Hydroxyacid-oxoacid transhydrogenase, mitochondrial

Overview
NameHydroxyacid-oxoacid transhydrogenase, mitochondrial
Smed IDSMED30001540
Length (bp)1700
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Hydroxyacid-oxoacid transhydrogenase, mitochondrial (SMED30001540) t-SNE clustered cells

Violin plots show distribution of expression levels for Hydroxyacid-oxoacid transhydrogenase, mitochondrial (SMED30001540) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Hydroxyacid-oxoacid transhydrogenase, mitochondrial (SMED30001540) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Hydroxyacid-oxoacid transhydrogenase, mitochondrial (SMED30001540) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001540

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30001540SMESG000009985.1 dd_Smed_v4_4554_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001540SMESG000009985.1 dd_Smed_v4_4554_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001540SMESG000009985.1 dd_Smed_v4_4554_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001540SMESG000009985.1 dd_Smed_v4_4554_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Human
Match: ADHFE1 (alcohol dehydrogenase iron containing 1 [Source:HGNC Symbol;Acc:HGNC:16354])

HSP 1 Score: 489.189 bits (1258), Expect = 4.974e-169
Identity = 258/497 (51.91%), Postives = 335/497 (67.40%), Query Frame = 3
Query:   87 MMNEIMNTGVKCSAHSTC-----GFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK 1562
            ++ ++     +C  HS       G + + K+     +YAFEMA SNIRYG  VTKE+GMD++N  +K   L+TDKN+S+LP  ++A+DSL K+GI F +YD V +EPTD S M A+ F++  +  +D +VA+GGGS +DTCK  NL  +   ++ LDYV+APIGKGK +  PLKP+IAVPTTSGTGSETTGVAIFD   +K K+GI+ RA+KPTLG++DP HT  +P  V   SGFDVLCHALES+T +PY+ R+PCPSNPI RPAYQGSNPISD+W+IHAL+I++ Y +R+V +P D EARS MH A A AG+GFGNAGVHLCHGMSYP+SGL K +Y    DY    N   P +PHGLSVV+T+PAVF FT  + P RHL  A  L      +R +  D+G +L+D                              +RK++ DL V DGL  +G++  DIP LV+GTLPQ RVTKL+P P  +EDL  LF+ SMK
Sbjct:   12 LLRQLQRAACQCPTHSHTYSQAPGLSPSGKTT----DYAFEMAVSNIRYGAAVTKEVGMDLKNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDSSFMEAIEFAQKGA--FDAYVAVGGGSTMDTCKAANLYASSPHSDFLDYVSAPIGKGKPVSVPLKPLIAVPTTSGTGSETTGVAIFDYEHLKVKIGITSRAIKPTLGLIDPLHTLHMPARVVANSGFDVLCHALESYTTLPYHLRSPCPSNPITRPAYQGSNPISDIWAIHALRIVAKYLKRAVRNPDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPISGLVK-MY-KAKDY----NVDHPLVPHGLSVVLTSPAVFTFTAQMFPERHLEMAEILGADTRTARIQ--DAGLVLADT-----------------------------LRKFLFDLDVDDGLAAVGYSKADIPALVKGTLPQERVTKLAPCPQSEEDLAALFEASMK 465          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Human
Match: ADHFE1 (alcohol dehydrogenase iron containing 1 [Source:HGNC Symbol;Acc:HGNC:16354])

HSP 1 Score: 475.322 bits (1222), Expect = 2.551e-164
Identity = 249/456 (54.61%), Postives = 317/456 (69.52%), Query Frame = 3
Query:  195 MACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK 1562
            MA SNIRYG  VTKE+GMD++N  +K   L+TDKN+S+LP  ++A+DSL K+GI F +YD V +EPTD S M A+ F++  +  +D +VA+GGGS +DTCK  NL  +   ++ LDYV+APIGKGK +  PLKP+IAVPTTSGTGSETTGVAIFD   +K K+GI+ RA+KPTLG++DP HT  +P  V   SGFDVLCHALES+T +PY+ R+PCPSNPI RPAYQGSNPISD+W+IHAL+I++ Y +R+V +P D EARS MH A A AG+GFGNAGVHLCHGMSYP+SGL K +Y    DY    N   P +PHGLSVV+T+PAVF FT  + P RHL  A  L      +R +  D+G +L+D                              +RK++ DL V DGL  +G++  DIP LV+GTLPQ RVTKL+P P  +EDL  LF+ SMK
Sbjct:    1 MAVSNIRYGAAVTKEVGMDLKNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDSSFMEAIEFAQKGA--FDAYVAVGGGSTMDTCKAANLYASSPHSDFLDYVSAPIGKGKPVSVPLKPLIAVPTTSGTGSETTGVAIFDYEHLKVKIGITSRAIKPTLGLIDPLHTLHMPARVVANSGFDVLCHALESYTTLPYHLRSPCPSNPITRPAYQGSNPISDIWAIHALRIVAKYLKRAVRNPDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPISGLVK-MY-KAKDY----NVDHPLVPHGLSVVLTSPAVFTFTAQMFPERHLEMAEILGADTRTARIQ--DAGLVLADT-----------------------------LRKFLFDLDVDDGLAAVGYSKADIPALVKGTLPQERVTKLAPCPQSEEDLAALFEASMK 417          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Human
Match: ADHFE1 (alcohol dehydrogenase iron containing 1 [Source:HGNC Symbol;Acc:HGNC:16354])

HSP 1 Score: 326.25 bits (835), Expect = 1.031e-107
Identity = 163/294 (55.44%), Postives = 217/294 (73.81%), Query Frame = 3
Query:   87 MMNEIMNTGVKCSAHSTC-----GFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVN 953
            ++ ++     +C  HS       G + + K+     +YAFEMA SNIRYG  VTKE+GMD++N  +K   L+TDKN+S+LP  ++A+DSL K+GI F +YD V +EPTD S M A+ F++  +  +D +VA+GGGS +DTCK  NL  +   ++ LDYV+APIGKGK +  PLKP+IAVPTTSGTGSETTGVAIFD   +K K+GI+ RA+KPTLG++DP HT  +P  V   SGFDVLCHALES+T +PY+ R+PCPSNPI RPAYQGSNPISD+W+IHAL+I++ Y +R+VN
Sbjct:   12 LLRQLQRAACQCPTHSHTYSQAPGLSPSGKTT----DYAFEMAVSNIRYGAAVTKEVGMDLKNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDSSFMEAIEFAQKGA--FDAYVAVGGGSTMDTCKAANLYASSPHSDFLDYVSAPIGKGKPVSVPLKPLIAVPTTSGTGSETTGVAIFDYEHLKVKIGITSRAIKPTLGLIDPLHTLHMPARVVANSGFDVLCHALESYTTLPYHLRSPCPSNPITRPAYQGSNPISDIWAIHALRIVAKYLKRAVN 299          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Human
Match: AC009879.3 (novel transcript)

HSP 1 Score: 312.768 bits (800), Expect = 4.704e-103
Identity = 154/253 (60.87%), Postives = 199/253 (78.66%), Query Frame = 3
Query:  195 MACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVN 953
            MA SNIRYG  VTKE+GMD++N  +K   L+TDKN+S+LP  ++A+DSL K+GI F +YD V +EPTD S M A+ F++  +  +D +VA+GGGS +DTCK  NL  +   ++ LDYV+APIGKGK +  PLKP+IAVPTTSGTGSETTGVAIFD   +K K+GI+ RA+KPTLG++DP HT  +P  V   SGFDVLCHALES+T +PY+ R+PCPSNPI RPAYQGSNPISD+W+IHAL+I++ Y +R+VN
Sbjct:    1 MAVSNIRYGAAVTKEVGMDLKNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDSSFMEAIEFAQKGA--FDAYVAVGGGSTMDTCKAANLYASSPHSDFLDYVSAPIGKGKPVSVPLKPLIAVPTTSGTGSETTGVAIFDYEHLKVKIGITSRAIKPTLGLIDPLHTLHMPARVVANSGFDVLCHALESYTTLPYHLRSPCPSNPITRPAYQGSNPISDIWAIHALRIVAKYLKRAVN 251          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Human
Match: ADHFE1 (alcohol dehydrogenase iron containing 1 [Source:HGNC Symbol;Acc:HGNC:16354])

HSP 1 Score: 104.375 bits (259), Expect = 5.449e-26
Identity = 50/111 (45.05%), Postives = 72/111 (64.86%), Query Frame = 3
Query:   87 MMNEIMNTGVKCSAHSTC-----GFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVS 404
            ++ ++     +C  HS       G + + K+     +YAFEMA SNIRYG  VTKE+GMD++N  +K   L+TDKN+S+LP  ++A+DSL K+GI F +YD V +EPTD S
Sbjct:   12 LLRQLQRAACQCPTHSHTYSQAPGLSPSGKTT----DYAFEMAVSNIRYGAAVTKEVGMDLKNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDSS 118          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Celegans
Match: hphd-1 (Hydroxyacid-oxoacid transhydrogenase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q9U2M4])

HSP 1 Score: 392.889 bits (1008), Expect = 1.111e-131
Identity = 221/465 (47.53%), Postives = 290/465 (62.37%), Query Frame = 3
Query:  165 NSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSM 1559
            N+   +YAFEM CS +R+G GVT EIG D+RN  +KK LL+TDKNV     FK A  +L    I+++++D+V IEPT  SM  A+ F+++K   +D F+A+GGGSVIDT K   L  ++ EA+ LD+V  P GK      P+ P+IAVPTT+GTGSETT  AI DL   K K GI  R +KP L +VDP +   +PR+V  YSGFDVLCHALESFTA+P++QR+P P NP  RP YQGSNPISDVWS  AL+II  YFRRS+ DP D EAR++M  A + AG+GFGNAGVHLCHG+SYP+S  AKS  +  +DY    N     IPHGLSV+ TA A F+FT   CP+RHL +A+ L                  +D+ NN         +NE + +  C      ++R YM D  VP+GL+ +GF   DI  L E          +SP+   +E +  L++ S+
Sbjct:   36 NNKSTDYAFEMVCSTLRFGKGVTLEIGYDVRNLGAKKTLLITDKNVQNTIAFKNAEQALKMVNIEYEVFDDVLIEPTVNSMQKAIAFAKSKQ--FDSFIAVGGGSVIDTTKAAALYASNPEADFLDFVGPPFGKSMQPKNPMLPLIAVPTTAGTGSETTAAAIMDLPEHKCKTGIRLRCIKPYLAVVDPLNVMSMPRNVAIYSGFDVLCHALESFTALPFDQRSPRPENPGVRPLYQGSNPISDVWSKEALRIIGKYFRRSIFDPTDEEARTEMLKASSFAGIGFGNAGVHLCHGLSYPISSQAKSCVA--DDYPKEKN----LIPHGLSVMTTAVADFEFTTAACPDRHLISAQTLG-----------------ADIPNN--------ASNEYISRTLCD-----RLRGYMRDFGVPNGLKGMGFEFSDIEMLTEAASHSVPNIAISPKSADREIISTLYEKSL 462          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Celegans
Match: hphd-1 (Hydroxyacid-oxoacid transhydrogenase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q9U2M4])

HSP 1 Score: 392.889 bits (1008), Expect = 1.111e-131
Identity = 221/465 (47.53%), Postives = 290/465 (62.37%), Query Frame = 3
Query:  165 NSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSM 1559
            N+   +YAFEM CS +R+G GVT EIG D+RN  +KK LL+TDKNV     FK A  +L    I+++++D+V IEPT  SM  A+ F+++K   +D F+A+GGGSVIDT K   L  ++ EA+ LD+V  P GK      P+ P+IAVPTT+GTGSETT  AI DL   K K GI  R +KP L +VDP +   +PR+V  YSGFDVLCHALESFTA+P++QR+P P NP  RP YQGSNPISDVWS  AL+II  YFRRS+ DP D EAR++M  A + AG+GFGNAGVHLCHG+SYP+S  AKS  +  +DY    N     IPHGLSV+ TA A F+FT   CP+RHL +A+ L                  +D+ NN         +NE + +  C      ++R YM D  VP+GL+ +GF   DI  L E          +SP+   +E +  L++ S+
Sbjct:   36 NNKSTDYAFEMVCSTLRFGKGVTLEIGYDVRNLGAKKTLLITDKNVQNTIAFKNAEQALKMVNIEYEVFDDVLIEPTVNSMQKAIAFAKSKQ--FDSFIAVGGGSVIDTTKAAALYASNPEADFLDFVGPPFGKSMQPKNPMLPLIAVPTTAGTGSETTAAAIMDLPEHKCKTGIRLRCIKPYLAVVDPLNVMSMPRNVAIYSGFDVLCHALESFTALPFDQRSPRPENPGVRPLYQGSNPISDVWSKEALRIIGKYFRRSIFDPTDEEARTEMLKASSFAGIGFGNAGVHLCHGLSYPISSQAKSCVA--DDYPKEKN----LIPHGLSVMTTAVADFEFTTAACPDRHLISAQTLG-----------------ADIPNN--------ASNEYISRTLCD-----RLRGYMRDFGVPNGLKGMGFEFSDIEMLTEAASHSVPNIAISPKSADREIISTLYEKSL 462          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Celegans
Match: hphd-1 (Hydroxyacid-oxoacid transhydrogenase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q9U2M4])

HSP 1 Score: 392.889 bits (1008), Expect = 1.111e-131
Identity = 221/465 (47.53%), Postives = 290/465 (62.37%), Query Frame = 3
Query:  165 NSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSM 1559
            N+   +YAFEM CS +R+G GVT EIG D+RN  +KK LL+TDKNV     FK A  +L    I+++++D+V IEPT  SM  A+ F+++K   +D F+A+GGGSVIDT K   L  ++ EA+ LD+V  P GK      P+ P+IAVPTT+GTGSETT  AI DL   K K GI  R +KP L +VDP +   +PR+V  YSGFDVLCHALESFTA+P++QR+P P NP  RP YQGSNPISDVWS  AL+II  YFRRS+ DP D EAR++M  A + AG+GFGNAGVHLCHG+SYP+S  AKS  +  +DY    N     IPHGLSV+ TA A F+FT   CP+RHL +A+ L                  +D+ NN         +NE + +  C      ++R YM D  VP+GL+ +GF   DI  L E          +SP+   +E +  L++ S+
Sbjct:   36 NNKSTDYAFEMVCSTLRFGKGVTLEIGYDVRNLGAKKTLLITDKNVQNTIAFKNAEQALKMVNIEYEVFDDVLIEPTVNSMQKAIAFAKSKQ--FDSFIAVGGGSVIDTTKAAALYASNPEADFLDFVGPPFGKSMQPKNPMLPLIAVPTTAGTGSETTAAAIMDLPEHKCKTGIRLRCIKPYLAVVDPLNVMSMPRNVAIYSGFDVLCHALESFTALPFDQRSPRPENPGVRPLYQGSNPISDVWSKEALRIIGKYFRRSIFDPTDEEARTEMLKASSFAGIGFGNAGVHLCHGLSYPISSQAKSCVA--DDYPKEKN----LIPHGLSVMTTAVADFEFTTAACPDRHLISAQTLG-----------------ADIPNN--------ASNEYISRTLCD-----RLRGYMRDFGVPNGLKGMGFEFSDIEMLTEAASHSVPNIAISPKSADREIISTLYEKSL 462          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Celegans
Match: hphd-1 (Hydroxyacid-oxoacid transhydrogenase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q9U2M4])

HSP 1 Score: 392.889 bits (1008), Expect = 1.111e-131
Identity = 221/465 (47.53%), Postives = 290/465 (62.37%), Query Frame = 3
Query:  165 NSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSM 1559
            N+   +YAFEM CS +R+G GVT EIG D+RN  +KK LL+TDKNV     FK A  +L    I+++++D+V IEPT  SM  A+ F+++K   +D F+A+GGGSVIDT K   L  ++ EA+ LD+V  P GK      P+ P+IAVPTT+GTGSETT  AI DL   K K GI  R +KP L +VDP +   +PR+V  YSGFDVLCHALESFTA+P++QR+P P NP  RP YQGSNPISDVWS  AL+II  YFRRS+ DP D EAR++M  A + AG+GFGNAGVHLCHG+SYP+S  AKS  +  +DY    N     IPHGLSV+ TA A F+FT   CP+RHL +A+ L                  +D+ NN         +NE + +  C      ++R YM D  VP+GL+ +GF   DI  L E          +SP+   +E +  L++ S+
Sbjct:   36 NNKSTDYAFEMVCSTLRFGKGVTLEIGYDVRNLGAKKTLLITDKNVQNTIAFKNAEQALKMVNIEYEVFDDVLIEPTVNSMQKAIAFAKSKQ--FDSFIAVGGGSVIDTTKAAALYASNPEADFLDFVGPPFGKSMQPKNPMLPLIAVPTTAGTGSETTAAAIMDLPEHKCKTGIRLRCIKPYLAVVDPLNVMSMPRNVAIYSGFDVLCHALESFTALPFDQRSPRPENPGVRPLYQGSNPISDVWSKEALRIIGKYFRRSIFDPTDEEARTEMLKASSFAGIGFGNAGVHLCHGLSYPISSQAKSCVA--DDYPKEKN----LIPHGLSVMTTAVADFEFTTAACPDRHLISAQTLG-----------------ADIPNN--------ASNEYISRTLCD-----RLRGYMRDFGVPNGLKGMGFEFSDIEMLTEAASHSVPNIAISPKSADREIISTLYEKSL 462          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Celegans
Match: hphd-1 (Hydroxyacid-oxoacid transhydrogenase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q9U2M4])

HSP 1 Score: 392.889 bits (1008), Expect = 1.111e-131
Identity = 221/465 (47.53%), Postives = 290/465 (62.37%), Query Frame = 3
Query:  165 NSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSM 1559
            N+   +YAFEM CS +R+G GVT EIG D+RN  +KK LL+TDKNV     FK A  +L    I+++++D+V IEPT  SM  A+ F+++K   +D F+A+GGGSVIDT K   L  ++ EA+ LD+V  P GK      P+ P+IAVPTT+GTGSETT  AI DL   K K GI  R +KP L +VDP +   +PR+V  YSGFDVLCHALESFTA+P++QR+P P NP  RP YQGSNPISDVWS  AL+II  YFRRS+ DP D EAR++M  A + AG+GFGNAGVHLCHG+SYP+S  AKS  +  +DY    N     IPHGLSV+ TA A F+FT   CP+RHL +A+ L                  +D+ NN         +NE + +  C      ++R YM D  VP+GL+ +GF   DI  L E          +SP+   +E +  L++ S+
Sbjct:   36 NNKSTDYAFEMVCSTLRFGKGVTLEIGYDVRNLGAKKTLLITDKNVQNTIAFKNAEQALKMVNIEYEVFDDVLIEPTVNSMQKAIAFAKSKQ--FDSFIAVGGGSVIDTTKAAALYASNPEADFLDFVGPPFGKSMQPKNPMLPLIAVPTTAGTGSETTAAAIMDLPEHKCKTGIRLRCIKPYLAVVDPLNVMSMPRNVAIYSGFDVLCHALESFTALPFDQRSPRPENPGVRPLYQGSNPISDVWSKEALRIIGKYFRRSIFDPTDEEARTEMLKASSFAGIGFGNAGVHLCHGLSYPISSQAKSCVA--DDYPKEKN----LIPHGLSVMTTAVADFEFTTAACPDRHLISAQTLG-----------------ADIPNN--------ASNEYISRTLCD-----RLRGYMRDFGVPNGLKGMGFEFSDIEMLTEAASHSVPNIAISPKSADREIISTLYEKSL 462          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Fly
Match: T3dh (gene:FBgn0017482 transcript:FBtr0071848)

HSP 1 Score: 481.871 bits (1239), Expect = 1.659e-166
Identity = 253/500 (50.60%), Postives = 334/500 (66.80%), Query Frame = 3
Query:   69 KMRVISMMNEIMNTGVKCSAHS-TCGFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTM-KPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK 1562
            +  V+ ++N I+    KC AHS   G A+   S + + EYAFEM+ S +R+GPGV+ E+G D+RN  ++K  LVTDKNV +LP+ K+ALDSL+++GI++++YDE  +EPTD SM HAV F+R K   +D F+AIGGGS +DT K  NL ++D  AE LDYVN PIG+GK I   LKP+IA+PTTSGTGSETTGVAIFD   + AK GIS + LKPTL ++DP HT   P+ V  ++GFDV CHALESFTA+ Y +R   PS+P  RP YQG NP+SDVW+  AL+ I   F  ++  P + EARSQMH A  +AG+GFGNAGVHLCHG+SYP+SG       N+ DYKP   +     IPHGLSVVI+APAVF+FT P CP+RHL AA+ L  +V     + +D+G +L+D                              VR +M+   + +GL +LGF++ DIP LVEGTLPQ R+TKL+PR   +E+L  LF+ SM+
Sbjct:    3 RKNVLGLINTIVANSCKCPAHSHNYGSAAPTASQTGRMEYAFEMSASTVRFGPGVSAEVGADLRNLGARKVCLVTDKNVVQLPSVKVALDSLARNGINYEVYDETRVEPTDGSMWHAVEFARGKE--FDAFLAIGGGSAMDTAKAANLFSSDANAEFLDYVNCPIGRGKEISVKLKPLIAMPTTSGTGSETTGVAIFDYKKLHAKTGISSKFLKPTLAVIDPLHTLSQPQRVMAFAGFDVFCHALESFTAVDYRERGLAPSDPSLRPTYQGRNPVSDVWARFALETIRKNFVNAIYQPDNLEARSQMHLASTMAGVGFGNAGVHLCHGLSYPISG-------NVRDYKPKGYSADHALIPHGLSVVISAPAVFEFTAPACPDRHLEAAQLLGAEVRG--VEKADAGRLLADT-----------------------------VRGFMQRAGIENGLRELGFSSSDIPALVEGTLPQERITKLAPRAQTQENLSQLFEKSME 462          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Zebrafish
Match: adhfe1 (alcohol dehydrogenase iron containing 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2070])

HSP 1 Score: 508.834 bits (1309), Expect = 1.069e-176
Identity = 269/508 (52.95%), Postives = 337/508 (66.34%), Query Frame = 3
Query:   60 MVHKMRVISMMNEIMNTGVKCSAHSTCGFASTNKSNSLQC-------EYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK 1562
            M    RV  +M ++ +   +C AHS     S N++++ +        +YAFEMACSNIR+G GVT+EIGMD++N  ++   L+TD+ +S+LP     LDSL KHG+   LY++V +EPTD S   A+ F+  K   +D++VA+GGGSVIDTCK  NL  +  EAE LD+VNAPIGKGK I   LKP+IAVPTT+GTGSETTGVAIFDL  MKAK GI+ RALKPTLG+VDP HT  +P  V   SGFDVLCHALESFTA+PYN R+PCP NPI RPAYQGSNPISDVW+ HAL+I++ Y +R+V D  D EARS MH A   AG+GFGNAGVHLCHGMSYP++G  K+       Y    N   P +PHGLSVV+T+PAVF+FT  +CP RHL AA+ L   VS    K  D+G +L+D                              +R ++ DL+V DGL  +G+   DIP LV+GT+PQ RVTKLSPR   +EDL  LF  SMK
Sbjct:    7 MAGGERVARLMRQLASAACRCPAHSQAYSHSYNRASAGEAHVCDRKTDYAFEMACSNIRFGAGVTREIGMDLQNMGARNVCLMTDRTLSQLPPVAAVLDSLIKHGVKHKLYEDVRVEPTDKSFKAAIDFA--KKGHFDVYVAVGGGSVIDTCKAANLYASHPEAEFLDFVNAPIGKGKPITATLKPLIAVPTTAGTGSETTGVAIFDLEDMKAKTGIANRALKPTLGMVDPLHTLHMPSRVAANSGFDVLCHALESFTALPYNLRSPCPPNPISRPAYQGSNPISDVWAKHALRIVAKYLKRAVRDAEDVEARSSMHLASVFAGIGFGNAGVHLCHGMSYPIAGNVKT--HRAKGY----NVEHPIVPHGLSVVLTSPAVFEFTANMCPERHLEAAQILGTDVSN--VKKDDAGRVLADT-----------------------------LRAFLYDLEVEDGLSAIGYTKEDIPSLVKGTIPQERVTKLSPRAHTEEDLTGLFAASMK 475          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Xenopus
Match: zmynd15 (zinc finger, MYND-type containing 15 [Source:Xenbase;Acc:XB-GENE-6458566])

HSP 1 Score: 485.337 bits (1248), Expect = 1.489e-167
Identity = 256/496 (51.61%), Postives = 329/496 (66.33%), Query Frame = 3
Query:   75 RVISMMNEIMNTGVKCSAHSTCGFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK 1562
            +VI ++ ++     KC AHS     S       + EYAFEMA SNIRYG  VT+EIGMD++N  ++   ++TDKN+  L   K  L+SL K+ + F LYD V +EPTD S M A+ F+  K   +D +V +GGGSVIDTCK  NL ++   A+ LDYVN PIGKGK +  PLKP+IAVPTTSGTGSETTG+AIFD   +KAK GI+ RA+KPTLG++DP HT  +P  V   SGFDVLCH+LES+TA+PYN R+PCP+NPI RPAYQGSNPISDVW+ HAL+I++ Y +R+V +P D EAR  MH A + AG+GFGNAGVHLCHGMSYP++G  K+  +   DY+       P +PHGLSVV+T+PAVF FT  +CP RHL AA  L   +  ++ K  ++G IL+D                              +RK++ DL V DGL  +G+   DIP LV+GTLPQ RVTKLSPR   +E+L  LF+ SMK
Sbjct:    7 QVIHLLRQLQRASCKCPAHSHT--YSQAPVTGRKTEYAFEMAVSNIRYGENVTQEIGMDLQNLGARNVCVMTDKNLVELSPVKAVLNSLVKNNVSFKLYDRVRVEPTDKSFMDAIEFA--KKGQFDAYVGVGGGSVIDTCKAANLYSSSPGADFLDYVNPPIGKGKAVTVPLKPLIAVPTTSGTGSETTGIAIFDYEELKAKTGIASRAIKPTLGLIDPVHTLSMPERVVANSGFDVLCHSLESYTALPYNMRSPCPTNPINRPAYQGSNPISDVWAKHALRIVAKYLKRAVRNPDDREARFAMHLASSFAGVGFGNAGVHLCHGMSYPIAGHVKTYRA--KDYE----VDHPLVPHGLSVVLTSPAVFSFTALMCPERHLEAAEILGADIRTAKIK--EAGLILADT-----------------------------LRKFLYDLNVDDGLAAVGYTTEDIPALVKGTLPQERVTKLSPRAHSEEELAGLFEASMK 461          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Xenopus
Match: zmynd15 (zinc finger, MYND-type containing 15 [Source:Xenbase;Acc:XB-GENE-6458566])

HSP 1 Score: 445.277 bits (1144), Expect = 4.983e-152
Identity = 240/478 (50.21%), Postives = 314/478 (65.69%), Query Frame = 3
Query:  129 HSTCGFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK 1562
            HS C   +  ++ + +    FE   SNI+   GV K+  +D++N  ++   ++TDKN+  L   K  L+SL K+ + F LYD V +EPTD S M A+ F+  K   +D +V +GGGSVIDTCK  NL ++   A+ LDYVN PIGKGK +  PLKP+IAVPTTSGTGSETTG+AIFD   +KAK GI+ RA+KPTLG++DP HT  +P  V   SGFDVLCH+LES+TA+PYN R+PCP+NPI RPAYQGSNPISDVW+ HAL+I++ Y +R+V +P D EAR  MH A + AG+GFGNAGVHLCHGMSYP++G  K+  +   DY+       P +PHGLSVV+T+PAVF FT  +CP RHL AA  L   +  ++ K  ++G IL+D                              +RK++ DL V DGL  +G+   DIP LV+GTLPQ RVTKLSPR   +E+L  LF+ SMK
Sbjct:   18 HSLCTSKTCLQAKNSKISTCFEATGSNIQ---GVGKQY-VDLQNLGARNVCVMTDKNLVELSPVKAVLNSLVKNNVSFKLYDRVRVEPTDKSFMDAIEFA--KKGQFDAYVGVGGGSVIDTCKAANLYSSSPGADFLDYVNPPIGKGKAVTVPLKPLIAVPTTSGTGSETTGIAIFDYEELKAKTGIASRAIKPTLGLIDPVHTLSMPERVVANSGFDVLCHSLESYTALPYNMRSPCPTNPINRPAYQGSNPISDVWAKHALRIVAKYLKRAVRNPDDREARFAMHLASSFAGVGFGNAGVHLCHGMSYPIAGHVKTYRA--KDYE----VDHPLVPHGLSVVLTSPAVFSFTALMCPERHLEAAEILGADIRTAKIK--EAGLILADT-----------------------------LRKFLYDLNVDDGLAAVGYTTEDIPALVKGTLPQERVTKLSPRAHSEEELAGLFEASMK 452          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Xenopus
Match: zmynd15 (zinc finger, MYND-type containing 15 [Source:Xenbase;Acc:XB-GENE-6458566])

HSP 1 Score: 434.491 bits (1116), Expect = 7.153e-148
Identity = 229/438 (52.28%), Postives = 295/438 (67.35%), Query Frame = 3
Query:  249 DIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK 1562
            D++N  ++   ++TDKN+  L   K  L+SL K+ + F LYD V +EPTD S M A+ F+  K   +D +V +GGGSVIDTCK  NL ++   A+ LDYVN PIGKGK +  PLKP+IAVPTTSGTGSETTG+AIFD   +KAK GI+ RA+KPTLG++DP HT  +P  V   SGFDVLCH+LES+TA+PYN R+PCP+NPI RPAYQGSNPISDVW+ HAL+I++ Y +R+V +P D EAR  MH A + AG+GFGNAGVHLCHGMSYP++G  K+  +   DY+       P +PHGLSVV+T+PAVF FT  +CP RHL AA  L   +  ++ K  ++G IL+D                              +RK++ DL V DGL  +G+   DIP LV+GTLPQ RVTKLSPR   +E+L  LF+ SMK
Sbjct:   48 DLQNLGARNVCVMTDKNLVELSPVKAVLNSLVKNNVSFKLYDRVRVEPTDKSFMDAIEFA--KKGQFDAYVGVGGGSVIDTCKAANLYSSSPGADFLDYVNPPIGKGKAVTVPLKPLIAVPTTSGTGSETTGIAIFDYEELKAKTGIASRAIKPTLGLIDPVHTLSMPERVVANSGFDVLCHSLESYTALPYNMRSPCPTNPINRPAYQGSNPISDVWAKHALRIVAKYLKRAVRNPDDREARFAMHLASSFAGVGFGNAGVHLCHGMSYPIAGHVKTYRA--KDYE----VDHPLVPHGLSVVLTSPAVFSFTALMCPERHLEAAEILGADIRTAKIK--EAGLILADT-----------------------------LRKFLYDLNVDDGLAAVGYTTEDIPALVKGTLPQERVTKLSPRAHSEEELAGLFEASMK 446          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Xenopus
Match: zmynd15 (zinc finger, MYND-type containing 15 [Source:Xenbase;Acc:XB-GENE-6458566])

HSP 1 Score: 389.423 bits (999), Expect = 7.432e-129
Identity = 207/385 (53.77%), Postives = 262/385 (68.05%), Query Frame = 3
Query:  408 MHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK 1562
            M A+ F+  K   +D +V +GGGSVIDTCK  NL ++   A+ LDYVN PIGKGK +  PLKP+IAVPTTSGTGSETTG+AIFD   +KAK GI+ RA+KPTLG++DP HT  +P  V   SGFDVLCH+LES+TA+PYN R+PCP+NPI RPAYQGSNPISDVW+ HAL+I++ Y +R+V +P D EAR  MH A + AG+GFGNAGVHLCHGMSYP++G  K+  +   DY+       P +PHGLSVV+T+PAVF FT  +CP RHL AA  L   +  ++ K  ++G IL+D                              +RK++ DL V DGL  +G+   DIP LV+GTLPQ RVTKLSPR   +E+L  LF+ SMK
Sbjct:  197 MDAIEFA--KKGQFDAYVGVGGGSVIDTCKAANLYSSSPGADFLDYVNPPIGKGKAVTVPLKPLIAVPTTSGTGSETTGIAIFDYEELKAKTGIASRAIKPTLGLIDPVHTLSMPERVVANSGFDVLCHSLESYTALPYNMRSPCPTNPINRPAYQGSNPISDVWAKHALRIVAKYLKRAVRNPDDREARFAMHLASSFAGVGFGNAGVHLCHGMSYPIAGHVKTYRA--KDYE----VDHPLVPHGLSVVLTSPAVFSFTALMCPERHLEAAEILGADIRTAKIK--EAGLILADT-----------------------------LRKFLYDLNVDDGLAAVGYTTEDIPALVKGTLPQERVTKLSPRAHSEEELAGLFEASMK 542          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Mouse
Match: Adhfe1 (alcohol dehydrogenase, iron containing, 1 [Source:MGI Symbol;Acc:MGI:1923437])

HSP 1 Score: 511.531 bits (1316), Expect = 5.825e-178
Identity = 265/498 (53.21%), Postives = 342/498 (68.67%), Query Frame = 3
Query:   69 KMRVISMMNEIMNTGVKCSAHSTCGFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK 1562
            + RV  ++  + +T  +C  HS   ++     +    +YAFEMA SNIRYG GVTKE+GMD++N  +K   L+TDKN+S+LP  +I +DSLSK+GI F +YD+V +EPTD S M A+ F++  +  +D +VA+GGGS +DTCK  NL  +   +E LDYVNAPIGKGK +  PLKP+IAVPTTSGTGSETTGVAIFD   +K K GI+ RA+KPTLG+VDP HT  +P  V   SGFDVLCHALES+TAIPY+ R+PCPSNPI+RPAYQGSNPISD+W++HALQI++ Y +R+V +P D EARS+MH A A AG+GFGNAGVHLCHGMSYP+SGL K+  +   +Y    N   P +PHGLSVV+T+PAVF FT  + P RHL  A  L   +  +R +  D+G +L+D                              +RK++ DL V DGL  LG++  DIP LV+GTLPQ RVTKL+PR   +EDL  LF+ SMK
Sbjct:    6 RARVTHLLRHLQSTACQCPTHSHT-YSQAPGPSGKTADYAFEMAVSNIRYGAGVTKEVGMDLQNMGAKNVCLMTDKNLSQLPPVQIVMDSLSKNGISFQVYDDVRVEPTDGSFMDAIEFAKKGA--FDAYVAVGGGSTMDTCKAANLYASSPHSEFLDYVNAPIGKGKPVTVPLKPLIAVPTTSGTGSETTGVAIFDYEHLKVKTGIASRAIKPTLGLVDPLHTLHMPCQVVANSGFDVLCHALESYTAIPYSMRSPCPSNPIQRPAYQGSNPISDIWAVHALQIVAKYLKRAVRNPDDLEARSKMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKTYKA--KEY----NVDHPLVPHGLSVVLTSPAVFTFTAQMFPERHLETAGILGANIRTARIQ--DAGLVLADA-----------------------------LRKFLFDLNVDDGLAALGYSKDDIPSLVKGTLPQERVTKLAPRAQSEEDLSALFEASMK 463          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Mouse
Match: Adhfe1 (alcohol dehydrogenase, iron containing, 1 [Source:MGI Symbol;Acc:MGI:1923437])

HSP 1 Score: 506.908 bits (1304), Expect = 3.294e-176
Identity = 263/492 (53.46%), Postives = 339/492 (68.90%), Query Frame = 3
Query:   87 MMNEIMNTGVKCSAHSTCGFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK 1562
            ++  + +T  +C  HS   ++     +    +YAFEMA SNIRYG GVTKE+GMD++N  +K   L+TDKN+S+LP  +I +DSLSK+GI F +YD+V +EPTD S M A+ F++  +  +D +VA+GGGS +DTCK  NL  +   +E LDYVNAPIGKGK +  PLKP+IAVPTTSGTGSETTGVAIFD   +K K GI+ RA+KPTLG+VDP HT  +P  V   SGFDVLCHALES+TAIPY+ R+PCPSNPI+RPAYQGSNPISD+W++HALQI++ Y +R+V +P D EARS+MH A A AG+GFGNAGVHLCHGMSYP+SGL K+  +   +Y    N   P +PHGLSVV+T+PAVF FT  + P RHL  A  L   +  +R +  D+G +L+D                              +RK++ DL V DGL  LG++  DIP LV+GTLPQ RVTKL+PR   +EDL  LF+ SMK
Sbjct:    4 LLRHLQSTACQCPTHSHT-YSQAPGPSGKTADYAFEMAVSNIRYGAGVTKEVGMDLQNMGAKNVCLMTDKNLSQLPPVQIVMDSLSKNGISFQVYDDVRVEPTDGSFMDAIEFAKKGA--FDAYVAVGGGSTMDTCKAANLYASSPHSEFLDYVNAPIGKGKPVTVPLKPLIAVPTTSGTGSETTGVAIFDYEHLKVKTGIASRAIKPTLGLVDPLHTLHMPCQVVANSGFDVLCHALESYTAIPYSMRSPCPSNPIQRPAYQGSNPISDIWAVHALQIVAKYLKRAVRNPDDLEARSKMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKTYKA--KEY----NVDHPLVPHGLSVVLTSPAVFTFTAQMFPERHLETAGILGANIRTARIQ--DAGLVLADA-----------------------------LRKFLFDLNVDDGLAALGYSKDDIPSLVKGTLPQERVTKLAPRAQSEEDLSALFEASMK 455          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q8R0N6|HOT_MOUSE (Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Adhfe1 PE=1 SV=2)

HSP 1 Score: 511.531 bits (1316), Expect = 4.074e-177
Identity = 265/498 (53.21%), Postives = 342/498 (68.67%), Query Frame = 3
Query:   69 KMRVISMMNEIMNTGVKCSAHSTCGFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK 1562
            + RV  ++  + +T  +C  HS   ++     +    +YAFEMA SNIRYG GVTKE+GMD++N  +K   L+TDKN+S+LP  +I +DSLSK+GI F +YD+V +EPTD S M A+ F++  +  +D +VA+GGGS +DTCK  NL  +   +E LDYVNAPIGKGK +  PLKP+IAVPTTSGTGSETTGVAIFD   +K K GI+ RA+KPTLG+VDP HT  +P  V   SGFDVLCHALES+TAIPY+ R+PCPSNPI+RPAYQGSNPISD+W++HALQI++ Y +R+V +P D EARS+MH A A AG+GFGNAGVHLCHGMSYP+SGL K+  +   +Y    N   P +PHGLSVV+T+PAVF FT  + P RHL  A  L   +  +R +  D+G +L+D                              +RK++ DL V DGL  LG++  DIP LV+GTLPQ RVTKL+PR   +EDL  LF+ SMK
Sbjct:    6 RARVTHLLRHLQSTACQCPTHSHT-YSQAPGPSGKTADYAFEMAVSNIRYGAGVTKEVGMDLQNMGAKNVCLMTDKNLSQLPPVQIVMDSLSKNGISFQVYDDVRVEPTDGSFMDAIEFAKKGA--FDAYVAVGGGSTMDTCKAANLYASSPHSEFLDYVNAPIGKGKPVTVPLKPLIAVPTTSGTGSETTGVAIFDYEHLKVKTGIASRAIKPTLGLVDPLHTLHMPCQVVANSGFDVLCHALESYTAIPYSMRSPCPSNPIQRPAYQGSNPISDIWAVHALQIVAKYLKRAVRNPDDLEARSKMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKTYKA--KEY----NVDHPLVPHGLSVVLTSPAVFTFTAQMFPERHLETAGILGANIRTARIQ--DAGLVLADA-----------------------------LRKFLFDLNVDDGLAALGYSKDDIPSLVKGTLPQERVTKLAPRAQSEEDLSALFEASMK 463          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q4QQW3|HOT_RAT (Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Adhfe1 PE=1 SV=1)

HSP 1 Score: 504.982 bits (1299), Expect = 1.373e-174
Identity = 265/503 (52.68%), Postives = 341/503 (67.79%), Query Frame = 3
Query:   69 KMRVISMMNEIMNTGVKCSAHSTC-----GFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK 1562
            + RV  ++  + +T  +C  HS       G + + K+     +YAFEMA SNIRYG GVTKE+GMD++N  +K   L+TDKN+S+LP  +I +DSLSK+GI F +YD V +EPTD S M A+ F++  +  +D +VA+GGGS +DTCK  NL      +E LDYVNAPIGKGK +  PLKP+IAVPTTSGTGSETTGVAIFD   +K K GI+ RA+KPTLG+VDP HT  +P  V   SGFDVLCHALES+TAIPY+ R+PCPSNPI+RPAYQGSNPISD+W++HAL+I++ Y +R+V +P D EARS MH A A AG+GFGNAGVHLCHGMSYP+SGL K+  +   +Y    N   P +PHGLSVV+T+PAVF FT  + P RHL  A  L   +  ++ +  D+G +L+D                              +RK++ DL V DGL  LG++  DIP LV+GTLPQ RVTKL+PR   +EDL  LF+ SMK
Sbjct:    6 RARVTHLLRHLQSTACQCPTHSHTYSQVPGLSPSGKTT----DYAFEMAVSNIRYGAGVTKEVGMDLQNMGAKNVCLMTDKNLSQLPPVQIVMDSLSKNGISFQVYDNVRVEPTDGSFMDAIEFAKKGA--FDAYVAVGGGSTMDTCKAANLYACSPHSEFLDYVNAPIGKGKPVTVPLKPLIAVPTTSGTGSETTGVAIFDYEHLKVKTGIASRAIKPTLGLVDPLHTLHMPCQVVANSGFDVLCHALESYTAIPYSMRSPCPSNPIQRPAYQGSNPISDIWAVHALRIVAKYLKRAVRNPDDLEARSSMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKTYKA--KEY----NVDHPLVPHGLSVVLTSPAVFTFTAQMFPERHLETAEILGANIRTAKIQ--DAGPVLADA-----------------------------LRKFLFDLNVDDGLAALGYSKDDIPSLVKGTLPQERVTKLAPRAQSEEDLSALFEASMK 465          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. UniProt/SwissProt
Match: sp|A6QP15|HOT_BOVIN (Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Bos taurus OX=9913 GN=ADHFE1 PE=2 SV=1)

HSP 1 Score: 499.204 bits (1284), Expect = 2.415e-172
Identity = 258/499 (51.70%), Postives = 339/499 (67.94%), Query Frame = 3
Query:   69 KMRVISMMNEIMNTGVKCSAHS-TCGFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK 1562
            + RV+ ++  +     +C +HS T   A     +    +YAFEMA S IRYG GVTKE+GMD+++  +K   L+TDKN+S+LP  +  +DSL K+GI+F +YD V +EPTD S M A+ F++  +  +D F+A+GGGS IDTCK  NL ++  +++ LDYVNAPIGKGK +  PLKP+IAVPTTSGTGSETTGVAIFD   +K K GI+ RA+KPTLG++DP HT  +P  V   SGFDVLCHALES+TA+PY+ R+PCPS+PI RPAYQGSNPISD+W++HAL+I++ Y +R++ +P D EARS MH A A AG+GFGNAGVHLCHGMSYP+SGL K+  +   DY    N   P +PHGLSVV+T+PAVF FT  + P RHL  A  L      +R    D+G +L+D                              +RK++ DL V DGL  +G++  DIP+LV+GTLPQ RVTKL+PRP  +EDL  LF+ SMK
Sbjct:    5 RSRVVHLLRLLQRAACQCPSHSHTYSQAPGLSPSGKTTDYAFEMAVSTIRYGAGVTKEVGMDLQSMGAKNVCLMTDKNLSQLPPVQTVMDSLVKNGINFKVYDHVRVEPTDTSFMEAIEFAKKGA--FDAFLAVGGGSTIDTCKAANLYSSSPDSDFLDYVNAPIGKGKPVTVPLKPLIAVPTTSGTGSETTGVAIFDYEHLKVKTGIASRAIKPTLGLIDPLHTLHMPERVVANSGFDVLCHALESYTALPYHMRSPCPSSPITRPAYQGSNPISDIWAVHALRIVAKYLKRAIRNPDDLEARSNMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKTYKA--KDY----NVDHPLVPHGLSVVLTSPAVFTFTSQMFPERHLEVAEILGADTRTAR--RPDAGPVLADT-----------------------------LRKFLFDLDVDDGLAAIGYSKADIPELVKGTLPQERVTKLAPRPQSEEDLSALFEASMK 464          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q5RF11|HOT_PONAB (Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Pongo abelii OX=9601 GN=ADHFE1 PE=2 SV=1)

HSP 1 Score: 499.204 bits (1284), Expect = 2.697e-172
Identity = 260/503 (51.69%), Postives = 339/503 (67.40%), Query Frame = 3
Query:   69 KMRVISMMNEIMNTGVKCSAHSTC-----GFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK 1562
            + RV  ++ ++     +C  HS       G + + K+     +YAFEMA SNIRYG GVTKE+GMD++N  +K   L+TDKN+S+LP  ++A+DSL K+GI F +YD V +EPTD S M A+ F++  +  +D +VA+GGGS +DTC   NL  +   ++ LDYV+APIGKGK +  PLKP+IAVPTTSGTGSETTGVAIFD   +K K+GI+ RA+KPTLG++DP HT  +P  V   SGFDVLCHALES+T +PY+ R+PCPSNPI RPAYQGSNPISD+W+IHAL+I++ Y +R+V +P D EARS MH A A AG+GFGNAGVHLCHGMSYP+SGL K+  +   DY    N   P +PHGLSVV+T+PAVF FT  + P RHL  A  L      +R +  D+G +L+D                              +RK++ DL V DGL  +G++  DIP LV+GTLPQ RVTKL+PRP  +EDL  LF+ SMK
Sbjct:    6 RARVAYLLRQLQRAACQCPTHSHTYSQAPGLSPSGKTT----DYAFEMAVSNIRYGAGVTKEVGMDLQNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDASFMEAIEFAQKGA--FDAYVAVGGGSTMDTCMAANLYASSPHSDFLDYVSAPIGKGKPVSVPLKPLIAVPTTSGTGSETTGVAIFDYEHLKVKIGIASRAIKPTLGLIDPLHTLHMPARVVANSGFDVLCHALESYTTLPYHLRSPCPSNPITRPAYQGSNPISDIWAIHALRIVAKYLKRAVRNPDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKTYKA--KDY----NVDHPLVPHGLSVVLTSPAVFTFTAQMFPERHLETAEILGADTRTARIQ--DAGLVLADT-----------------------------LRKFLFDLDVDDGLAAVGYSKADIPALVKGTLPQERVTKLAPRPQSEEDLAALFEASMK 465          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q28XT3|HOT_DROPS (Probable hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=GA17444 PE=3 SV=2)

HSP 1 Score: 496.508 bits (1277), Expect = 2.639e-171
Identity = 258/499 (51.70%), Postives = 338/499 (67.74%), Query Frame = 3
Query:   69 KMRVISMMNEIMNTGVKCSAHS-TCGFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTM-KPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSM 1559
            +  V++++N I+    KC AHS   G A+     + Q EYAFEM+ S +R+GPGV+ E+G D+RN  +KK  LVTD+NV++LP+ K+ALDSL++HGI++++YDE  +EPTD S+ HA  ++R     +D F+AIGGGSV+DT K  NL ++D+EAE LDYVN PIGKGK I   LKP+IA+PTTSGTGSETTGVAIFD   + AK GIS + LKPTL I+DP HT   P  V  ++GFDV CHALESFTA+ Y +R P PS+P  RP YQG NPISDVW+  AL+ I   F  ++ +P + EARSQMH A  +AG+GFGNAGVHLCHG+SYP+SG       N+ +YKP   T     IPHGLSVVI+APAVF+FT P CP+RHL AA+ L  KV   R   SD+G +L+D                              VR +M+   + +GL +LGF++ D+P+LV+GTLPQ R+TKL+PR   +E+L  LF+NSM
Sbjct:    3 RKNVLNLINTIVANSCKCPAHSHNYGSAAPTGVQTGQKEYAFEMSASTVRFGPGVSVEVGADLRNLGAKKVCLVTDRNVAKLPSVKVALDSLARHGINYEVYDETRVEPTDASLWHAADYARQNE--FDAFLAIGGGSVMDTAKAANLFSSDREAEFLDYVNCPIGKGKEISVKLKPLIAMPTTSGTGSETTGVAIFDYKRLHAKTGISSKYLKPTLAIIDPLHTLSQPERVMAFAGFDVFCHALESFTAVDYRERGPAPSDPSLRPTYQGRNPISDVWARFALETIRKNFINAIYEPGNLEARSQMHLASTMAGVGFGNAGVHLCHGLSYPISG-------NVRNYKPAGYTADHALIPHGLSVVISAPAVFEFTAPACPDRHLEAAKLLGAKVDGVRA--SDAGRLLADT-----------------------------VRGFMQRAGIENGLRELGFSSSDVPNLVDGTLPQERITKLAPRAQTQENLAQLFENSM 461          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. TrEMBL
Match: A0A2L2Y052 (Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Parasteatoda tepidariorum OX=114398 PE=2 SV=1)

HSP 1 Score: 530.406 bits (1365), Expect = 0.000e+0
Identity = 276/504 (54.76%), Postives = 352/504 (69.84%), Query Frame = 3
Query:   60 MVHKMRVISMMNEIMNTGVKCSAHSTCGFASTNKSNSLQ----CEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSM 1559
            M  + +V+ +++ +     +C AHS+  +   +     +     +YAFEMACS++RYGPGVT+E+GMD++N N+K+ L++TD N+  LP    A+DS+ +  IDFD+YD+V IEPT+ S   A+ F++ ++  YD FVA+GGGSVIDTCK  NL   D EAE LDYVNAPIGKGK +  PLKP+IAVPTT+GTGSETTGVA+FD + +KAK GI+ RAL+PTLGI+DP HT  +P  V  YSGFDVLCHALES+TAIPYN+RTPCPSNPI RPAYQGSNPISD+WS+ AL+ +  YF R+V +  D EARS+MH A   AG+GFGNAGVHLCHGMSYP+SGL K   +  ++YK       P IPHGLSVVITAPAVF+FT P CP+RHL AA  L   ++ +  K  D+G ILSDV                             VR YM +L + DGL+ LGF + DIP+LVEGTLPQHRVTKL+PR   +E+L  LF+NS+
Sbjct:    1 MGSRDKVLHLLSNVAKVSCRCPAHSSAVYLRGSHVAVPKPVAGKDYAFEMACSSVRYGPGVTQELGMDLQNMNAKRVLVMTDSNLGSLPPMSQAIDSIKRCSIDFDVYDKVRIEPTNDSFKEAISFAKKRN--YDAFVAVGGGSVIDTCKAANLYAADPEAEFLDYVNAPIGKGKPVTKPLKPLIAVPTTAGTGSETTGVAVFDYLPLKAKTGIAHRALRPTLGIIDPLHTLHMPNRVAAYSGFDVLCHALESYTAIPYNERTPCPSNPIMRPAYQGSNPISDIWSLKALKSMQKYFIRAVKNSDDYEARSEMHLASTFAGIGFGNAGVHLCHGMSYPISGLVKKYKA--SEYK----CDHPIIPHGLSVVITAPAVFRFTSPACPDRHLTAAEALGKDITNA--KKEDAGLILSDV-----------------------------VRDYMHNLGIEDGLKGLGFDSSDIPELVEGTLPQHRVTKLAPREQSREELSELFENSL 465          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. TrEMBL
Match: A0A087TZ15 (Hydroxyacid-oxoacid transhydrogenase, mitochondrial (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_03909 PE=4 SV=1)

HSP 1 Score: 525.783 bits (1353), Expect = 2.395e-180
Identity = 275/506 (54.35%), Postives = 343/506 (67.79%), Query Frame = 3
Query:   60 MVHKMRVISMMNEIMNTGVKCSAHSTC-------GFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNS 1556
            M  K ++  +++ I     +C AHS+        GF      N    EYAFEMACS++RYGPGVT+EIGMD++N N+KK LLVTD N+S LP     LDS+ KHGI++D++D+V IEP + S   A+ F++ K   YD FVA+GGGSVIDTCK  NL ++D E E LDYVNAPIGKGK +   LKP+IAVPTT+GTGSETTGVAIFD + +K K GI+ RAL+PTLGI+DP HT  +P  V  YSGFDVLCHALES+TAIP+N+RTP P NP+ RPAYQGSNPISD+W++ AL+ I  YFRR+V +  D EARS+MH A   AG+GFGNAGVHLCHGMSYP+SGL K   +  ++YK       P IPHGLSVVITAPAVF+FT P CP RHL AA  L         K  D+G +L+DV                             VR++M+DL + +GL  LGF + DIP LVEGTLPQ RVT+L+PR   +E+L +LF+ S
Sbjct:    1 MAGKEKIYHLLSTISKASCRCPAHSSAVHLRGNHGFTPKQNGNK---EYAFEMACSSVRYGPGVTQEIGMDLKNLNAKKVLLVTDSNISVLPPMTETLDSIHKHGIEYDVFDKVRIEPNNESFEQAISFAKKKQ--YDAFVAVGGGSVIDTCKAANLYSSDPETEFLDYVNAPIGKGKPVTCNLKPLIAVPTTAGTGSETTGVAIFDHVPLKTKTGIAHRALRPTLGIIDPLHTLHMPSRVAAYSGFDVLCHALESYTAIPFNERTPRPENPVLRPAYQGSNPISDIWALKALRTIQKYFRRAVKNSDDYEARSEMHLASTFAGIGFGNAGVHLCHGMSYPISGLVKEYKA--SEYK----CSHPIIPHGLSVVITAPAVFRFTAPACPERHLTAAEVLGKNTMN--VKREDAGKVLADV-----------------------------VREFMKDLGIENGLRGLGFTSSDIPSLVEGTLPQQRVTRLAPRGQSQEELSHLFEES 464          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. TrEMBL
Match: G1KSW5 (Fe-ADH domain-containing protein OS=Anolis carolinensis OX=28377 GN=adhfe1 PE=4 SV=2)

HSP 1 Score: 522.316 bits (1344), Expect = 7.594e-179
Identity = 266/498 (53.41%), Postives = 343/498 (68.88%), Query Frame = 3
Query:   69 KMRVISMMNEIMNTGVKCSAHSTCGFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK 1562
            + RV  ++ ++      C AHS         + S + +YAFEMA SNIRYG GVTKE+GMD+ N  ++K  ++TDKN+S+LP  K  LDSL+ +GI+F +YD V +EPTD S M A+ F+  K E +D +VA+GGGSVIDTCK  NL  +  E++ LDYVNAPIGKGK +   LKP+IAVPTT+GTGSETTGVAIFD   +K K GI+ R +KP LGI+DP HT ++P  VT  +GFDVLCHALES+TA+PY+QR+PCPSNP+ RPAYQGSNPISDVW+IHAL+I + Y +R++ +P D EAR+ MH A A AG+GFGNAGVHLCHGMSYP+SGL K+  +   DY+         +PHGLSVV+T+PAVF FT P+CP RHL AA  L   +S S+ +  D+G IL+D                              +R+++ DL V DGL  LG+++ DIP LV+GTLPQ RVTKLSPRP  +E+L  LF+ SMK
Sbjct:    5 RERVAHLLKQLHRASCACPAHSHVYSQGIGHAASGKTDYAFEMAVSNIRYGKGVTKEVGMDLHNLGARKVCVMTDKNLSQLPPVKAVLDSLTTNGINFQMYDNVRVEPTDQSFMDAIMFA--KKEEFDSYVAVGGGSVIDTCKTANLYASSPESDFLDYVNAPIGKGKPVNITLKPLIAVPTTAGTGSETTGVAIFDYKELKVKTGIASRTIKPLLGIIDPLHTLYMPERVTANTGFDVLCHALESYTALPYHQRSPCPSNPVNRPAYQGSNPISDVWAIHALRITAKYLKRAIRNPEDEEARASMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKNYKA--KDYR----VEHSLVPHGLSVVLTSPAVFTFTAPMCPERHLEAAHILGANISNSKVR--DAGLILADT-----------------------------LREFLFDLNVDDGLAALGYSSADIPALVKGTLPQERVTKLSPRPQTEEELSALFEASMK 463          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. TrEMBL
Match: W5MBF6 (Alcohol dehydrogenase iron containing 1 OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 520.39 bits (1339), Expect = 4.350e-178
Identity = 274/502 (54.58%), Postives = 342/502 (68.13%), Query Frame = 3
Query:   60 MVHKMRVISMMNEIMNTGVKCSAHSTCGF-ASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK 1562
            M  + RV+ ++ ++     +C AHS   + AS + S+    +YAFEMACSNIRYG GVT+EIGMD+ N  S+   L+TDKN+S+LP     LDSL KHG+ F  YD+V +EPTD S   A+ F+R K E +D +VA+GGGSVIDTCKV NL     EA+ LD+VNAPIGKGK +   LKP+IAVPTT+GTGSETTGVAIFD  S+KAK GI+ RA+KPTLG+VDP HT  +P+ V   SGFDVLCHALES+TA+PY+ R+PCP+NPI RPAYQGSNPISDVWS HAL+I++ Y +R+V DP D EARS MH A   AG+GFGNAGVHLCHGMSYP++G  K+  +         N   P +PHGLSVV+T+PAVF FT  +CP RHL AA  L   V  +  K  D+G ILSDV                             +RK++ DL V DGL  +G+   DIP LV+GT+PQ RVTKLSPR   +EDL +LF+ S+K
Sbjct:    7 MAGRERVVQLLRQLERAACRCPAHSHSYYQASGHTSSGKTTDYAFEMACSNIRYGEGVTREIGMDLLNLGSRNVCLMTDKNLSQLPPLTAVLDSLVKHGVRFKCYDKVRVEPTDASFKEAIDFAR-KGE-FDAYVAVGGGSVIDTCKVANLYDCHPEADFLDFVNAPIGKGKAVTAVLKPLIAVPTTAGTGSETTGVAIFDFESLKAKTGIASRAIKPTLGMVDPLHTLHMPQRVAANSGFDVLCHALESYTALPYSLRSPCPTNPIHRPAYQGSNPISDVWSRHALRIVAKYLKRAVRDPGDLEARSSMHLASVFAGIGFGNAGVHLCHGMSYPIAGHVKTFRAE------GYNVDHPLVPHGLSVVLTSPAVFTFTACMCPERHLEAAEILGADVRNA--KQGDAGLILSDV-----------------------------LRKFLFDLNVDDGLSAVGYTTDDIPALVKGTIPQERVTKLSPRAHTEEDLTDLFEASLK 469          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. TrEMBL
Match: A0A158NWM4 (Fe-ADH domain-containing protein OS=Atta cephalotes OX=12957 GN=105625201 PE=4 SV=1)

HSP 1 Score: 518.079 bits (1333), Expect = 4.157e-177
Identity = 272/508 (53.54%), Postives = 348/508 (68.50%), Query Frame = 3
Query:   60 MVHKMRVISMMNEIMNTGVKCSAHSTCGFAS--------TNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVT-NTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNS 1556
            M+ + RVI ++  I +   +C AH   G  S        +  +N+   EYAFEMACS +RYG GVT+E+GMDI+N  +KK  L+TD N+  L   K A+DSLSK+GI F++YD+V +EPT+ S+  +++F+  K E +D FVA+GGGSV+DTCK  NL + D  AE LDYVNAPIGKGK I  PLKP+IAVPTTSGTGSETTGV+IFD   +KAK GI+ R+L+PTLGI+DP HT  LP  V  YSGFDVLCHALESFTAI Y +RTPCPSNPI RPAYQGSNPISDVW+ +ALQ++  YF R+V +  D EAR  MH A  +AG+GFGNAGVHLCHG+SYP+SG       N+ +++P   +   P IPHGLSVVI+APAVF FT   CP+RHL AA+ L  +V  +  K +D+G IL+D+                             +++YM  +K+ +GL +LGF   DIP LV+GTLPQHR+TKL+PR   +EDL  LF+NS
Sbjct:    1 MLPRRRVIELLQVISSQSCRCPAHGNPGATSVWDHGKTRSTAANTTDKEYAFEMACSTVRYGVGVTRELGMDIQNLGAKKTCLMTDPNLMNLAPVKTAIDSLSKYGIQFEIYDQVRVEPTEQSLQDSIKFA--KRENFDAFVAVGGGSVMDTCKAANLYSCDPNAEFLDYVNAPIGKGKPIRVPLKPLIAVPTTSGTGSETTGVSIFDYRPLKAKTGIANRSLRPTLGIIDPKHTLTLPERVCAYSGFDVLCHALESFTAISYTERTPCPSNPILRPAYQGSNPISDVWARYALQVMRKYFERAVYNQEDLEARGHMHLASTMAGVGFGNAGVHLCHGLSYPISG-------NVRNFQPKGYSNDHPIIPHGLSVVISAPAVFSFTGSACPDRHLEAAKLLGAEVQNA--KQADAGKILADI-----------------------------IKEYMHLMKIENGLTELGFKKEDIPTLVQGTLPQHRITKLAPREQSEEDLAQLFENS 468          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Cavefish
Match: adhfe1 (alcohol dehydrogenase iron containing 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2070])

HSP 1 Score: 482.641 bits (1241), Expect = 3.871e-167
Identity = 248/473 (52.43%), Postives = 322/473 (68.08%), Query Frame = 3
Query:  147 ASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTM-KPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK 1562
            + T  +   + +YAFEMACSNIRYG GVT+EIGMD++N + +   L+TD N+SRLP     LDSL++HG+ ++ YD+V +EPTD S   A+ F++ +   +D +VA+GGGSVIDTCK  NL      A+ LD+VNAPIGKGK +   LKP+IAVPTT+GTGSETTGVAIFD   +KAK GI+ R+L+PTLG+VDP HT  +P  V   SGFDVLCHALES+TA+PY  R+PCP+NPI RPAYQGSNP+SDVW+ HAL++++ Y +R+V DP D EARS MH A   AG+GFGNAGVHLCHGMSYP++G       N+  +K    ++    +PHGLSVV+T+PAVF FT  +CP RHL AA  L   V     K +D+G++L+D                              +RK + DL+V DGL  +G++  DIP LV+GT+PQ RVTKL+PR   +EDL  LF  SMK
Sbjct:    3 SGTGHTCGRKTDYAFEMACSNIRYGEGVTREIGMDLQNLSVRNVCLMTDSNLSRLPPVTAVLDSLARHGVKYECYDKVRVEPTDSSFKAAIDFAKKRD--FDAYVAVGGGSVIDTCKAANLYACHPTADFLDFVNAPIGKGKPVTGTLKPLIAVPTTAGTGSETTGVAIFDFEDLKAKTGIASRSLRPTLGMVDPLHTLHMPARVAANSGFDVLCHALESYTALPYTMRSPCPTNPINRPAYQGSNPVSDVWAKHALRMVAKYLKRAVRDPDDVEARSSMHLASVFAGIGFGNAGVHLCHGMSYPIAG-------NVKTHKAKGYSVDHSLVPHGLSVVLTSPAVFAFTASMCPERHLEAAEILGADVRN--VKAADAGSVLADT-----------------------------LRKILFDLEVEDGLAAVGYSKEDIPALVKGTIPQERVTKLAPRSHTEEDLTELFAASMK 435          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Sea Lamprey
Match: adhfe1 (alcohol dehydrogenase iron containing 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2070])

HSP 1 Score: 511.146 bits (1315), Expect = 1.673e-178
Identity = 268/501 (53.49%), Postives = 346/501 (69.06%), Query Frame = 3
Query:   60 MVHKMRVISMMNEIMNTGVKCSAHSTCGFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK 1562
            +VHK+    +++  M    +C AHS   + +T +++  Q +YAFEMACSNIRYG GVT+EIGMD++N  ++   ++TDKN+SRLP  +  LDSL    I+F LYD+V +EPTD S  +A+ F+R+    +D +VA+GGGSV+DTCK  NL +   +A+ LD+VNAPIGKG  +   LKP+IAVPTT+GTGSETTGVAIFD   +KAK GI+ RA+KPTLG+VDP HT  +PR V   SGFDVLCHALES+TA+PY+QR PCPSNPI RPAYQGSNPISDVWSIHAL+I++ Y +R+V    D EARS MH A   AG+GFGNAGVHLCHGMSYP++G+ K+  +   DY    N   P +PHGLSVV+T+PAVF FT  +CP RHL  A  L   VS++  K +D+G+IL+D                              +R  + DL V DGL  +G+++ DIP LV+GTLPQ RVTKLSPRP  +EDL  LF+ SM+
Sbjct:   10 VVHKLSCC-LISVSMTNRCRCPAHSH-AYTATAEASKRQTDYAFEMACSNIRYGEGVTQEIGMDLQNIGARNVCVMTDKNLSRLPPVRAVLDSLVSSKINFKLYDDVRVEPTDTSFKNAIAFARSGG--FDAYVAVGGGSVMDTCKASNLYSASPDADFLDFVNAPIGKGMPVTATLKPLIAVPTTAGTGSETTGVAIFDYEPLKAKTGIASRAMKPTLGLVDPLHTLHMPRRVCANSGFDVLCHALESYTALPYHQRAPCPSNPINRPAYQGSNPISDVWSIHALKIVAKYMKRAVRQQDDLEARSSMHLASVFAGIGFGNAGVHLCHGMSYPIAGMVKNYRA--KDY----NVDHPILPHGLSVVLTSPAVFTFTAAMCPERHLELASCLGADVSQA--KRADAGSILADT-----------------------------LRALLFDLNVEDGLSAVGYSSQDIPALVKGTLPQERVTKLSPRPQNEEDLAALFEASMR 469          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Yeast
Match: ADH4 (Alcohol dehydrogenase isoenzyme type IV; dimeric enzyme demonstrated to be zinc-dependent despite sequence similarity to iron-activated alcohol dehydrogenases; transcription is induced in response to zinc deficiency [Source:SGD;Acc:S000003225])

HSP 1 Score: 100.138 bits (248), Expect = 2.309e-23
Identity = 79/286 (27.62%), Postives = 130/286 (45.45%), Query Frame = 3
Query:  216 YGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGL 1073
            +G G  +E    I+N + KKAL+VTD  ++ +         L +  ++  +YD+    P   ++   ++    K +  +I V+IGGGS  D  K I LL T+   E+ DY      K   +     P+ A+ TT+GT SE T   I      K K+ I    + P + + DP     LP  +T  +G D L H +E++ +                     SNPI+D  ++  + +I+     +  D  D +AR+ M +A  LAGM F NA +   H +++ + G 
Sbjct:   15 FGEGALEETADYIKNKDYKKALIVTDPGIAAIGLSGRVQKMLEERDLNVAIYDKTQPNPNIANVTAGLKV--LKEQNSEIVVSIGGGSAHDNAKAIALLATNG-GEIGDYEGVNQSKKAAL-----PLFAINTTAGTASEMTRFTIISNEEKKIKMAIIDNNVTPAVAVNDPSTMFGLPPALTAATGLDALTHCIEAYVST-------------------ASNPITDACALKGIDLINESLVAAYKDGKDKKARTDMCYAEYLAGMAFNNASLGYVHALAHQLGGF 273          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Nematostella
Match: EDO48370 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJF8])

HSP 1 Score: 456.447 bits (1173), Expect = 1.224e-157
Identity = 241/456 (52.85%), Postives = 308/456 (67.54%), Query Frame = 3
Query:  195 MACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVV-KEDLFNLFKNSM 1559
            MA S+IR+G GVT+E+GMD +N   +K  LVTD  ++RLP  + A++SL  HG++ ++YD+  IEPTD S    + F+  K+  +D F+A+GGGSVIDT K  NL  +  + + LD+VNAP+GKG  +  P+KP+IA+PTT+GTGSETTGVAIFD   + AK GI+ RA++P LGIVDP HT  +P  VT  SGFDVLCHA+ESFTAIPY +R PCP NP  RPAYQGSNP+SDVWS HAL II  Y +RSV DP D EARSQMH A   AG+GFGNAGVHLCHGMSYP+SGL KS  +   DY P      P +PHGLSVV+TAPAVF+FT P CP+RH+ AAR +      S  K +D+G +L+D +  F                             M  L V DGL+  G++  DIP+LV+GT+PQHRVTKL+P     +E+L  LF++S+
Sbjct:    1 MASSSIRFGEGVTREVGMDFKNLGVRKVCLVTDSKLARLPPVEQAVESLVTHGVNHEVYDKTRIEPTDASFKDCIAFA--KAGQFDSFLAVGGGSVIDTAKAANLYLSHPDNDFLDFVNAPVGKGLPVTRPVKPLIAIPTTAGTGSETTGVAIFDYQPLNAKTGIANRAIRPMLGIVDPFHTLHMPERVTANSGFDVLCHAIESFTAIPYKERGPCPPNPNMRPAYQGSNPVSDVWSRHALSIIHKYMKRSVRDPHDLEARSQMHLASVYAGIGFGNAGVHLCHGMSYPISGLVKSYKA--KDYDP----SHPIVPHGLSVVVTAPAVFRFTAPSCPDRHIEAARLM--GADTSNVKQADAGPLLADTLLEF-----------------------------MHSLDVDDGLQAFGYSTADIPNLVKGTIPQHRVTKLAPAGAPGEEELARLFEDSL 417          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Nematostella
Match: EDO48161 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF8])

HSP 1 Score: 422.165 bits (1084), Expect = 8.214e-145
Identity = 215/376 (57.18%), Postives = 269/376 (71.54%), Query Frame = 3
Query:  117 KCSAHSTC---GFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFL 1235
            +C AHS        S+  +   + EYAFEMA S+IR+G GVT+E+GMD +N   +K  LVTD  ++RLP  + A++SL  HG++ ++YD+  IEPTD S    + F+  K+  +D F+A+GGGSVIDT K  NL  +  + + LD+VNAP+GKG  +  P+KP+IA+PTT+GTG ETTGVAIFD   + AK GI+ RA++P LGIVDP HT  +P  VT  SGFDVLCHA+ESFTAIPY +R PCP NP  RPAYQGSNP+SDVWS HAL II  Y +RSV DP D EARSQMH A   AG+GFGNAGVHLCHGMSYP+SGL KS  +   DY P      P +PHGLSVV+TAPAVF+FT P CP+RH+ AAR +
Sbjct:    4 RCPAHSQAFSHRLGSSAANKQPEKEYAFEMASSSIRFGEGVTREVGMDFKNLGVRKVCLVTDSKLARLPPVEQAVESLVTHGVNHEVYDKTRIEPTDASFKDCIAFA--KAGQFDSFLAVGGGSVIDTAKAANLYLSHPDNDFLDFVNAPVGKGLPVTRPVKPLIAIPTTAGTGIETTGVAIFDYQPLNAKTGIANRAIRPILGIVDPFHTLHMPERVTANSGFDVLCHAIESFTAIPYKERGPCPPNPNMRPAYQGSNPVSDVWSRHALSIIHKYMKRSVRDPHDLEARSQMHLASVYAGIGFGNAGVHLCHGMSYPISGLVKSYKA--KDYDP----SHPIVPHGLSVVVTAPAVFRFTAPSCPDRHIEAARLM 371          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Nematostella
Match: EDO26839 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAX8])

HSP 1 Score: 51.6026 bits (122), Expect = 4.136e-7
Identity = 42/150 (28.00%), Postives = 62/150 (41.33%), Query Frame = 3
Query:  738 TAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQF 1187
            T  LP  VT  +G D + HA+E++T+                      NP+SD+ +  AL++++      V++  + EAR  M     LAG  F NA V   H ++YP+ G                      IPHGLS  +  P V  F
Sbjct:   20 TLGLPPAVTAATGIDAMVHAIEAYTSALKK------------------NPLSDLLAREALRLLAANLDEVVHNGGNREARQAMLLGSCLAGQAFANAPVAAVHALAYPLGG-------------------HFHIPHGLSNALVLPHVLGF 132          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Medaka
Match: adhfe1 (alcohol dehydrogenase iron containing 1 [Source:NCBI gene;Acc:101169732])

HSP 1 Score: 510.76 bits (1314), Expect = 9.246e-178
Identity = 269/509 (52.85%), Postives = 339/509 (66.60%), Query Frame = 3
Query:   60 MVHKMRVISMMNEIMNTGVKCSAHSTC--GFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMK------PFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK 1562
            M  + R++ ++ ++     +C AHS      A      +   +YAFEMA SNIRYGPGV+KEIGMD++N  ++   L+TD+N+S LP  K  L+SL+K+G++F +YD V +EPTD S   A+ F++  S  +D+FVA+GGGSVIDTCK  NL     EA+ LD+VNAPIGKGK I  PLKP+IAVPTT+GTGSETTGVAIFD   +KAK GI+ RA++P LGIVDP HT  +P  V   SGFDVLCHALES+TA+PY+QR+PCPSNPI RPAYQGSNPISDVWS HAL +++ Y +R+V DP D EARS MH A   AG+GFGNAGVHLCHGMSYP++G  K            T+T K      P +PHGLSVV+T+PAVF FT P+CP RHL AA  L   V +   K  D+GA L+D                              +R+++ DL V DGL  +G++  DIP LV+GTLPQ RVTKLSPR   +EDL  LF+ SMK
Sbjct:    1 MAGRDRIVHLLRQLERAACRCPAHSNTFHQGAGAAGCTARTTDYAFEMASSNIRYGPGVSKEIGMDLQNLGARNVCLMTDRNLSLLPPVKAVLESLAKNGVNFKVYDNVRVEPTDSSFKDAIAFAKKGS--FDVFVAVGGGSVIDTCKAANLYACHPEADFLDFVNAPIGKGKPIRNPLKPLIAVPTTAGTGSETTGVAIFDYEPLKAKTGIASRAIRPMLGIVDPTHTLSMPERVAANSGFDVLCHALESYTALPYDQRSPCPSNPILRPAYQGSNPISDVWSRHALHVVAKYMKRAVRDPEDLEARSSMHLASVFAGIGFGNAGVHLCHGMSYPIAGNVK------------THTAKGYCVEHPLVPHGLSVVLTSPAVFSFTAPMCPERHLEAAEILGADVQQ--VKRQDAGASLADT-----------------------------LRQFLSDLHVEDGLGAVGYSKDDIPALVKGTLPQERVTKLSPRKHTEEDLSQLFEASMK 464          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Planmine SMEST
Match: SMESG000009985.1 (SMESG000009985.1)

HSP 1 Score: 937.947 bits (2423), Expect = 0.000e+0
Identity = 472/501 (94.21%), Postives = 472/501 (94.21%), Query Frame = 3
Query:   60 MVHKMRVISMMNEIMNTGVKCSAHSTCGFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK 1562
            MVHKMRVISMMNEIMNTGVKCSAHSTCGFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPTTSGTGSETTGVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDV                             VRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK
Sbjct:    1 MVHKMRVISMMNEIMNTGVKCSAHSTCGFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPTTSGTGSETTGVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDV-----------------------------VRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK 472          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Planmine SMEST
Match: SMESG000009985.1 (SMESG000009985.1)

HSP 1 Score: 928.702 bits (2399), Expect = 0.000e+0
Identity = 468/497 (94.16%), Postives = 468/497 (94.16%), Query Frame = 3
Query:   72 MRVISMMNEIMNTGVKCSAHSTCGFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK 1562
            MRVISMMNEIMNTGVKCSAHSTCGFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPTTSGTGSETTGVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDV                             VRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK
Sbjct:    1 MRVISMMNEIMNTGVKCSAHSTCGFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPTTSGTGSETTGVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDV-----------------------------VRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK 468          
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Planmine SMEST
Match: SMESG000009985.1 (SMESG000009985.1)

HSP 1 Score: 918.687 bits (2373), Expect = 0.000e+0
Identity = 463/492 (94.11%), Postives = 463/492 (94.11%), Query Frame = 3
Query:   87 MMNEIMNTGVKCSAHSTCGFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPXXXXXXXXXXXVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK 1562
            MMNEIMNTGVKCSAHSTCGFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPTTSGTGSETTGVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDV                             VRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK
Sbjct:    1 MMNEIMNTGVKCSAHSTCGFASTNKSNSLQCEYAFEMACSNIRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGIDFDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINLLTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPTTSGTGSETTGVAIFDLISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESFTAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDPMDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYKPVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESRCKNSDSGAILSDV-----------------------------VRKYMEDLKVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSMK 463          
The following BLAST results are available for this feature:
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADHFE14.974e-16951.91alcohol dehydrogenase iron containing 1 [Source:HG... [more]
ADHFE12.551e-16454.61alcohol dehydrogenase iron containing 1 [Source:HG... [more]
ADHFE11.031e-10755.44alcohol dehydrogenase iron containing 1 [Source:HG... [more]
AC009879.34.704e-10360.87novel transcript[more]
ADHFE15.449e-2645.05alcohol dehydrogenase iron containing 1 [Source:HG... [more]
back to top
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hphd-11.111e-13147.53Hydroxyacid-oxoacid transhydrogenase, mitochondria... [more]
hphd-11.111e-13147.53Hydroxyacid-oxoacid transhydrogenase, mitochondria... [more]
hphd-11.111e-13147.53Hydroxyacid-oxoacid transhydrogenase, mitochondria... [more]
hphd-11.111e-13147.53Hydroxyacid-oxoacid transhydrogenase, mitochondria... [more]
hphd-11.111e-13147.53Hydroxyacid-oxoacid transhydrogenase, mitochondria... [more]
back to top
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
T3dh1.659e-16650.60gene:FBgn0017482 transcript:FBtr0071848[more]
back to top
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
adhfe11.069e-17652.95alcohol dehydrogenase iron containing 1 [Source:ZF... [more]
back to top
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
zmynd151.489e-16751.61zinc finger, MYND-type containing 15 [Source:Xenba... [more]
zmynd154.983e-15250.21zinc finger, MYND-type containing 15 [Source:Xenba... [more]
zmynd157.153e-14852.28zinc finger, MYND-type containing 15 [Source:Xenba... [more]
zmynd157.432e-12953.77zinc finger, MYND-type containing 15 [Source:Xenba... [more]
back to top
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Adhfe15.825e-17853.21alcohol dehydrogenase, iron containing, 1 [Source:... [more]
Adhfe13.294e-17653.46alcohol dehydrogenase, iron containing, 1 [Source:... [more]
back to top
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8R0N6|HOT_MOUSE4.074e-17753.21Hydroxyacid-oxoacid transhydrogenase, mitochondria... [more]
sp|Q4QQW3|HOT_RAT1.373e-17452.68Hydroxyacid-oxoacid transhydrogenase, mitochondria... [more]
sp|A6QP15|HOT_BOVIN2.415e-17251.70Hydroxyacid-oxoacid transhydrogenase, mitochondria... [more]
sp|Q5RF11|HOT_PONAB2.697e-17251.69Hydroxyacid-oxoacid transhydrogenase, mitochondria... [more]
sp|Q28XT3|HOT_DROPS2.639e-17151.70Probable hydroxyacid-oxoacid transhydrogenase, mit... [more]
back to top
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2L2Y0520.000e+054.76Hydroxyacid-oxoacid transhydrogenase, mitochondria... [more]
A0A087TZ152.395e-18054.35Hydroxyacid-oxoacid transhydrogenase, mitochondria... [more]
G1KSW57.594e-17953.41Fe-ADH domain-containing protein OS=Anolis carolin... [more]
W5MBF64.350e-17854.58Alcohol dehydrogenase iron containing 1 OS=Lepisos... [more]
A0A158NWM44.157e-17753.54Fe-ADH domain-containing protein OS=Atta cephalote... [more]
back to top
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
adhfe13.871e-16752.43alcohol dehydrogenase iron containing 1 [Source:ZF... [more]
back to top
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
adhfe11.673e-17853.49alcohol dehydrogenase iron containing 1 [Source:ZF... [more]
back to top
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ADH42.309e-2327.62Alcohol dehydrogenase isoenzyme type IV; dimeric e... [more]
back to top
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO483701.224e-15752.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481618.214e-14557.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO268394.136e-728.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
adhfe19.246e-17852.85alcohol dehydrogenase iron containing 1 [Source:NC... [more]
back to top
BLAST of Hydroxyacid-oxoacid transhydrogenase, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000009985.10.000e+094.21SMESG000009985.1[more]
SMESG000009985.10.000e+094.16SMESG000009985.1[more]
SMESG000009985.10.000e+094.11SMESG000009985.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001540 ID=SMED30001540|Name=Hydroxyacid-oxoacid transhydrogenase, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=1700bp
GGAATAATAAACTAATTATACATTAGTATTTGAACTTTTTAAAAATAACA
CGTTTTACAATGGTGCACAAAATGCGCGTTATATCAATGATGAATGAAAT
TATGAATACTGGAGTAAAATGTTCCGCCCATTCTACATGCGGATTTGCTA
GCACAAACAAATCCAATTCCTTACAATGTGAATACGCCTTTGAAATGGCT
TGTTCCAATATTCGTTATGGGCCTGGAGTTACGAAAGAAATTGGAATGGA
TATTAGAAATTTTAATTCAAAAAAAGCCTTATTGGTAACTGATAAGAACG
TATCACGTTTGCCAACTTTTAAAATTGCGCTTGATTCGTTATCTAAACAT
GGAATTGATTTTGATTTGTATGACGAAGTGCACATAGAGCCAACTGATGT
GAGTATGATGCATGCGGTACGTTTTTCCCGGACTAAATCAGAGCCTTATG
ATATATTTGTAGCAATTGGAGGTGGCTCGGTAATTGACACATGCAAGGTA
ATAAATTTGCTAACTACTGACAAAGAAGCTGAATTGCTGGATTACGTAAA
TGCTCCAATAGGGAAAGGCAAACTTATTCTAACTCCTTTAAAACCTATGA
TAGCTGTTCCTACTACGTCTGGTACCGGTAGTGAAACCACTGGGGTTGCG
ATTTTTGATTTAATTTCTATGAAGGCAAAAGTAGGAATTTCTCAACGAGC
TTTGAAACCTACTTTGGGTATTGTCGATCCAGATCATACGGCATTTCTAC
CAAGAGATGTTACATGTTATAGTGGGTTCGATGTTTTGTGTCATGCGTTG
GAATCTTTCACAGCTATCCCTTACAATCAACGAACTCCATGTCCATCTAA
TCCAATTGAAAGGCCAGCATATCAAGGTAGCAATCCAATCAGCGATGTTT
GGTCAATTCATGCTTTACAAATCATATCCAACTATTTCCGACGCAGTGTT
AATGATCCCATGGATTCCGAAGCTCGCAGTCAAATGCATTTTGCTGGTGC
ACTAGCGGGAATGGGATTTGGCAATGCTGGTGTCCATTTATGTCACGGAA
TGAGTTATCCGGTTTCTGGACTGGCTAAATCCCTATATTCTAATCTCAAT
GATTACAAACCGGTTACCAACACGATGAAACCATTTATTCCCCACGGGCT
GTCTGTGGTGATAACTGCCCCTGCAGTTTTTCAATTTACTTTTCCACTCT
GTCCCAATCGACATTTGAATGCAGCAAGATTTCTTGATCCAAAAGTCTCT
GAATCTAGATGCAAAAATAGTGATTCCGGTGCAATATTATCAGATGTGGT
AAATAATTTTATTGTTATTCAATTCAATTTTTGCACAAATGAACCGGTCA
GGAAACTGTTTTGCATTTTTGATATCTCTTTTAAGGTACGCAAGTATATG
GAGGATTTGAAAGTACCGGATGGGTTAGAGAAATTAGGATTTGCAGCAAT
GGACATTCCTGATTTAGTGGAAGGAACGCTGCCTCAACATCGCGTCACAA
AATTGTCACCGAGGCCAGTAGTCAAAGAAGACCTTTTCAATTTGTTTAAA
AATTCCATGAAAATATTTTAAATAATAATTTTTCATAAATGACAAACAAA
GTTTACTTAAATTATTAGGAAAATCTTATTTTGTTCGTGATTTCCTATGA
ATTTGTTTTGCAGTTAATCAAAAATGTGGATGTGAAAATCAATATGGAAA
back to top

protein sequence of SMED30001540-orf-1

>SMED30001540-orf-1 ID=SMED30001540-orf-1|Name=SMED30001540-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=504bp
MVHKMRVISMMNEIMNTGVKCSAHSTCGFASTNKSNSLQCEYAFEMACSN
IRYGPGVTKEIGMDIRNFNSKKALLVTDKNVSRLPTFKIALDSLSKHGID
FDLYDEVHIEPTDVSMMHAVRFSRTKSEPYDIFVAIGGGSVIDTCKVINL
LTTDKEAELLDYVNAPIGKGKLILTPLKPMIAVPTTSGTGSETTGVAIFD
LISMKAKVGISQRALKPTLGIVDPDHTAFLPRDVTCYSGFDVLCHALESF
TAIPYNQRTPCPSNPIERPAYQGSNPISDVWSIHALQIISNYFRRSVNDP
MDSEARSQMHFAGALAGMGFGNAGVHLCHGMSYPVSGLAKSLYSNLNDYK
PVTNTMKPFIPHGLSVVITAPAVFQFTFPLCPNRHLNAARFLDPKVSESR
CKNSDSGAILSDVVNNFIVIQFNFCTNEPVRKLFCIFDISFKVRKYMEDL
KVPDGLEKLGFAAMDIPDLVEGTLPQHRVTKLSPRPVVKEDLFNLFKNSM
KIF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR039697Alcohol_dehydrogenase_Fe
IPR001670ADH_Fe/GldA
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0016491oxidoreductase activity
GO:0004022alcohol dehydrogenase (NAD) activity
GO:0047988hydroxyacid-oxoacid transhydrogenase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0015993molecular hydrogen transport
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001670Alcohol dehydrogenase, iron-type/glycerol dehydrogenase GldAPFAMPF00465Fe-ADHcoord: 49..398
e-value: 1.4E-87
score: 293.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.1970coord: 28..231
e-value: 1.8E-49
score: 169.9
NoneNo IPR availableGENE3DG3DSA:1.20.1090.10coord: 232..500
e-value: 1.6E-49
score: 170.3
NoneNo IPR availablePANTHERPTHR11496:SF83HYDROXYACID-OXOACID TRANSHYDROGENASE, MITOCHONDRIALcoord: 36..417
coord: 442..501
NoneNo IPR availableCDDcd08190HOTcoord: 48..500
e-value: 0.0
score: 623.028
NoneNo IPR availableSUPERFAMILYSSF56796Dehydroquinate synthase-likecoord: 47..394
IPR039697Iron-type alcohol dehydrogenase-likePANTHERPTHR11496ALCOHOL DEHYDROGENASEcoord: 36..417
IPR039697Iron-type alcohol dehydrogenase-likePANTHERPTHR11496ALCOHOL DEHYDROGENASEcoord: 442..501