIQSISA-FQCPTCRYVISLNQRGLEGLKRNVTLQNIID 84          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000020467.1 (SMESG000020467.1)

HSP 1 Score: 1098.96 bits (2841), Expect = 0.000e+0
Identity = 538/540 (99.63%), Postives = 540/540 (100.00%), Query Frame = 1
Query:  256 MATAEVKVNMPTSRASSIEKRDRNRSYLEDNNLLKHLKRNSRMSMSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVNFSCPVCRRYCEIDQKTVCLLPPSIATKQLTDYIVETKSRLFMKQHPNMEYLSNXXXXXXXXXXVDQKRELVKHLIREISEYTKSKSNQEQFHEILKSIDTPLVIESQPSESENAILHSVTNMEIFNSNYELMDVETIRENMRKYSEYKLLRDVNHSIVNFHSSGRNKMIIADIKLLNHEAEVIVWTSVHGNLIAVKTPDHSVHDFTIQIDSCEVKPIFLKIYNNELFLSGYIENSATKEKHYYLIQSSLTGELIHTSVFNSSHDITTKIAGFHIDPGSGKILLAIPDACKIAIMTSNLVETSHGYHFTDLHPSFITQNQDTAEIWASCPQDGRIIIIDEETGSYRQLGTDQIYNAIPSHITISGDNRVMFLDCRQNRVFWVRKRNDFILIQRINFIGHHNKQLNGKMTAMVAISGTDTLGRLLFVIGSNAYLVRPAKAIGGQNHKLCNIL 1875
            MATAEVKVNMPTSRASSIEKRDRNRSYLEDNNLLKHLKRNSRMSMSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVNFSCPVCRRYCEIDQKTVCLLPPSIATKQLTDYIVETKSRLFMKQHPNMEYLSNESIIESISTTVDQKRELVKHLIREISEYTKSKSNQEQFHEILKSIDTPLVIESQPSESENAILHSVTNMEIFNSNYELMDVETIRENMRKYSEYKLLRDVNHSIVNFHSSGRNKMIIADIKLLNHEAEVIVWTSVHGNLIAVKTPDHSVHDFTIQIDSCEVKPIFLKIYNN+LFLSGYIENSATKEKHYYLIQSSLTGELIHTSVFNSSHDITTKIAGFHIDPGSGKILLAIPDACKIAI+TSNLVETSHGYHFTDLHPSFITQNQDTAEIWASCPQDGRIIIIDEETGSYRQLGTDQIYNAIPSHITISGDNRVMFLDCRQNRVFWVRKRNDFILIQRINFIGHHNKQLNGKMTAMVAISGTDTLGRLLFVIGSNAYLVRPAKAIGGQNHKLCNIL
Sbjct:    1 MATAEVKVNMPTSRASSIEKRDRNRSYLEDNNLLKHLKRNSRMSMSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVNFSCPVCRRYCEIDQKTVCLLPPSIATKQLTDYIVETKSRLFMKQHPNMEYLSNESIIESISTTVDQKRELVKHLIREISEYTKSKSNQEQFHEILKSIDTPLVIESQPSESENAILHSVTNMEIFNSNYELMDVETIRENMRKYSEYKLLRDVNHSIVNFHSSGRNKMIIADIKLLNHEAEVIVWTSVHGNLIAVKTPDHSVHDFTIQIDSCEVKPIFLKIYNNDLFLSGYIENSATKEKHYYLIQSSLTGELIHTSVFNSSHDITTKIAGFHIDPGSGKILLAIPDACKIAILTSNLVETSHGYHFTDLHPSFITQNQDTAEIWASCPQDGRIIIIDEETGSYRQLGTDQIYNAIPSHITISGDNRVMFLDCRQNRVFWVRKRNDFILIQRINFIGHHNKQLNGKMTAMVAISGTDTLGRLLFVIGSNAYLVRPAKAIGGQNHKLCNIL 540          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000064098.1 (SMESG000064098.1)

HSP 1 Score: 215.312 bits (547), Expect = 2.619e-61
Identity = 165/542 (30.44%), Postives = 271/542 (50.00%), Query Frame = 1
Query:  313 KRDRNRSYLEDNNLLKHLKRNSRMSMSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCL--YSCLIRMSISVNFSCPVCRRYCEIDQKTVCLLPPSIATKQLTDYIVETKSRLFMKQHPNMEYLSNXXXXXXXXXXVDQKRELVKHLI-----REISEYTKSKSNQEQFHEILKSIDTPLVIESQPSESE---NAILHSVTNMEIFNSNY-----ELMDVETIRENMRKYSEYKL----LRDVNHSIVNFHSSGRNKMI-IADIKLLNHEAEVIVWTSVHGNLIAVKTPDHSVHDFTIQIDSCEVKPIFLKIYNNELFLSGYIENSATKEKHYYLIQSSLTGELIHTSVFNSSHDITTKIAGFHIDPGSGKILLAIPDACKIAIMTSNLVETSHGYHFTDLHPSFITQNQDTAEIWASCPQDGRIIIIDEETGSYRQLGTDQIYNAIPSHITISGDNRVMFLDCRQNRVFWVRKRNDFILIQRINFIGHHNKQLNGKMTAMVAISGTDTLGRLLFVIGSNAYLVRPAKAIGGQNHKL-CNIL 1875
            +R RN+S     + + H   N   S+  LEDL+ CPIHLG +++PR L CGH FCL+CL  Y+     +      CP+CR + ++D K +  L PS   KQLT+Y+   K ++      NM    +E  + S +     K +L+  L+     +++S    S  + E F + L  +     I  +P+ S     ++L  VTN   F  +Y     +  D  TIR+NMRKY EY L    L  ++ S++   S  +  ++ I+D K+      +I        +    +    +  F I +++ ++ PIF+K + N++F+SG I      ++   LIQ SL GE  + S   S         GF  D  +  I +A P   ++ ++ ++L +    + F +L P F+  +  T EIW SCP DGRI + DE T +Y  L T+QIY + P+HI  + D+R++FLD  ++R+FW+ + N  + IQ IN  G   +    K+  + +IS       +LF  G+  ++ RP ++   ++ KL C IL
Sbjct:   18 ERQRNKSESCVCSKVFHKSNNEFSSIENLEDLLTCPIHLGAIDEPRQLQCGHVFCLSCLESYASHGLETSPKQICCPLCRNHTQLDHKGIKSLAPSFLHKQLTEYLFNKKQKVL-----NMSAEFDELHVTSSNNIFKTKLQLMNQLLNDIKTKDLSLDVLSPESNENFIQNLTEVLEKHNIPKKPTNSRVRSKSVL--VTNSSEFGMSYCDLKFKSFDETTIRKNMRKYREYTLEKYFLNHIDTSVIGITSIHQTNILDISDDKI-----SLIYIIKDSPEICLANSRGLKLRSFFISVENSKIFPIFIKCFLNKIFVSGKI----GLDQSSCLIQLSLNGERENISPIYSG-----LFGGFCFDLTNNSIFVAYPSRNQVILLDNSLEKELKVFEFGNLSPMFVAISFKTREIWVSCPNDGRIAVYDEMTDNYLHLATNQIYESTPTHIIETLDHRLLFLDVGKSRLFWIFRWNSCLYIQLINVNGSKEEI---KINTVQSISE----NMILFSDGNKTFIARPNRSPKEEHQKLKCRIL 531          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000064098.1 (SMESG000064098.1)

HSP 1 Score: 215.312 bits (547), Expect = 3.175e-61
Identity = 165/542 (30.44%), Postives = 271/542 (50.00%), Query Frame = 1
Query:  313 KRDRNRSYLEDNNLLKHLKRNSRMSMSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCL--YSCLIRMSISVNFSCPVCRRYCEIDQKTVCLLPPSIATKQLTDYIVETKSRLFMKQHPNMEYLSNXXXXXXXXXXVDQKRELVKHLI-----REISEYTKSKSNQEQFHEILKSIDTPLVIESQPSESE---NAILHSVTNMEIFNSNY-----ELMDVETIRENMRKYSEYKL----LRDVNHSIVNFHSSGRNKMI-IADIKLLNHEAEVIVWTSVHGNLIAVKTPDHSVHDFTIQIDSCEVKPIFLKIYNNELFLSGYIENSATKEKHYYLIQSSLTGELIHTSVFNSSHDITTKIAGFHIDPGSGKILLAIPDACKIAIMTSNLVETSHGYHFTDLHPSFITQNQDTAEIWASCPQDGRIIIIDEETGSYRQLGTDQIYNAIPSHITISGDNRVMFLDCRQNRVFWVRKRNDFILIQRINFIGHHNKQLNGKMTAMVAISGTDTLGRLLFVIGSNAYLVRPAKAIGGQNHKL-CNIL 1875
            +R RN+S     + + H   N   S+  LEDL+ CPIHLG +++PR L CGH FCL+CL  Y+     +      CP+CR + ++D K +  L PS   KQLT+Y+   K ++      NM    +E  + S +     K +L+  L+     +++S    S  + E F + L  +     I  +P+ S     ++L  VTN   F  +Y     +  D  TIR+NMRKY EY L    L  ++ S++   S  +  ++ I+D K+      +I        +    +    +  F I +++ ++ PIF+K + N++F+SG I      ++   LIQ SL GE  + S   S         GF  D  +  I +A P   ++ ++ ++L +    + F +L P F+  +  T EIW SCP DGRI + DE T +Y  L T+QIY + P+HI  + D+R++FLD  ++R+FW+ + N  + IQ IN  G   +    K+  + +IS       +LF  G+  ++ RP ++   ++ KL C IL
Sbjct:   27 ERQRNKSESCVCSKVFHKSNNEFSSIENLEDLLTCPIHLGAIDEPRQLQCGHVFCLSCLESYASHGLETSPKQICCPLCRNHTQLDHKGIKSLAPSFLHKQLTEYLFNKKQKVL-----NMSAEFDELHVTSSNNIFKTKLQLMNQLLNDIKTKDLSLDVLSPESNENFIQNLTEVLEKHNIPKKPTNSRVRSKSVL--VTNSSEFGMSYCDLKFKSFDETTIRKNMRKYREYTLEKYFLNHIDTSVIGITSIHQTNILDISDDKI-----SLIYIIKDSPEICLANSRGLKLRSFFISVENSKIFPIFIKCFLNKIFVSGKI----GLDQSSCLIQLSLNGERENISPIYSGL-----FGGFCFDLTNNSIFVAYPSRNQVILLDNSLEKELKVFEFGNLSPMFVAISFKTREIWVSCPNDGRIAVYDEMTDNYLHLATNQIYESTPTHIIETLDHRLLFLDVGKSRLFWIFRWNSCLYIQLINVNGSKEEI---KINTVQSISE----NMILFSDGNKTFIARPNRSPKEEHQKLKCRIL 540          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000069646.1 (SMESG000069646.1)

HSP 1 Score: 214.542 bits (545), Expect = 3.987e-61
Identity = 156/531 (29.38%), Postives = 273/531 (51.41%), Query Frame = 1
Query:  346 NNLLKHLKRNSRM--SMSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCL--YSCLIRMSISVNFSCPVCRRYCEIDQKT--VCLLPPSIATKQLTDYIVETKSRLFMKQHPNMEYLSNXXXXXXXXXXVDQKRELVKHLIREISEYTKSKSNQEQFHEILKSIDTPLVIESQPSESENAILHSVTNMEIFNSNYELMDVETIRENMRKYSEYKLL-RDVNHSIV-NFHS----SGRNKMIIADIKL------LNHEAEVIVWTSVHGNLIAVKTPDHSVHDFTIQIDSCEVKPIFLKIYNNELFLSGYIENSATKEKHYYLIQSSLTGELIHTS---VFNSSHDITTKIAGFHIDPGSGKILLAIPDACKIAIMTSNLVETSHGYHFTDLHPSFITQNQDTAEIWASCPQDGRIIIIDEETGSYRQLGTDQIYNAIPSHITISGDNRVMFLDCRQNRVFWVRKRNDFILIQRINFIGHHNKQLNGKMTAMVAISGTDTLGRLLFVIGSNAYLVRPAKAIGGQNHKLCNIL 1875
            N+ L+ + R S    +  +LE+++ C IHLG+M DPR L C HAFC NCL  YS      I V+  CP+CR    + +KT  +  LP ++  KQL   +++ +    ++     + LS+           + K +LV+HL++EI+   +        +++ KS +  +   SQ +    A L S  N  I +  YE+MD+ETIRENM KYS+Y+++ RD  H I  N H     S + +  I DI +      L+H   V+V +  H  L+     D ++  F I + +  +KP +++IY   L L+G ++ +  +E     +Q S+ G+++  S   ++ ++ D+   + GF I+    K  L +P++  + I ++N +E+   Y F +  P +I  +    ++W SCP++ RI+I+D ++G +R   T+QI  AIP  I ++ D +++FLD   NR  W+++RN++IL Q++NF+  +          +     T  +   + V  S  Y  +  +       +LCN L
Sbjct:   30 NSQLQRITRRSETFDNTRELEEIVTCCIHLGIMNDPRKLFCQHAFCYNCLKEYS-----KICVDLICPICR----VKEKTNDIDKLPSALTEKQLISVVMKNRITKCIEDPQISKGLSD-----------EIKEDLVQHLVKEINLNNR-------VYKVSKSDEVFVSTSSQNTNQITAYLESNQNTSIDDLTYEMMDIETIRENMLKYSQYEVVKRDGVHKICKNIHQLQKESSQFEFSIFDINISATHPKLSHL--VLVDSKSHQLLVY---SDSNIKTFHIVLKNDIIKPEYIRIYQGNLILTGRLDRN--EEIGSIFLQCSMCGKILRQSELYIWPNTPDLPM-MMGFDINEKEEKYYLCMPNSGSVRIYSTNFIESHQYYEFDENRPEYIAFSSTQNQLWISCPRNRRILILDLDSGIFRLFNTEQINKAIPKMIFVTDDEKIIFLDITGNRFIWIKRRNEYILTQKLNFLSINRDSTIKNFLVLPCSRVTVGVENEILVFQSTKYFSKSRRIF-----ELCNFL 520          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000081132.1 (SMESG000081132.1)

HSP 1 Score: 211.46 bits (537), Expect = 4.825e-60
Identity = 148/505 (29.31%), Postives = 255/505 (50.50%), Query Frame = 1
Query:  367 KRNSRMSMSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVN-FSCPVCRRYCEIDQKTVCLLPPSIATKQLTDYIVETKSRLFMKQHPNMEYLSNXXXXXXXXXXVDQKRELVKHLIREISEYTKSKSNQE------QFHEILKSIDTPLVIESQPSESENAILHSVTNMEIFNSNYEL-MDVETIRENMRKYSEYKLLRD-VNHSIVN--FHSSGRNKMIIADIKLLNHEAEVIVWTSVHGNLIAVKTPDHSVHDFTIQIDSCEVKPIFLKIYNNELFLSGYIENSATKEK-HYYLIQSSLTGELIHTSV-FNSSHDITTKIAGFHIDPGSGKILLAIPDACKIAIMTSNLVETSHGYHFTD--LHPSFITQNQDTAEIWASCPQDGRIIIIDEETGSYRQLGTDQIYNAIPSHITISGDNRVMFLDCRQNRVFWVRKRNDFILIQRINFIGHHNKQLNGKMTAMVAISGTDTLGRLLFVIGSNAYLVRPAK 1836
            ++NS +    LED++ CPIHLG++E P  LPCGH+FCL C+  CL    +  N F+CPVCR    +  +     P S A   +  Y+ E K +    +       SN +   S    + +K ++VK L  +I+    S  + +      + + ILK +  P    S P       +++V N     S++EL ++ E  RE M K  EYK++++ ++  ++     S  ++ + + +    + +   +V+ +    ++       +   F     S  +KP+FL+ + + +F+SG I +          L++ SL G++I  S  +   ++    + GF ID   G + LA PD   I +MTS+L E    + F +  LHP+F+   + T EIWASCP    I+I+D  TGSY Q GT Q++N+ P+HI  + DN++ FLD + +RVFW++++N+++ IQR+ F G   K+ N  +     + G      LL +   + +  +P K
Sbjct:   25 RKNSILPSEPLEDMVSCPIHLGILERPIQLPCGHSFCLECIERCLKTQMLQNNHFACPVCRVSWPVPLEGAHGWPQSYALNDIITYVQEEKQKKLSGKSSQKYRNSNSNRKNS----IIEKADIVKKLAEDIANKKLSDGSVDKAFLITELNSILKKLQEP----STP-------VNNVENSGSRRSSFELKIETEVTREQMSKLCEYKVIQERLSEEVLKELMKSPAKDSVDLDE----DPQFRKLVFVNTSHEIVIYDCNTETSTSFVPMYYSDCLKPVFLRFFQDLVFVSGLIYSKDDGSVLAGVLVKYSLDGKMIDASQRYTKQNNEYLPVHGFDID-TQGNVYLAQPDMATITVMTSDLKENEDKFVFNEPELHPTFVCFCKLTKEIWASCPAHKSILILDSVTGSYMQFGTIQLFNSEPAHIISTQDNKICFLDSKLSRVFWIKRQNEYLCIQRLAF-GTTLKKANFSL-----LRGFCNSSALLLITDKSVFTAKPCK 503          
The following BLAST results are available for this feature:
BLAST of RING-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AC079594.24.041e-834.52TRIM59 and iFT80 readthrough[more]
TRIM596.840e-834.52tripartite motif containing 59 [Source:HGNC Symbol... [more]
TRIM597.957e-834.52tripartite motif containing 59 [Source:HGNC Symbol... [more]
TRIM591.061e-734.52tripartite motif containing 59 [Source:HGNC Symbol... [more]
TRIM591.067e-734.52tripartite motif containing 59 [Source:HGNC Symbol... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nhl-14.718e-743.40RING finger protein nhl-1 [Source:UniProtKB/Swiss... [more]
nhl-14.770e-743.40RING finger protein nhl-1 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ftr433.644e-836.00finTRIM family, member 43 [Source:ZFIN;Acc:ZDB-GEN... [more]
ftr433.644e-836.00finTRIM family, member 43 [Source:ZFIN;Acc:ZDB-GEN... [more]
ftr643.722e-834.48finTRIM family, member 64 [Source:ZFIN;Acc:ZDB-GEN... [more]
ftr504.296e-836.36finTRIM family, member 50 [Source:ZFIN;Acc:ZDB-GEN... [more]
ftr501.153e-734.55finTRIM family, member 50 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000037685.11.213e-741.82pep primary_assembly:Xenopus_tropicalis_v9.1:9:968... [more]
ENSXETT00000037681.11.485e-741.82pep primary_assembly:Xenopus_tropicalis_v9.1:9:968... [more]
ENSXETT00000026455.14.152e-735.71tripartite motif containing 59 [Source:NCBI gene;A... [more]
pitrm16.819e-738.24pitrilysin metallopeptidase 1 [Source:Xenbase;Acc:... [more]
ENSXETT00000011866.18.301e-741.82tripartite motif-containing protein 7 [Source:NCBI... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trim595.403e-834.52tripartite motif-containing 59 [Source:MGI Symbol;... [more]
Trim595.846e-834.52tripartite motif-containing 59 [Source:MGI Symbol;... [more]
Mid14.605e-733.33midline 1 [Source:MGI Symbol;Acc:MGI:1100537][more]
Rnf1355.354e-739.62ring finger protein 135 [Source:MGI Symbol;Acc:MGI... [more]
Mid15.426e-733.33midline 1 [Source:MGI Symbol;Acc:MGI:1100537][more]
back to top
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IWR1|TRI59_HUMAN3.285e-734.52Tripartite motif-containing protein 59 OS=Homo sap... [more]
sp|Q922Y2|TRI59_MOUSE3.779e-734.52Tripartite motif-containing protein 59 OS=Mus musc... [more]
sp|Q32L60|TRI13_BOVIN2.836e-644.07E3 ubiquitin-protein ligase TRIM13 OS=Bos taurus O... [more]
sp|P82458|TRI18_RAT3.115e-633.33E3 ubiquitin-protein ligase Midline-1 OS=Rattus no... [more]
sp|O15344|TRI18_HUMAN3.308e-630.95E3 ubiquitin-protein ligase Midline-1 OS=Homo sapi... [more]
back to top
BLAST of RING-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267ECL92.300e-3526.32RING-type domain-containing protein OS=Macrostomum... [more]
A0A267DTD77.432e-3526.32RING-type domain-containing protein OS=Macrostomum... [more]
A0A267FRC48.006e-3526.32RING-type domain-containing protein OS=Macrostomum... [more]
A0A1I8IQ651.075e-3426.22RING-type domain-containing protein OS=Macrostomum... [more]
A0A267GNM72.758e-2925.95RING-type domain-containing protein OS=Macrostomum... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000035312.11.074e-842.37pep primary_assembly:Astyanax_mexicanus-2.0:17:412... [more]
ENSAMXT00000005684.21.124e-838.98tripartite motif-containing protein 16-like [Sourc... [more]
ENSAMXT00000041324.13.880e-843.14tripartite motif-containing protein 16-like [Sourc... [more]
ENSAMXT00000009928.24.431e-843.14pep primary_assembly:Astyanax_mexicanus-2.0:6:1003... [more]
ENSAMXT00000040376.14.500e-843.14pep primary_assembly:Astyanax_mexicanus-2.0:6:1003... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000010730.15.187e-934.52pep scaffold:Pmarinus_7.0:GL485872:9458:10706:1 ge... [more]
trim592.117e-733.33tripartite motif containing 59 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO271248.096e-637.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458018.469e-639.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000028079.12.561e-840.00pep primary_assembly:ASM223467v1:18:3187730:319493... [more]
ENSORLT00000019661.27.125e-842.00pep primary_assembly:ASM223467v1:13:32568675:32574... [more]
mid11.751e-734.12E3 ubiquitin-protein ligase Midline-1 [Source:NCBI... [more]
ENSORLT00000015094.21.764e-746.15pep primary_assembly:ASM223467v1:17:17654645:17656... [more]
mid12.257e-734.12E3 ubiquitin-protein ligase Midline-1 [Source:NCBI... [more]
back to top
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020467.10.000e+099.63SMESG000020467.1[more]
SMESG000064098.12.619e-6130.44SMESG000064098.1[more]
SMESG000064098.13.175e-6130.44SMESG000064098.1[more]
SMESG000069646.13.987e-6129.38SMESG000069646.1[more]
SMESG000081132.14.825e-6029.31SMESG000081132.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001548 ID=SMED30001548|Name=RING-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2170bp
GGATCATGCTATAAAATAATGAAAATGCAACATGCCTACTTCAATCGATA
TATTAATATGTAAGAATTAAAGACATTAAAAATAAATGATTTTGATTGGT
TGTTGAATTGTTTATAAATTTCAACTAATTTATAATTGTCATTTTATAGA
TGGTATTTGAGGTTGGAGTCTTTATTTTTGGATTTATTTTTTATGTTAAT
ATTAATACATTGTTTTGAATAAGAATTTGCTCAATATAATTTTTTGATTG
GAGAGATGGCTACTGCAGAAGTGAAGGTGAACATGCCCACTTCAAGAGCA
AGTAGTATTGAGAAAAGAGATAGAAATCGATCGTATTTGGAAGATAACAA
CCTACTTAAACATTTAAAAAGGAATAGCAGAATGTCCATGTCGAAATTGG
AAGATTTGATAATGTGTCCTATTCATCTTGGAATGATGGAAGACCCGCGA
ATTCTGCCATGTGGACATGCATTTTGCTTGAATTGCCTATACAGCTGTCT
GATTAGGATGAGTATAAGTGTGAATTTCAGTTGCCCAGTCTGTCGTAGAT
ATTGTGAAATTGACCAGAAAACTGTCTGTCTATTGCCACCGTCTATTGCA
ACCAAACAACTTACAGATTATATTGTCGAAACTAAAAGCCGGCTATTCAT
GAAGCAACATCCGAATATGGAATATCTGAGCAATGAAAGTATTATTGAAT
CAATCTCTACGACTGTTGACCAGAAGCGCGAACTTGTCAAGCATTTGATA
CGAGAAATCAGCGAGTATACAAAATCCAAATCGAACCAGGAACAATTCCA
TGAAATATTGAAATCTATCGATACTCCACTAGTGATTGAGTCACAGCCGT
CTGAGAGTGAGAATGCAATTTTGCATTCCGTTACCAACATGGAAATATTT
AACTCTAATTATGAATTGATGGATGTTGAAACAATACGAGAGAACATGAG
AAAATACAGCGAATATAAATTGCTGAGAGATGTCAACCATTCAATTGTTA
ACTTTCATTCTTCAGGACGTAATAAAATGATAATTGCGGACATAAAGTTG
TTGAACCATGAAGCCGAGGTGATTGTATGGACGTCAGTCCATGGAAACCT
TATTGCTGTCAAAACTCCAGACCATTCTGTCCATGATTTCACTATTCAAA
TAGACTCATGTGAAGTCAAACCGATTTTTTTGAAAATCTATAACAATGAG
TTATTTCTCAGTGGTTATATTGAAAACAGTGCAACCAAAGAAAAACATTA
TTATCTTATTCAATCATCGCTTACAGGGGAACTTATTCACACTTCAGTTT
TTAATAGTTCCCATGATATAACAACGAAGATTGCTGGATTTCATATTGAC
CCAGGAAGCGGGAAGATTTTATTAGCTATTCCTGATGCATGTAAAATTGC
GATCATGACGAGCAACCTTGTGGAAACAAGTCATGGTTATCATTTTACCG
ATTTGCATCCGTCGTTCATTACTCAAAATCAAGACACAGCTGAAATATGG
GCTTCTTGTCCACAAGATGGTAGGATTATCATTATTGATGAAGAAACGGG
TTCTTACAGGCAGTTGGGAACTGATCAAATCTACAATGCTATTCCTTCTC
ATATCACAATTAGTGGAGACAATCGGGTTATGTTTCTCGATTGTCGGCAA
AATCGGGTTTTTTGGGTTCGCAAGCGAAATGATTTTATCCTGATTCAGCG
AATAAATTTTATCGGTCATCATAACAAACAATTAAATGGTAAAATGACCG
CAATGGTTGCAATTTCCGGTACAGACACATTGGGGAGACTGTTGTTTGTT
ATTGGCAGCAATGCCTATCTTGTTCGTCCAGCCAAAGCGATCGGTGGCCA
AAATCATAAACTGTGCAATATTCTCTAAAGAGTAATATATCATTAATTCC
ATCATCATTATTAGTAAAGTATTCTGAGCTTAACACAAAAGATATTAAAT
TTGGAAAATTATTGTTTATTTTTTAAGTGTTTACTTTTATTCTTATAATA
ATTTTGTAAAAGATTGTTAGTGTAATTCTTGTTTTTGAAATAGAAAATAA
ATGATTTGTATCATATAATCTCAGTATAGTTCATCCAGTCCGTTATGTAA
TCACCACCATTTCTACCAGAATTGTGATTGTTTTTTAAATATTATTTGCT
TTTGTATTATTCAGTTTGAT
back to top

protein sequence of SMED30001548-orf-1

>SMED30001548-orf-1 ID=SMED30001548-orf-1|Name=SMED30001548-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=541bp
MATAEVKVNMPTSRASSIEKRDRNRSYLEDNNLLKHLKRNSRMSMSKLED
LIMCPIHLGMMEDPRILPCGHAFCLNCLYSCLIRMSISVNFSCPVCRRYC
EIDQKTVCLLPPSIATKQLTDYIVETKSRLFMKQHPNMEYLSNESIIESI
STTVDQKRELVKHLIREISEYTKSKSNQEQFHEILKSIDTPLVIESQPSE
SENAILHSVTNMEIFNSNYELMDVETIRENMRKYSEYKLLRDVNHSIVNF
HSSGRNKMIIADIKLLNHEAEVIVWTSVHGNLIAVKTPDHSVHDFTIQID
SCEVKPIFLKIYNNELFLSGYIENSATKEKHYYLIQSSLTGELIHTSVFN
SSHDITTKIAGFHIDPGSGKILLAIPDACKIAIMTSNLVETSHGYHFTDL
HPSFITQNQDTAEIWASCPQDGRIIIIDEETGSYRQLGTDQIYNAIPSHI
TISGDNRVMFLDCRQNRVFWVRKRNDFILIQRINFIGHHNKQLNGKMTAM
VAISGTDTLGRLLFVIGSNAYLVRPAKAIGGQNHKLCNIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR001841Znf_RING
IPR0110426-blade_b-propeller_TolB-like
IPR027370Znf-RING_LisH
IPR013083Znf_RING/FYVE/PHD
IPR017907Znf_RING_CS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 54..96
e-value: 1.8E-4
score: 30.8
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 54..97
score: 11.117
IPR027370RING-type zinc-finger, LisH dimerisation motifPFAMPF13445zf-RING_UBOXcoord: 54..94
e-value: 2.3E-6
score: 27.5
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 5..127
e-value: 9.3E-15
score: 56.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..22
NoneNo IPR availablePANTHERPTHR25464FAMILY NOT NAMEDcoord: 47..294
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 46..107
NoneNo IPR availableSUPERFAMILYSSF750113-carboxy-cis,cis-mucoante lactonizing enzymecoord: 305..505
IPR017907Zinc finger, RING-type, conserved sitePROSITEPS00518ZF_RING_1coord: 69..78