ANK_REP_REGION domain-containing protein

Overview
NameANK_REP_REGION domain-containing protein
Smed IDSMED30001527
Length (bp)2345
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ANK_REP_REGION domain-containing protein (SMED30001527) t-SNE clustered cells

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30001527) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ANK_REP_REGION domain-containing protein (SMED30001527) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30001527) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001527

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30001527SMESG000070878.1 dd_Smed_v4_5349_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001527SMESG000070878.1 dd_Smed_v4_5349_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001527SMESG000070878.1 Contig50383newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001527SMESG000070878.1 Contig50383uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001527SMESG000070878.1 Contig30305newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001527SMESG000070878.1 Contig30305uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30001527SMESG000070878.1 dd_Smed_v4_5349_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30001527SMESG000070878.1 dd_Smed_v4_5349_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANKRD27 (ankyrin repeat domain 27 [Source:HGNC Symbol;Acc:HGNC:25310])

HSP 1 Score: 54.6842 bits (130), Expect = 7.879e-11
Identity = 27/78 (34.62%), Postives = 44/78 (56.41%), Query Frame = 2
Query:  269 NGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEE--NSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            NG  PL  AC   H + VK L+ +     +  +  E  ++PLHIAA +GY  +++ L+++GA    QN+ K+T +  A
Sbjct:  528 NGNTPLHLACTYGHEDCVKALVYYDVESCRLDIGNEKGDTPLHIAARWGYQGVIETLLQNGASTEIQNRLKETPLKCA 605          

HSP 2 Score: 33.113 bits (74), Expect = 7.879e-11
Identity = 15/44 (34.09%), Postives = 23/44 (52.27%), Query Frame = 3
Query:  162 KDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            +D  G T LH AA  G   ++  LV++GA + + D     P H+
Sbjct:  459 RDDRGHTPLHVAAVCGQASLIDLLVSKGAMVNATDYHGATPLHL 502          

HSP 3 Score: 46.2098 bits (108), Expect = 4.294e-7
Identity = 25/69 (36.23%), Postives = 38/69 (55.07%), Query Frame = 2
Query:  281 PLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAM 487
            PL  AC   H   VK L++  +  NK  L   N+PL  A   G+ ++V +L++HGA ++  N K  TA+
Sbjct:  780 PLHLACQQGHFQVVKCLLDSNAKPNKKDL-SGNTPLIYACSGGHHELVALLLQHGASINASNNKGNTAL 847          

HSP 4 Score: 28.8758 bits (63), Expect = 4.294e-7
Identity = 13/49 (26.53%), Postives = 25/49 (51.02%), Query Frame = 3
Query:  147 IDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            + ++V    G++ LH AA HG  +++  L+  GA   + +     P H+
Sbjct:  735 LGVNVTSQDGSSPLHVAALHGRADLIPLLLKHGANAGARNADQAVPLHL 783          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANKEF1 (ankyrin repeat and EF-hand domain containing 1 [Source:HGNC Symbol;Acc:HGNC:15803])

HSP 1 Score: 45.0542 bits (105), Expect = 2.143e-10
Identity = 25/74 (33.78%), Postives = 42/74 (56.76%), Query Frame = 2
Query:  275 WRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            W PL +AC     + V+ L+E  + ++  S+   ++PL+ A     +D VK L++ GA    +N+K  +AMDVA
Sbjct:  559 WTPLHFACHAGQQDIVELLVESGALIDAASI-NNSTPLNRAIESCRLDTVKYLLDIGAKFQLENRKGHSAMDVA 631          

HSP 2 Score: 41.2022 bits (95), Expect = 2.143e-10
Identity = 24/78 (30.77%), Postives = 38/78 (48.72%), Query Frame = 3
Query:   81 DDLRKIFDKI-------DKAKNKRKLKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            DD  K+F  I       D A  K+  +  I +D+KD+   T L  A   GNI+++ +L+ +GA + + D     P H 
Sbjct:  487 DDSEKVFSNINIITKAGDLASLKKAFESGIPVDMKDNYYKTPLMTACASGNIDVVKFLLEKGANVNATDNFLWTPLHF 564          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANKEF1 (ankyrin repeat and EF-hand domain containing 1 [Source:HGNC Symbol;Acc:HGNC:15803])

HSP 1 Score: 45.0542 bits (105), Expect = 2.143e-10
Identity = 25/74 (33.78%), Postives = 42/74 (56.76%), Query Frame = 2
Query:  275 WRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            W PL +AC     + V+ L+E  + ++  S+   ++PL+ A     +D VK L++ GA    +N+K  +AMDVA
Sbjct:  559 WTPLHFACHAGQQDIVELLVESGALIDAASI-NNSTPLNRAIESCRLDTVKYLLDIGAKFQLENRKGHSAMDVA 631          

HSP 2 Score: 41.2022 bits (95), Expect = 2.143e-10
Identity = 24/78 (30.77%), Postives = 38/78 (48.72%), Query Frame = 3
Query:   81 DDLRKIFDKI-------DKAKNKRKLKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            DD  K+F  I       D A  K+  +  I +D+KD+   T L  A   GNI+++ +L+ +GA + + D     P H 
Sbjct:  487 DDSEKVFSNINIITKAGDLASLKKAFESGIPVDMKDNYYKTPLMTACASGNIDVVKFLLEKGANVNATDNFLWTPLHF 564          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: CASKIN1 (CASK interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:20879])

HSP 1 Score: 44.2838 bits (103), Expect = 1.025e-9
Identity = 26/77 (33.77%), Postives = 43/77 (55.84%), Query Frame = 2
Query:  272 GWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACE 502
            G RPL YA        +K +++  S VN  S  E + PLH+AA  G+ D+ ++L++H +     +   +T +D+ACE
Sbjct:   82 GMRPLHYAAWQGRKEPMKLVLKAGSAVNIPS-DEGHIPLHLAAQHGHYDVSEMLLQHQSNPCMVDNSGKTPLDLACE 157          

HSP 2 Score: 39.6614 bits (91), Expect = 1.025e-9
Identity = 24/88 (27.27%), Postives = 43/88 (48.86%), Query Frame = 3
Query:   39 KESKLLTAAKNNKYDDLRKIFDKIDKAKNKR-KLKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHMRA 299
            KE +L+ A K       +++  +    K K     + I+++ +D  G +ALH+AA +GN E++  L+   A ++  D     P H  A
Sbjct:    3 KEQELVQAVKAEDVGTAQRLLQRPRPGKAKLLGSTKKINVNFQDPDGFSALHHAALNGNTELISLLLEAQAAVDIKDNKGMRPLHYAA 90          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: EHMT1 (euchromatic histone lysine methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:24650])

HSP 1 Score: 41.5874 bits (96), Expect = 9.860e-9
Identity = 24/75 (32.00%), Postives = 39/75 (52.00%), Query Frame = 2
Query:  272 GWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            GW P+ +A    H++ VK L+   S++N     EEN  LH AA  G +DI ++L+     +H  N    + + +A
Sbjct:  873 GWTPMIWATEYKHVDLVKLLLSKGSDIN-IRDNEENICLHWAAFSGCVDIAEILLAAKCDLHAVNIHGDSPLHIA 946          

HSP 2 Score: 38.891 bits (89), Expect = 9.860e-9
Identity = 21/69 (30.43%), Postives = 38/69 (55.07%), Query Frame = 3
Query:   39 KESKLLTAAKNNKYDDLRKIFDKIDKAKNKRKLKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARG 245
            + + L+ AA+NN  + ++ +            +K    +D KD+ G+T LH AAK G+ E++ YL++ G
Sbjct:  806 QRTPLMEAAENNHLEAVKYL------------IKAGALVDPKDAEGSTCLHLAAKKGHYEVVQYLLSNG 862          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 44.2838 bits (103), Expect = 2.708e-6
Identity = 26/75 (34.67%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  272 GWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            G+ PL  AC    +N VK L+E  ++V +       +PLH AA  G+ + V+ L+E+GA  + Q    QT + +A
Sbjct:  722 GYTPLHVACHFGQLNMVKFLVENGADVGE-KTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 2 Score: 26.9498 bits (58), Expect = 2.708e-6
Identity = 14/48 (29.17%), Postives = 23/48 (47.92%), Query Frame = 3
Query:  150 DIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            D+  K ++G TA+H  A+  ++ +   L   GA I S       P H+
Sbjct:  681 DVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHV 728          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 44.2838 bits (103), Expect = 2.708e-6
Identity = 26/75 (34.67%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  272 GWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            G+ PL  AC    +N VK L+E  ++V +       +PLH AA  G+ + V+ L+E+GA  + Q    QT + +A
Sbjct:  722 GYTPLHVACHFGQLNMVKFLVENGADVGE-KTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 2 Score: 26.9498 bits (58), Expect = 2.708e-6
Identity = 14/48 (29.17%), Postives = 23/48 (47.92%), Query Frame = 3
Query:  150 DIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            D+  K ++G TA+H  A+  ++ +   L   GA I S       P H+
Sbjct:  681 DVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHV 728          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 44.2838 bits (103), Expect = 2.794e-6
Identity = 26/75 (34.67%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  272 GWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            G+ PL  AC    +N VK L+E  ++V +       +PLH AA  G+ + V+ L+E+GA  + Q    QT + +A
Sbjct:  722 GYTPLHVACHFGQLNMVKFLVENGADVGE-KTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 2 Score: 26.9498 bits (58), Expect = 2.794e-6
Identity = 14/48 (29.17%), Postives = 23/48 (47.92%), Query Frame = 3
Query:  150 DIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            D+  K ++G TA+H  A+  ++ +   L   GA I S       P H+
Sbjct:  681 DVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHV 728          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 44.2838 bits (103), Expect = 2.794e-6
Identity = 26/75 (34.67%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  272 GWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            G+ PL  AC    +N VK L+E  ++V +       +PLH AA  G+ + V+ L+E+GA  + Q    QT + +A
Sbjct:  722 GYTPLHVACHFGQLNMVKFLVENGADVGE-KTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 2 Score: 26.9498 bits (58), Expect = 2.794e-6
Identity = 14/48 (29.17%), Postives = 23/48 (47.92%), Query Frame = 3
Query:  150 DIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            D+  K ++G TA+H  A+  ++ +   L   GA I S       P H+
Sbjct:  681 DVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHV 728          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 43.8986 bits (102), Expect = 2.889e-6
Identity = 26/75 (34.67%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  272 GWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            G+ PL  AC    +N VK L+E  ++V +       +PLH AA  G+ + V+ L+E+GA  + Q    QT + +A
Sbjct:  722 GYTPLHVACHFGQLNMVKFLVENGADVGE-KTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 2 Score: 26.9498 bits (58), Expect = 2.889e-6
Identity = 14/48 (29.17%), Postives = 23/48 (47.92%), Query Frame = 3
Query:  150 DIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            D+  K ++G TA+H  A+  ++ +   L   GA I S       P H+
Sbjct:  681 DVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHV 728          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Tnks (gene:FBgn0027508 transcript:FBtr0084890)

HSP 1 Score: 46.9802 bits (110), Expect = 1.786e-9
Identity = 28/79 (35.44%), Postives = 43/79 (54.43%), Query Frame = 2
Query:  266 QNGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACE 502
            + G  PL  AC+  H    + L++  +NVN  S + + +PLH AA  G  DI K+L++HGA    +N+   T  D+  E
Sbjct:  551 KGGLVPLHNACSYGHYEVTELLVKHGANVN-VSDLWKFTPLHEAAAKGKYDICKLLLKHGADPMKKNRDGATPADLVKE 628          

HSP 2 Score: 35.4242 bits (80), Expect = 1.786e-9
Identity = 25/85 (29.41%), Postives = 40/85 (47.06%), Query Frame = 3
Query:   42 ESKLLTAAKNNKYDDLRKIFDKIDKAKNKRKLKENIDIDVKDSSG--TTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFH 290
            E+ LL AAK    D +R+I            L   I ++ +D  G  +T LH+AA    + ++ +L+  GA + + DK    P H
Sbjct:  485 ETHLLEAAKAGDLDTVRRIV-----------LNNPISVNCRDLDGRHSTPLHFAAGFNRVPVVQFLLEHGAEVYAADKGGLVPLH 558          

HSP 3 Score: 40.4318 bits (93), Expect = 9.472e-9
Identity = 23/79 (29.11%), Postives = 42/79 (53.16%), Query Frame = 2
Query:  266 QNGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACE 502
            + G  PL   C+  H   V+ L++  ++ N        +PLH AA  G +D+   L++HGA    +N +++T +++A E
Sbjct:   88 EGGLHPLHNCCSFGHAEVVRLLLKAGASPNTTDNWNY-TPLHEAASKGKVDVCLALLQHGANHTIRNSEQKTPLELADE 165          

HSP 4 Score: 39.2762 bits (90), Expect = 9.472e-9
Identity = 23/74 (31.08%), Postives = 43/74 (58.11%), Query Frame = 3
Query:   81 DDLRKIFD--KIDKAKNKRKLKENIDIDVKDSSG--TTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFH 290
            D LR++F+  K  +    +KL     ++ +D++G  +T LH+AA +G  E++ +L+  GA I++ D+    P H
Sbjct:   22 DPLRELFEACKTGEIAKVKKLITPQTVNARDTAGRKSTPLHFAAGYGRREVVEFLLNSGASIQACDEGGLHPLH 95          

HSP 5 Score: 39.2762 bits (90), Expect = 1.727e-6
Identity = 25/80 (31.25%), Postives = 43/80 (53.75%), Query Frame = 2
Query:  266 QNGWRPLSYACANNHINAVKTLIEWKSNVN---KFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            + G  PL  A +  H++    LI+ K+ VN   K+      +PLH AA  G   +  +L+ HGA  + +N++ QT +++A
Sbjct:  704 KGGLIPLHNASSYGHLDIAALLIKHKTVVNATDKWGF----TPLHEAAQKGRTQLCSLLLAHGADAYMKNQEGQTPIELA 779          

HSP 6 Score: 33.113 bits (74), Expect = 1.727e-6
Identity = 28/90 (31.11%), Postives = 42/90 (46.67%), Query Frame = 3
Query:   27 EMHRKESKLLTAAKNNKYDDLRKIFDKIDKAKNKRKLKENIDIDVKDSSG--TTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFH 290
            E+ R  S LL AAK     +L ++          ++L     I+ +D+ G  +T LH AA + N E   YL+  GA + + DK    P H
Sbjct:  635 ELLRGPSALLDAAKKG---NLARV----------QRLVTPESINCRDAQGRNSTPLHLAAGYNNFECAEYLLENGADVNAQDKGGLIPLH 711          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Tnks (gene:FBgn0027508 transcript:FBtr0330383)

HSP 1 Score: 46.595 bits (109), Expect = 2.241e-9
Identity = 28/79 (35.44%), Postives = 43/79 (54.43%), Query Frame = 2
Query:  266 QNGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACE 502
            + G  PL  AC+  H    + L++  +NVN  S + + +PLH AA  G  DI K+L++HGA    +N+   T  D+  E
Sbjct:  551 KGGLVPLHNACSYGHYEVTELLVKHGANVN-VSDLWKFTPLHEAAAKGKYDICKLLLKHGADPMKKNRDGATPADLVKE 628          

HSP 2 Score: 35.4242 bits (80), Expect = 2.241e-9
Identity = 25/85 (29.41%), Postives = 40/85 (47.06%), Query Frame = 3
Query:   42 ESKLLTAAKNNKYDDLRKIFDKIDKAKNKRKLKENIDIDVKDSSG--TTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFH 290
            E+ LL AAK    D +R+I            L   I ++ +D  G  +T LH+AA    + ++ +L+  GA + + DK    P H
Sbjct:  485 ETHLLEAAKAGDLDTVRRIV-----------LNNPISVNCRDLDGRHSTPLHFAAGFNRVPVVQFLLEHGAEVYAADKGGLVPLH 558          

HSP 3 Score: 40.4318 bits (93), Expect = 1.188e-8
Identity = 23/79 (29.11%), Postives = 42/79 (53.16%), Query Frame = 2
Query:  266 QNGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACE 502
            + G  PL   C+  H   V+ L++  ++ N        +PLH AA  G +D+   L++HGA    +N +++T +++A E
Sbjct:   88 EGGLHPLHNCCSFGHAEVVRLLLKAGASPNTTDNWNY-TPLHEAASKGKVDVCLALLQHGANHTIRNSEQKTPLELADE 165          

HSP 4 Score: 39.2762 bits (90), Expect = 1.188e-8
Identity = 23/74 (31.08%), Postives = 43/74 (58.11%), Query Frame = 3
Query:   81 DDLRKIFD--KIDKAKNKRKLKENIDIDVKDSSG--TTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFH 290
            D LR++F+  K  +    +KL     ++ +D++G  +T LH+AA +G  E++ +L+  GA I++ D+    P H
Sbjct:   22 DPLRELFEACKTGEIAKVKKLITPQTVNARDTAGRKSTPLHFAAGYGRREVVEFLLNSGASIQACDEGGLHPLH 95          

HSP 5 Score: 38.891 bits (89), Expect = 2.125e-6
Identity = 25/80 (31.25%), Postives = 43/80 (53.75%), Query Frame = 2
Query:  266 QNGWRPLSYACANNHINAVKTLIEWKSNVN---KFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            + G  PL  A +  H++    LI+ K+ VN   K+      +PLH AA  G   +  +L+ HGA  + +N++ QT +++A
Sbjct:  704 KGGLIPLHNASSYGHLDIAALLIKHKTVVNATDKWGF----TPLHEAAQKGRTQLCSLLLAHGADAYMKNQEGQTPIELA 779          

HSP 6 Score: 32.7278 bits (73), Expect = 2.125e-6
Identity = 28/90 (31.11%), Postives = 42/90 (46.67%), Query Frame = 3
Query:   27 EMHRKESKLLTAAKNNKYDDLRKIFDKIDKAKNKRKLKENIDIDVKDSSG--TTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFH 290
            E+ R  S LL AAK     +L ++          ++L     I+ +D+ G  +T LH AA + N E   YL+  GA + + DK    P H
Sbjct:  635 ELLRGPSALLDAAKKG---NLARV----------QRLVTPESINCRDAQGRNSTPLHLAAGYNNFECAEYLLENGADVNAQDKGGLIPLH 711          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334062)

HSP 1 Score: 50.8322 bits (120), Expect = 6.331e-9
Identity = 26/77 (33.77%), Postives = 43/77 (55.84%), Query Frame = 2
Query:  272 GWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACE 502
            G  PL  A   N  + ++ L+   + V+  +  E+ +PLHIA+  G +DIV +L++HGA V    K   TA+ +A +
Sbjct:  436 GETPLHLAARANQTDIIRILLRNGAQVDARA-REQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAK 511          

HSP 2 Score: 29.6462 bits (65), Expect = 6.331e-9
Identity = 16/55 (29.09%), Postives = 24/55 (43.64%), Query Frame = 3
Query:  135 LKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHMRA 299
            L+    I     SG T LH AA  G + +++YL+   A  +        P H+ A
Sbjct:  390 LRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAA 444          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303120)

HSP 1 Score: 50.0618 bits (118), Expect = 1.322e-8
Identity = 26/77 (33.77%), Postives = 43/77 (55.84%), Query Frame = 2
Query:  272 GWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACE 502
            G  PL  A   N  + ++ L+   + V+  +  E+ +PLHIA+  G +DIV +L++HGA V    K   TA+ +A +
Sbjct:  586 GETPLHLAARANQTDIIRILLRNGAQVDARA-REQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAK 661          

HSP 2 Score: 29.261 bits (64), Expect = 1.322e-8
Identity = 16/55 (29.09%), Postives = 24/55 (43.64%), Query Frame = 3
Query:  135 LKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHMRA 299
            L+    I     SG T LH AA  G + +++YL+   A  +        P H+ A
Sbjct:  540 LRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAA 594          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303121)

HSP 1 Score: 48.521 bits (114), Expect = 1.891e-7
Identity = 26/77 (33.77%), Postives = 43/77 (55.84%), Query Frame = 2
Query:  272 GWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACE 502
            G  PL  A   N  + ++ L+   + V+  +  E+ +PLHIA+  G +DIV +L++HGA V    K   TA+ +A +
Sbjct:  436 GETPLHLAARANQTDIIRILLRNGAQVDARA-REQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAK 511          

HSP 2 Score: 26.9498 bits (58), Expect = 1.891e-7
Identity = 16/55 (29.09%), Postives = 24/55 (43.64%), Query Frame = 3
Query:  135 LKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHMRA 299
            L+    I     SG T LH AA  G + +++YL+   A  +        P H+ A
Sbjct:  390 LRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAA 444          

HSP 3 Score: 36.965 bits (84), Expect = 3.255e-6
Identity = 24/89 (26.97%), Postives = 43/89 (48.31%), Query Frame = 2
Query:  284 LSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACEIIIMGSLMFS*QHHQS 550
            L  A    H+   K L++  ++ N  +L    +PLHIA     + +V++L+ HGA +    +   T + VA  +  M  +++  QH  S
Sbjct:  341 LHVAAHCGHVRVAKLLLDRNADANARAL-NGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDAS 428          

HSP 4 Score: 34.2686 bits (77), Expect = 3.255e-6
Identity = 20/55 (36.36%), Postives = 31/55 (56.36%), Query Frame = 3
Query:  135 LKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHMRA 299
            L++  +I+ K   G T LH AA+ G+ +++  L+ RGA I +  K    P HM A
Sbjct:  258 LEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAA 312          

HSP 5 Score: 36.1946 bits (82), Expect = 5.183e-6
Identity = 15/40 (37.50%), Postives = 25/40 (62.50%), Query Frame = 2
Query:  380 SPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVAC 499
            +PLH+ A +G+I + ++L++  A V  Q K   T + VAC
Sbjct:  537 TPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVAC 576          

HSP 6 Score: 34.2686 bits (77), Expect = 5.183e-6
Identity = 18/55 (32.73%), Postives = 26/55 (47.27%), Query Frame = 3
Query:  135 LKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHMRA 299
            L+    +D       TALH AAK G  E+   L+  GA +++  K    P H+ A
Sbjct:  489 LQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTA 543          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:ZFIN;Acc:ZDB-GENE-050112-1])

HSP 1 Score: 44.2838 bits (103), Expect = 1.100e-9
Identity = 24/72 (33.33%), Postives = 41/72 (56.94%), Query Frame = 2
Query:  281 PLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            PL  A A  +   ++ L++  ++ N     E N+PLH+A      +  K+L+EHGA ++ +NK+K T + VA
Sbjct:  142 PLHRASAKGNYRLIQLLLKESASTN-IQDSEGNTPLHLACDEERAEAAKLLVEHGASIYIENKEKMTPLQVA 212          

HSP 2 Score: 39.2762 bits (90), Expect = 1.100e-9
Identity = 17/51 (33.33%), Postives = 31/51 (60.78%), Query Frame = 3
Query:  147 IDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHMRA 299
            +++D+KD +  T LH AA  G  E++  L+++GA + S+++    P H  A
Sbjct:   64 VEVDLKDDACWTPLHIAASAGREEIVRSLISKGAQLNSVNQNGCTPLHYAA 114          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:ZFIN;Acc:ZDB-GENE-050112-1])

HSP 1 Score: 44.2838 bits (103), Expect = 1.100e-9
Identity = 24/72 (33.33%), Postives = 41/72 (56.94%), Query Frame = 2
Query:  281 PLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            PL  A A  +   ++ L++  ++ N     E N+PLH+A      +  K+L+EHGA ++ +NK+K T + VA
Sbjct:  142 PLHRASAKGNYRLIQLLLKESASTN-IQDSEGNTPLHLACDEERAEAAKLLVEHGASIYIENKEKMTPLQVA 212          

HSP 2 Score: 39.2762 bits (90), Expect = 1.100e-9
Identity = 17/51 (33.33%), Postives = 31/51 (60.78%), Query Frame = 3
Query:  147 IDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHMRA 299
            +++D+KD +  T LH AA  G  E++  L+++GA + S+++    P H  A
Sbjct:   64 VEVDLKDDACWTPLHIAASAGREEIVRSLISKGAQLNSVNQNGCTPLHYAA 114          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: tanc1b (tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 1b [Source:ZFIN;Acc:ZDB-GENE-130530-956])

HSP 1 Score: 46.9802 bits (110), Expect = 1.175e-9
Identity = 28/77 (36.36%), Postives = 41/77 (53.25%), Query Frame = 2
Query:  266 QNGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            + G  PLS+AC   H + V+ L+E K  V   S     SPL +AA +G  DIV  L+E GA++ + +      +D A
Sbjct: 1135 KEGLTPLSWACLKGHKSVVQFLVE-KGAVIDHSDKNGRSPLDLAAFYGDADIVHYLVEKGAVIEHVDYSGMRPLDRA 1210          

HSP 2 Score: 36.5798 bits (83), Expect = 1.175e-9
Identity = 16/45 (35.56%), Postives = 27/45 (60.00%), Query Frame = 3
Query:  135 LKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDK 269
            L+   D++V D  G T L  AA  G++    +L+++GA + S+DK
Sbjct: 1091 LQHGADVNVSDKQGRTLLMVAACEGHLSTADFLLSKGASVASVDK 1135          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: tanc1b (tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 1b [Source:ZFIN;Acc:ZDB-GENE-130530-956])

HSP 1 Score: 46.9802 bits (110), Expect = 1.294e-9
Identity = 28/77 (36.36%), Postives = 41/77 (53.25%), Query Frame = 2
Query:  266 QNGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            + G  PLS+AC   H + V+ L+E K  V   S     SPL +AA +G  DIV  L+E GA++ + +      +D A
Sbjct: 1203 KEGLTPLSWACLKGHKSVVQFLVE-KGAVIDHSDKNGRSPLDLAAFYGDADIVHYLVEKGAVIEHVDYSGMRPLDRA 1278          

HSP 2 Score: 36.1946 bits (82), Expect = 1.294e-9
Identity = 16/45 (35.56%), Postives = 27/45 (60.00%), Query Frame = 3
Query:  135 LKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDK 269
            L+   D++V D  G T L  AA  G++    +L+++GA + S+DK
Sbjct: 1159 LQHGADVNVSDKQGRTLLMVAACEGHLSTADFLLSKGASVASVDK 1203          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: dapk1 (death-associated protein kinase 1 [Source:ZFIN;Acc:ZDB-GENE-060526-177])

HSP 1 Score: 43.5134 bits (101), Expect = 1.701e-9
Identity = 19/49 (38.78%), Postives = 32/49 (65.31%), Query Frame = 3
Query:  153 IDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHMRA 299
            +D++D SG TALH AA++GN++++ YL +  A  + +D+    P H  A
Sbjct:  438 LDIQDKSGETALHVAARYGNVDVVQYLCSIHANPDLLDREQETPLHCAA 486          

HSP 2 Score: 39.2762 bits (90), Expect = 1.701e-9
Identity = 28/91 (30.77%), Postives = 46/91 (50.55%), Query Frame = 2
Query:  281 PLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA---CEIIIMGSLMFS*QHH 544
            PL  A  + +    + L E   +VN  +  E  SPL  A+  G+ DIV+ L+EHGA +   +K    A+ +A   C++ ++  L+    HH
Sbjct:  481 PLHCAAWHGYSAVARALCEAGCDVNARN-REGESPLLTASARGFKDIVECLLEHGADMDSADKDGHIALHLAVRRCQVEVVKCLL---SHH 567          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ANKRD27 (ankyrin repeat domain 27 [Source:NCBI gene;Acc:100493046])

HSP 1 Score: 63.5438 bits (153), Expect = 3.362e-14
Identity = 34/78 (43.59%), Postives = 47/78 (60.26%), Query Frame = 2
Query:  269 NGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEE--NSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            NG  PL  AC   H + VK L+ +  N  K   + E  ++PLHIAA +GY  I++VL+E+GA    QNK+K+T M  A
Sbjct:  539 NGNTPLHLACTYGHEDCVKALVYYDLNSCKIDTVNEKGDTPLHIAARWGYQGIIEVLLENGANTDIQNKRKETPMQCA 616          

HSP 2 Score: 35.8094 bits (81), Expect = 3.362e-14
Identity = 14/44 (31.82%), Postives = 25/44 (56.82%), Query Frame = 3
Query:  162 KDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            +D  G T LH AA +G  + +  L+++GA + + D +   P H+
Sbjct:  470 RDDRGYTPLHIAALYGQAQCVDLLISKGAVVNATDYLGSTPLHL 513          

HSP 3 Score: 54.299 bits (129), Expect = 7.644e-7
Identity = 32/79 (40.51%), Postives = 48/79 (60.76%), Query Frame = 2
Query:  257 IN*QNGWR--PLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAM 487
            ++ +NG R  PL  AC   H+  VKTL+E+ +  NK   M  N+PL  A   G+++I  +L+EHGA V+ +N K  TA+
Sbjct:  752 VDVKNGNRALPLHLACHKGHLEVVKTLMEYSTGKNKKD-MNGNTPLLYACMGGHLEIALLLLEHGASVNIRNVKGNTAL 829          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ANKRD27 (ankyrin repeat domain 27 [Source:NCBI gene;Acc:100493046])

HSP 1 Score: 63.5438 bits (153), Expect = 4.223e-14
Identity = 34/78 (43.59%), Postives = 47/78 (60.26%), Query Frame = 2
Query:  269 NGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEE--NSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            NG  PL  AC   H + VK L+ +  N  K   + E  ++PLHIAA +GY  I++VL+E+GA    QNK+K+T M  A
Sbjct:  504 NGNTPLHLACTYGHEDCVKALVYYDLNSCKIDTVNEKGDTPLHIAARWGYQGIIEVLLENGANTDIQNKRKETPMQCA 581          

HSP 2 Score: 35.4242 bits (80), Expect = 4.223e-14
Identity = 14/44 (31.82%), Postives = 25/44 (56.82%), Query Frame = 3
Query:  162 KDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            +D  G T LH AA +G  + +  L+++GA + + D +   P H+
Sbjct:  435 RDDRGYTPLHIAALYGQAQCVDLLISKGAVVNATDYLGSTPLHL 478          

HSP 3 Score: 54.6842 bits (130), Expect = 6.591e-7
Identity = 33/82 (40.24%), Postives = 49/82 (59.76%), Query Frame = 2
Query:  257 IN*QNGWR--PLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            ++ +NG R  PL  AC   H+  VKTL+E+ +  NK   M  N+PL  A   G+++I  +L+EHGA V+ +N K  TA+  A
Sbjct:  742 VDVKNGNRALPLHLACHKGHLEVVKTLMEYSTGKNKKD-MNGNTPLLYACMGGHLEIALLLLEHGASVNIRNVKGNTALHEA 822          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ANKRD27 (ankyrin repeat domain 27 [Source:NCBI gene;Acc:100493046])

HSP 1 Score: 63.929 bits (154), Expect = 5.549e-14
Identity = 34/78 (43.59%), Postives = 47/78 (60.26%), Query Frame = 2
Query:  269 NGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEE--NSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            NG  PL  AC   H + VK L+ +  N  K   + E  ++PLHIAA +GY  I++VL+E+GA    QNK+K+T M  A
Sbjct:  524 NGNTPLHLACTYGHEDCVKALVYYDLNSCKIDTVNEKGDTPLHIAARWGYQGIIEVLLENGANTDIQNKRKETPMQCA 601          

HSP 2 Score: 35.039 bits (79), Expect = 5.549e-14
Identity = 14/44 (31.82%), Postives = 25/44 (56.82%), Query Frame = 3
Query:  162 KDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            +D  G T LH AA +G  + +  L+++GA + + D +   P H+
Sbjct:  455 RDDRGYTPLHIAALYGQAQCVDLLISKGAVVNATDYLGSTPLHL 498          

HSP 3 Score: 54.6842 bits (130), Expect = 6.779e-7
Identity = 32/79 (40.51%), Postives = 48/79 (60.76%), Query Frame = 2
Query:  257 IN*QNGWR--PLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAM 487
            ++ +NG R  PL  AC   H+  VKTL+E+ +  NK   M  N+PL  A   G+++I  +L+EHGA V+ +N K  TA+
Sbjct:  744 VDVKNGNRALPLHLACHKGHLEVVKTLMEYSTGKNKKD-MNGNTPLLYACMGGHLEIALLLLEHGASVNIRNVKGNTAL 821          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ANKRD27 (ankyrin repeat domain 27 [Source:NCBI gene;Acc:100493046])

HSP 1 Score: 63.929 bits (154), Expect = 5.594e-14
Identity = 34/78 (43.59%), Postives = 47/78 (60.26%), Query Frame = 2
Query:  269 NGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEE--NSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            NG  PL  AC   H + VK L+ +  N  K   + E  ++PLHIAA +GY  I++VL+E+GA    QNK+K+T M  A
Sbjct:  524 NGNTPLHLACTYGHEDCVKALVYYDLNSCKIDTVNEKGDTPLHIAARWGYQGIIEVLLENGANTDIQNKRKETPMQCA 601          

HSP 2 Score: 35.039 bits (79), Expect = 5.594e-14
Identity = 14/44 (31.82%), Postives = 25/44 (56.82%), Query Frame = 3
Query:  162 KDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            +D  G T LH AA +G  + +  L+++GA + + D +   P H+
Sbjct:  455 RDDRGYTPLHIAALYGQAQCVDLLISKGAVVNATDYLGSTPLHL 498          

HSP 3 Score: 54.6842 bits (130), Expect = 6.776e-7
Identity = 32/79 (40.51%), Postives = 48/79 (60.76%), Query Frame = 2
Query:  257 IN*QNGWR--PLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAM 487
            ++ +NG R  PL  AC   H+  VKTL+E+ +  NK   M  N+PL  A   G+++I  +L+EHGA V+ +N K  TA+
Sbjct:  744 VDVKNGNRALPLHLACHKGHLEVVKTLMEYSTGKNKKD-MNGNTPLLYACMGGHLEIALLLLEHGASVNIRNVKGNTAL 821          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ANKRD27 (ankyrin repeat domain 27 [Source:NCBI gene;Acc:100493046])

HSP 1 Score: 63.5438 bits (153), Expect = 5.921e-14
Identity = 34/78 (43.59%), Postives = 47/78 (60.26%), Query Frame = 2
Query:  269 NGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEE--NSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            NG  PL  AC   H + VK L+ +  N  K   + E  ++PLHIAA +GY  I++VL+E+GA    QNK+K+T M  A
Sbjct:  526 NGNTPLHLACTYGHEDCVKALVYYDLNSCKIDTVNEKGDTPLHIAARWGYQGIIEVLLENGANTDIQNKRKETPMQCA 603          

HSP 2 Score: 35.039 bits (79), Expect = 5.921e-14
Identity = 14/44 (31.82%), Postives = 25/44 (56.82%), Query Frame = 3
Query:  162 KDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            +D  G T LH AA +G  + +  L+++GA + + D +   P H+
Sbjct:  457 RDDRGYTPLHIAALYGQAQCVDLLISKGAVVNATDYLGSTPLHL 500          

HSP 3 Score: 54.6842 bits (130), Expect = 7.045e-7
Identity = 32/79 (40.51%), Postives = 48/79 (60.76%), Query Frame = 2
Query:  257 IN*QNGWR--PLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAM 487
            ++ +NG R  PL  AC   H+  VKTL+E+ +  NK   M  N+PL  A   G+++I  +L+EHGA V+ +N K  TA+
Sbjct:  759 VDVKNGNRALPLHLACHKGHLEVVKTLMEYSTGKNKKD-MNGNTPLLYACMGGHLEIALLLLEHGASVNIRNVKGNTAL 836          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ankef1 (ankyrin repeat and EF-hand domain containing 1 [Source:MGI Symbol;Acc:MGI:2441685])

HSP 1 Score: 43.8986 bits (102), Expect = 1.629e-10
Identity = 23/74 (31.08%), Postives = 41/74 (55.41%), Query Frame = 2
Query:  275 WRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            W PL +AC     + V+ L++  ++++  S+   ++PL  A     +D VK L++ GA    +N+K   AMD+A
Sbjct:  559 WTPLHFACHAGQQDIVELLVKAGASIDATSI-NNSTPLSRAIESCRLDTVKYLLDMGAKFQIENRKGHAAMDIA 631          

HSP 2 Score: 42.3578 bits (98), Expect = 1.629e-10
Identity = 23/78 (29.49%), Postives = 40/78 (51.28%), Query Frame = 3
Query:   81 DDLRKIFDKI-------DKAKNKRKLKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            DD  ++F  I       D A  K+ ++  I +D+KD++  T L  A   GNI+++ +L+ +GA + + D     P H 
Sbjct:  487 DDPSRVFANISFITKAGDLASLKKAIETGIPVDMKDNTYKTPLMIACASGNIDVVKFLIEKGANVNATDNFLWTPLHF 564          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ankef1 (ankyrin repeat and EF-hand domain containing 1 [Source:MGI Symbol;Acc:MGI:2441685])

HSP 1 Score: 43.8986 bits (102), Expect = 1.629e-10
Identity = 23/74 (31.08%), Postives = 41/74 (55.41%), Query Frame = 2
Query:  275 WRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            W PL +AC     + V+ L++  ++++  S+   ++PL  A     +D VK L++ GA    +N+K   AMD+A
Sbjct:  559 WTPLHFACHAGQQDIVELLVKAGASIDATSI-NNSTPLSRAIESCRLDTVKYLLDMGAKFQIENRKGHAAMDIA 631          

HSP 2 Score: 42.3578 bits (98), Expect = 1.629e-10
Identity = 23/78 (29.49%), Postives = 40/78 (51.28%), Query Frame = 3
Query:   81 DDLRKIFDKI-------DKAKNKRKLKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            DD  ++F  I       D A  K+ ++  I +D+KD++  T L  A   GNI+++ +L+ +GA + + D     P H 
Sbjct:  487 DDPSRVFANISFITKAGDLASLKKAIETGIPVDMKDNTYKTPLMIACASGNIDVVKFLIEKGANVNATDNFLWTPLHF 564          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ankef1 (ankyrin repeat and EF-hand domain containing 1 [Source:MGI Symbol;Acc:MGI:2441685])

HSP 1 Score: 43.8986 bits (102), Expect = 1.629e-10
Identity = 23/74 (31.08%), Postives = 41/74 (55.41%), Query Frame = 2
Query:  275 WRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            W PL +AC     + V+ L++  ++++  S+   ++PL  A     +D VK L++ GA    +N+K   AMD+A
Sbjct:  559 WTPLHFACHAGQQDIVELLVKAGASIDATSI-NNSTPLSRAIESCRLDTVKYLLDMGAKFQIENRKGHAAMDIA 631          

HSP 2 Score: 42.3578 bits (98), Expect = 1.629e-10
Identity = 23/78 (29.49%), Postives = 40/78 (51.28%), Query Frame = 3
Query:   81 DDLRKIFDKI-------DKAKNKRKLKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            DD  ++F  I       D A  K+ ++  I +D+KD++  T L  A   GNI+++ +L+ +GA + + D     P H 
Sbjct:  487 DDPSRVFANISFITKAGDLASLKKAIETGIPVDMKDNTYKTPLMIACASGNIDVVKFLIEKGANVNATDNFLWTPLHF 564          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ankrd27 (ankyrin repeat domain 27 (VPS9 domain) [Source:MGI Symbol;Acc:MGI:2444103])

HSP 1 Score: 48.9062 bits (115), Expect = 5.284e-10
Identity = 26/78 (33.33%), Postives = 42/78 (53.85%), Query Frame = 2
Query:  269 NGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEE--NSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            NG  PL  AC     + VK L+ +     +  +  E  ++ LHIAA +GY  I++ L+++GA    QN+ K+T +  A
Sbjct:  528 NGNTPLHLACTYGQEDCVKALVYYDVQACRLDIGNEKGDTALHIAARWGYEGIIETLLQNGAPTAVQNRLKETPLKCA 605          

HSP 2 Score: 35.4242 bits (80), Expect = 5.284e-10
Identity = 15/44 (34.09%), Postives = 24/44 (54.55%), Query Frame = 3
Query:  162 KDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            +D  G T LH AA  G   ++ +LV++GA + + D     P H+
Sbjct:  459 RDDRGQTPLHVAALCGQASLIDFLVSKGAVVNATDYHGSTPLHL 502          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ankrd27 (ankyrin repeat domain 27 (VPS9 domain) [Source:MGI Symbol;Acc:MGI:2444103])

HSP 1 Score: 48.9062 bits (115), Expect = 6.125e-10
Identity = 26/78 (33.33%), Postives = 42/78 (53.85%), Query Frame = 2
Query:  269 NGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEE--NSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            NG  PL  AC     + VK L+ +     +  +  E  ++ LHIAA +GY  I++ L+++GA    QN+ K+T +  A
Sbjct:  528 NGNTPLHLACTYGQEDCVKALVYYDVQACRLDIGNEKGDTALHIAARWGYEGIIETLLQNGAPTAVQNRLKETPLKCA 605          

HSP 2 Score: 35.4242 bits (80), Expect = 6.125e-10
Identity = 15/44 (34.09%), Postives = 24/44 (54.55%), Query Frame = 3
Query:  162 KDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            +D  G T LH AA  G   ++ +LV++GA + + D     P H+
Sbjct:  459 RDDRGQTPLHVAALCGQASLIDFLVSKGAVVNATDYHGSTPLHL 502          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96NW4|ANR27_HUMAN (Ankyrin repeat domain-containing protein 27 OS=Homo sapiens OX=9606 GN=ANKRD27 PE=1 SV=2)

HSP 1 Score: 54.6842 bits (130), Expect = 3.473e-10
Identity = 27/78 (34.62%), Postives = 44/78 (56.41%), Query Frame = 2
Query:  269 NGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEE--NSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            NG  PL  AC   H + VK L+ +     +  +  E  ++PLHIAA +GY  +++ L+++GA    QN+ K+T +  A
Sbjct:  528 NGNTPLHLACTYGHEDCVKALVYYDVESCRLDIGNEKGDTPLHIAARWGYQGVIETLLQNGASTEIQNRLKETPLKCA 605          

HSP 2 Score: 33.113 bits (74), Expect = 3.473e-10
Identity = 15/44 (34.09%), Postives = 23/44 (52.27%), Query Frame = 3
Query:  162 KDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            +D  G T LH AA  G   ++  LV++GA + + D     P H+
Sbjct:  459 RDDRGHTPLHVAAVCGQASLIDLLVSKGAMVNATDYHGATPLHL 502          

HSP 3 Score: 46.2098 bits (108), Expect = 1.893e-6
Identity = 25/69 (36.23%), Postives = 38/69 (55.07%), Query Frame = 2
Query:  281 PLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAM 487
            PL  AC   H   VK L++  +  NK  L   N+PL  A   G+ ++V +L++HGA ++  N K  TA+
Sbjct:  780 PLHLACQQGHFQVVKCLLDSNAKPNKKDL-SGNTPLIYACSGGHHELVALLLQHGASINASNNKGNTAL 847          

HSP 4 Score: 28.8758 bits (63), Expect = 1.893e-6
Identity = 13/49 (26.53%), Postives = 25/49 (51.02%), Query Frame = 3
Query:  147 IDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            + ++V    G++ LH AA HG  +++  L+  GA   + +     P H+
Sbjct:  735 LGVNVTSQDGSSPLHVAALHGRADLIPLLLKHGANAGARNADQAVPLHL 783          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5REW9|ANR27_PONAB (Ankyrin repeat domain-containing protein 27 OS=Pongo abelii OX=9601 GN=ANKRD27 PE=2 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 4.541e-10
Identity = 28/78 (35.90%), Postives = 44/78 (56.41%), Query Frame = 2
Query:  269 NGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEE--NSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            NG  PL  AC   H + VK L+ +     +  +  E  ++PLHIAA +GY  I++ L+++GA    QN+ K+T +  A
Sbjct:  528 NGNTPLHLACTYGHEDCVKALVYYDVESCRLDIGNEKGDTPLHIAARWGYQAIIETLLQNGASPEIQNRLKETPLKCA 605          

HSP 2 Score: 33.4982 bits (75), Expect = 4.541e-10
Identity = 15/44 (34.09%), Postives = 23/44 (52.27%), Query Frame = 3
Query:  162 KDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            +D  G T LH AA  G   ++  LV++GA + + D     P H+
Sbjct:  459 RDDRGHTPLHVAALCGQASLIDLLVSKGAVVNATDYHGATPLHL 502          

HSP 3 Score: 46.9802 bits (110), Expect = 5.805e-6
Identity = 25/69 (36.23%), Postives = 38/69 (55.07%), Query Frame = 2
Query:  281 PLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAM 487
            PL  AC   H   VK L++  +  NK  L   N+PL  A   G+ ++V +L++HGA ++  N K  TA+
Sbjct:  780 PLHLACQQGHFQVVKCLLDSNAKPNKKDL-SGNTPLIYACSGGHHEVVALLLQHGAAINTSNNKGNTAL 847          

HSP 4 Score: 26.5646 bits (57), Expect = 5.805e-6
Identity = 12/49 (24.49%), Postives = 25/49 (51.02%), Query Frame = 3
Query:  147 IDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            + ++V    G++ L+ AA HG  +++  L+  GA   + +     P H+
Sbjct:  735 LGVNVTSQDGSSPLYVAALHGRADLIPLLLKHGANAGARNADQAVPLHL 783          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9NU02|ANKE1_HUMAN (Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKEF1 PE=2 SV=2)

HSP 1 Score: 45.0542 bits (105), Expect = 9.446e-10
Identity = 25/74 (33.78%), Postives = 42/74 (56.76%), Query Frame = 2
Query:  275 WRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            W PL +AC     + V+ L+E  + ++  S+   ++PL+ A     +D VK L++ GA    +N+K  +AMDVA
Sbjct:  559 WTPLHFACHAGQQDIVELLVESGALIDAASI-NNSTPLNRAIESCRLDTVKYLLDIGAKFQLENRKGHSAMDVA 631          

HSP 2 Score: 41.2022 bits (95), Expect = 9.446e-10
Identity = 24/78 (30.77%), Postives = 38/78 (48.72%), Query Frame = 3
Query:   81 DDLRKIFDKI-------DKAKNKRKLKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            DD  K+F  I       D A  K+  +  I +D+KD+   T L  A   GNI+++ +L+ +GA + + D     P H 
Sbjct:  487 DDSEKVFSNINIITKAGDLASLKKAFESGIPVDMKDNYYKTPLMTACASGNIDVVKFLLEKGANVNATDNFLWTPLHF 564          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9D2J7|ANKE1_MOUSE (Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ankef1 PE=2 SV=1)

HSP 1 Score: 43.8986 bits (102), Expect = 9.919e-10
Identity = 23/74 (31.08%), Postives = 41/74 (55.41%), Query Frame = 2
Query:  275 WRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            W PL +AC     + V+ L++  ++++  S+   ++PL  A     +D VK L++ GA    +N+K   AMD+A
Sbjct:  559 WTPLHFACHAGQQDIVELLVKAGASIDATSI-NNSTPLSRAIESCRLDTVKYLLDMGAKFQIENRKGHAAMDIA 631          

HSP 2 Score: 42.3578 bits (98), Expect = 9.919e-10
Identity = 23/78 (29.49%), Postives = 40/78 (51.28%), Query Frame = 3
Query:   81 DDLRKIFDKI-------DKAKNKRKLKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            DD  ++F  I       D A  K+ ++  I +D+KD++  T L  A   GNI+++ +L+ +GA + + D     P H 
Sbjct:  487 DDPSRVFANISFITKAGDLASLKKAIETGIPVDMKDNTYKTPLMIACASGNIDVVKFLIEKGANVNATDNFLWTPLHF 564          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3UMR0|ANR27_MOUSE (Ankyrin repeat domain-containing protein 27 OS=Mus musculus OX=10090 GN=Ankrd27 PE=1 SV=2)

HSP 1 Score: 48.9062 bits (115), Expect = 3.216e-9
Identity = 26/78 (33.33%), Postives = 42/78 (53.85%), Query Frame = 2
Query:  269 NGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEE--NSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            NG  PL  AC     + VK L+ +     +  +  E  ++ LHIAA +GY  I++ L+++GA    QN+ K+T +  A
Sbjct:  528 NGNTPLHLACTYGQEDCVKALVYYDVQACRLDIGNEKGDTALHIAARWGYEGIIETLLQNGAPTAVQNRLKETPLKCA 605          

HSP 2 Score: 35.4242 bits (80), Expect = 3.216e-9
Identity = 15/44 (34.09%), Postives = 24/44 (54.55%), Query Frame = 3
Query:  162 KDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            +D  G T LH AA  G   ++ +LV++GA + + D     P H+
Sbjct:  459 RDDRGQTPLHVAALCGQASLIDFLVSKGAVVNATDYHGSTPLHL 502          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A3P8V9R6 (CASK interacting protein 2 OS=Cynoglossus semilaevis OX=244447 GN=CASKIN2 PE=4 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 1.350e-12
Identity = 33/90 (36.67%), Postives = 53/90 (58.89%), Query Frame = 2
Query:  269 NGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACEI--IIMGSLMFS 532
            NG RPL YA      + V TL+   ++VN  SL +   PLH+AA +G+ ++ ++L++H +     NK K+T +D+ACE   I +  L+ S
Sbjct:   81 NGMRPLHYASWQGKGDCVLTLLRAGASVNAVSL-DGQIPLHLAAQYGHFEVSEMLLQHQSNPCLINKAKKTPLDLACEFGRIKVAQLLLS 169          

HSP 2 Score: 46.2098 bits (108), Expect = 1.350e-12
Identity = 26/85 (30.59%), Postives = 44/85 (51.76%), Query Frame = 3
Query:   39 KESKLLTAAKNNKYDDLRKIFDKIDKAKNKR-KLKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFH 290
            KE +LL A KN      +K+  K+  ++NK     + ++I+ +D  G +ALH+AA  G  +M+  L+   A ++  D     P H
Sbjct:    3 KEQELLQAVKNGDLVSTQKLLSKLKSSRNKLLSSNKRLNINFQDCDGFSALHHAALTGTTDMISVLIQAQAMVDIRDTNGMRPLH 87          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A3P8V9U0 (CASK interacting protein 2 OS=Cynoglossus semilaevis OX=244447 GN=CASKIN2 PE=4 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 1.631e-12
Identity = 33/90 (36.67%), Postives = 53/90 (58.89%), Query Frame = 2
Query:  269 NGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACEI--IIMGSLMFS 532
            NG RPL YA      + V TL+   ++VN  SL +   PLH+AA +G+ ++ ++L++H +     NK K+T +D+ACE   I +  L+ S
Sbjct:   81 NGMRPLHYASWQGKGDCVLTLLRAGASVNAVSL-DGQIPLHLAAQYGHFEVSEMLLQHQSNPCLINKAKKTPLDLACEFGRIKVAQLLLS 169          

HSP 2 Score: 45.8246 bits (107), Expect = 1.631e-12
Identity = 26/85 (30.59%), Postives = 44/85 (51.76%), Query Frame = 3
Query:   39 KESKLLTAAKNNKYDDLRKIFDKIDKAKNKR-KLKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFH 290
            KE +LL A KN      +K+  K+  ++NK     + ++I+ +D  G +ALH+AA  G  +M+  L+   A ++  D     P H
Sbjct:    3 KEQELLQAVKNGDLVSTQKLLSKLKSSRNKLLSSNKRLNINFQDCDGFSALHHAALTGTTDMISVLIQAQAMVDIRDTNGMRPLH 87          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A429GPX4 (ANK_REP_REGION domain-containing protein OS=Candidatus Methanodesulfokores washburnensis OX=2478471 GN=D6D85_05465 PE=4 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 2.526e-12
Identity = 28/77 (36.36%), Postives = 49/77 (63.64%), Query Frame = 2
Query:  272 GWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACE 502
            G  PL +A AN  ++ V+ L++  ++VN  S     +PLH+AA  G++DI K+L++ GA ++ +N   +T +D+A E
Sbjct:   92 GETPLHWAAANGRLDVVEFLVDRGADVNAKS-KAGWTPLHLAADKGHLDIAKLLLDRGADINAKNGGGKTPLDLARE 167          

HSP 2 Score: 49.6766 bits (117), Expect = 2.526e-12
Identity = 28/73 (38.36%), Postives = 40/73 (54.79%), Query Frame = 3
Query:   81 DDLRKIFDKIDKAKNKRKLKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHMRA 299
            DDL    ++ D  K KR L E  D++ KD  G T LH+AA +G++ ++  LV RGA + +  K    P H  A
Sbjct:   28 DDLFDAANRGDLKKVKRLLNEGADVNAKDEDGWTPLHWAAYYGHLNVVKLLVDRGADVNAKSKAGETPLHWAA 100          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A3P8VI36 (CASK interacting protein 2 OS=Cynoglossus semilaevis OX=244447 GN=CASKIN2 PE=4 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 2.847e-12
Identity = 33/90 (36.67%), Postives = 53/90 (58.89%), Query Frame = 2
Query:  269 NGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACEI--IIMGSLMFS 532
            NG RPL YA      + V TL+   ++VN  SL +   PLH+AA +G+ ++ ++L++H +     NK K+T +D+ACE   I +  L+ S
Sbjct:   81 NGMRPLHYASWQGKGDCVLTLLRAGASVNAVSL-DGQIPLHLAAQYGHFEVSEMLLQHQSNPCLINKAKKTPLDLACEFGRIKVAQLLLS 169          

HSP 2 Score: 45.0542 bits (105), Expect = 2.847e-12
Identity = 28/86 (32.56%), Postives = 45/86 (52.33%), Query Frame = 3
Query:   39 KESKLLTAAKNNKYDDLRKIFDKIDKAKNKRKLKEN--IDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFH 290
            KE +LL A KN      +K+  K+  ++NK  L  N  ++I+ +D  G +ALH+AA  G  +M+  L+   A ++  D     P H
Sbjct:    3 KEQELLQAVKNGDLVSTQKLLSKLKSSRNKL-LSSNKRLNINFQDCDGFSALHHAALTGTTDMISVLIQAQAMVDIRDTNGMRPLH 87          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: J9HSB7 (AAEL017480-PA (Fragment) OS=Aedes aegypti OX=7159 GN=AaeL_AAEL017480 PE=4 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 4.623e-12
Identity = 29/77 (37.66%), Postives = 51/77 (66.23%), Query Frame = 2
Query:  272 GWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACE 502
            GW PL YA  N H+  VK LI+ ++NV+     E  +PLH A+  G++++VK+L+++GA V  +N ++ T++ +A +
Sbjct:  207 GWTPLHYASRNGHLEVVKLLIDDEANVDTTD-NEGWTPLHDASLIGHLEVVKLLIDNGANVDTKNTRRPTSLHIASQ 282          

HSP 2 Score: 41.5874 bits (96), Expect = 4.623e-12
Identity = 15/47 (31.91%), Postives = 29/47 (61.70%), Query Frame = 3
Query:  150 DIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFH 290
            ++D  D+ G T LHYA+++G +E++ +L+  GA +++       P H
Sbjct:  166 NVDTTDNEGWTPLHYASRNGRLEVVKFLIDNGANVDTTQNEGWTPLH 212          

HSP 3 Score: 52.7582 bits (125), Expect = 5.205e-8
Identity = 28/77 (36.36%), Postives = 46/77 (59.74%), Query Frame = 2
Query:  272 GWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACE 502
            GW PL +A  N H+  VK LI+ ++NV+  +  EE +PLH A+  G +++VK L+++GA V   + +  T +  A  
Sbjct:   42 GWTPLHFASQNGHLEVVKLLIDNRANVDT-TQNEEWTPLHYASRNGRLEVVKFLIDNGANVDTTDNEGWTPLHYASR 117          

HSP 4 Score: 35.8094 bits (81), Expect = 5.205e-8
Identity = 14/50 (28.00%), Postives = 28/50 (56.00%), Query Frame = 3
Query:  150 DIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHMRA 299
            ++D   + G T LHYA+ +G++E++  L+  GA +++       P H  +
Sbjct:    1 NVDTTRNEGWTPLHYASLNGHLEVVKLLIDNGANVDTTQNKGWTPLHFAS 50          

HSP 5 Score: 44.669 bits (104), Expect = 8.473e-7
Identity = 26/77 (33.77%), Postives = 41/77 (53.25%), Query Frame = 2
Query:  272 GWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACE 502
            GW PL YA  N  +  VK +I+  +NV+     E  +PLH A+  G +++VK L+++GA V     +  T +  A  
Sbjct:  141 GWTPLHYASRNGRLEVVKFMIDNGANVDTTD-NEGWTPLHYASRNGRLEVVKFLIDNGANVDTTQNEGWTPLHYASR 216          

HSP 6 Score: 39.6614 bits (91), Expect = 8.473e-7
Identity = 15/47 (31.91%), Postives = 29/47 (61.70%), Query Frame = 3
Query:  150 DIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFH 290
            ++D  D+ G T LHYA+++G++E++  L+  GA +++       P H
Sbjct:  100 NVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTTRNEGWTPLH 146          

HSP 7 Score: 48.9062 bits (115), Expect = 3.009e-6
Identity = 27/77 (35.06%), Postives = 44/77 (57.14%), Query Frame = 2
Query:  272 GWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACE 502
            GW PL YA  N H+  VK LI+  +NV+  +  E  +PLH A+  G +++VK ++++GA V   + +  T +  A  
Sbjct:  108 GWTPLHYASRNGHLEVVKLLIDNGANVDT-TRNEGWTPLHYASRNGRLEVVKFMIDNGANVDTTDNEGWTPLHYASR 183          

HSP 8 Score: 33.4982 bits (75), Expect = 3.009e-6
Identity = 12/47 (25.53%), Postives = 28/47 (59.57%), Query Frame = 3
Query:  150 DIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFH 290
            ++D   + G T LH+A+++G++E++  L+   A +++    +  P H
Sbjct:   34 NVDTTQNKGWTPLHFASQNGHLEVVKLLIDNRANVDTTQNEEWTPLH 80          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000048191.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:3100273:3104460:1 gene:ENSAMXG00000036724.1 transcript:ENSAMXT00000048191.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 43.5134 bits (101), Expect = 7.049e-10
Identity = 25/74 (33.78%), Postives = 39/74 (52.70%), Query Frame = 2
Query:  278 RPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVAC 499
            +P+ +A    H+  VK L+   S+          +PLH AA  G++D+VK L+ +GA +   N    TA+ VAC
Sbjct:  161 QPIHWAAYLGHLEVVKLLVSQGSD-KSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVAC 233          

HSP 2 Score: 40.4318 bits (93), Expect = 7.049e-10
Identity = 18/52 (34.62%), Postives = 31/52 (59.62%), Query Frame = 3
Query:  150 DIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHMRALI 305
             +++ D +G  ALH+AA+ G  EM+  L+ +GA + + DK +  P H  A +
Sbjct:  118 SLNIADRTGRAALHHAAQSGCQEMVKLLLNKGASLSASDKKERQPIHWAAYL 169          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ankrd27 (ankyrin repeat domain 27 (VPS9 domain) [Source:ZFIN;Acc:ZDB-GENE-121105-1])

HSP 1 Score: 49.6766 bits (117), Expect = 1.149e-9
Identity = 27/79 (34.18%), Postives = 47/79 (59.49%), Query Frame = 2
Query:  266 QNGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACE 502
            Q G  PL  AC   H   V+ L+E  ++VN  +  + N+ +H A   G+  +V++L++ GA+ H +NK+++T +D A E
Sbjct:  773 QFGNTPLIQACLKGHEQTVEVLLESGASVN-LANNQGNTAIHEAVRGGHQALVELLLQAGALTHLRNKRQRTPLDCAQE 850          

HSP 2 Score: 33.4982 bits (75), Expect = 1.149e-9
Identity = 18/49 (36.73%), Postives = 25/49 (51.02%), Query Frame = 3
Query:  153 IDVKDSS--GTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            + V  SS  G T LH AA HG+  ++  L+  GA I S +     P H+
Sbjct:  700 LGVNSSSVDGFTPLHVAALHGHTALVSLLIRHGANINSRNGQSATPLHL 748          

HSP 3 Score: 49.2914 bits (116), Expect = 9.005e-9
Identity = 28/78 (35.90%), Postives = 44/78 (56.41%), Query Frame = 2
Query:  269 NGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEE--NSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            NG  PL  AC   H + VK L+ +  +  + ++  +  ++ LHIAA +GY  I++VL+E+GA     NK  QT +  A
Sbjct:  508 NGNTPLHLACMYGHEDCVKALVYYDMHTCQLNVQNDKGDTALHIAARWGYEGIIEVLLENGASTLNHNKANQTPLHCA 585          

HSP 4 Score: 30.8018 bits (68), Expect = 9.005e-9
Identity = 15/44 (34.09%), Postives = 23/44 (52.27%), Query Frame = 3
Query:  162 KDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            +D  G T LH AA  G   ++  LV++GA + + D     P H+
Sbjct:  458 RDDRGYTPLHVAAICGQSLLIDLLVSKGAPVNATDYHSLTPLHL 501          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ankrd27 (ankyrin repeat domain 27 (VPS9 domain) [Source:ZFIN;Acc:ZDB-GENE-121105-1])

HSP 1 Score: 49.6766 bits (117), Expect = 1.874e-9
Identity = 27/79 (34.18%), Postives = 47/79 (59.49%), Query Frame = 2
Query:  266 QNGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACE 502
            Q G  PL  AC   H   V+ L+E  ++VN  +  + N+ +H A   G+  +V++L++ GA+ H +NK+++T +D A E
Sbjct:  773 QFGNTPLIQACLKGHEQTVEVLLESGASVN-LANNQGNTAIHEAVRGGHQALVELLLQAGALTHLRNKRQRTPLDCAQE 850          

HSP 2 Score: 32.7278 bits (73), Expect = 1.874e-9
Identity = 15/51 (29.41%), Postives = 25/51 (49.02%), Query Frame = 3
Query:  141 ENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            + + ++     G T LH AA HG+  ++  L+  GA I S +     P H+
Sbjct:  698 DGLGVNSSSVDGFTPLHVAALHGHTALVSLLIRHGANINSRNGQSATPLHL 748          

HSP 3 Score: 49.2914 bits (116), Expect = 1.467e-8
Identity = 28/78 (35.90%), Postives = 44/78 (56.41%), Query Frame = 2
Query:  269 NGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEE--NSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            NG  PL  AC   H + VK L+ +  +  + ++  +  ++ LHIAA +GY  I++VL+E+GA     NK  QT +  A
Sbjct:  508 NGNTPLHLACMYGHEDCVKALVYYDMHTCQLNVQNDKGDTALHIAARWGYEGIIEVLLENGASTLNHNKANQTPLHCA 585          

HSP 4 Score: 30.0314 bits (66), Expect = 1.467e-8
Identity = 15/44 (34.09%), Postives = 23/44 (52.27%), Query Frame = 3
Query:  162 KDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHM 293
            +D  G T LH AA  G   ++  LV++GA + + D     P H+
Sbjct:  458 RDDRGYTPLHVAAICGQSLLIDLLVSKGAPVNATDYHSLTPLHL 501          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: dapk1 (death-associated protein kinase 1 [Source:ZFIN;Acc:ZDB-GENE-060526-177])

HSP 1 Score: 43.1282 bits (100), Expect = 1.980e-9
Identity = 20/49 (40.82%), Postives = 31/49 (63.27%), Query Frame = 3
Query:  153 IDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHMRA 299
            +DV+D SG TALH AA++GN++++ YL +  A  +  D+    P H  A
Sbjct:  436 LDVQDKSGETALHVAARYGNVDVVQYLCSIHANPDLTDREQETPLHCAA 484          

HSP 2 Score: 39.2762 bits (90), Expect = 1.980e-9
Identity = 29/91 (31.87%), Postives = 46/91 (50.55%), Query Frame = 2
Query:  281 PLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA---CEIIIMGSLMFS*QHH 544
            PL  A  + +    + L E   +VN  +  E  SPL  A+  G+ DIV+ L+EHGA +   +K    A+ +A   C+I ++  L+    HH
Sbjct:  479 PLHCAAWHGYSPVARALCEAGCDVNARN-REGESPLLTASARGFRDIVECLLEHGADMDSTDKDGHIALHLAVRRCQIEVVKCLL---SHH 565          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ankrd52a (ankyrin repeat domain 52a [Source:NCBI gene;Acc:553206])

HSP 1 Score: 41.2022 bits (95), Expect = 2.352e-9
Identity = 21/59 (35.59%), Postives = 32/59 (54.24%), Query Frame = 2
Query:  332 IEWKSNVNKFS---LMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVAC 499
            I W + +       L+   +PLH AA  G++D+VK L+ +GA +   N    TA+ VAC
Sbjct:  180 IHWAAYLGHLEVVKLLRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVAC 238          

HSP 2 Score: 40.817 bits (94), Expect = 2.352e-9
Identity = 18/51 (35.29%), Postives = 31/51 (60.78%), Query Frame = 3
Query:  153 IDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHMRALI 305
            +++ D +G  ALH+AA+ G  EM+  L+ +GA + + DK +  P H  A +
Sbjct:  136 LNIADRTGRAALHHAAQSGCQEMVKLLLNKGASLSASDKKERQPIHWAAYL 186          

HSP 3 Score: 38.1206 bits (87), Expect = 7.235e-6
Identity = 20/55 (36.36%), Postives = 27/55 (49.09%), Query Frame = 3
Query:  135 LKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHMRA 299
            L    D++ KD  G T LHYAA +   + +V LV  GA +   D+    P H  A
Sbjct:  434 LSSGADMNKKDKFGRTPLHYAAANRRYQCVVILVGAGAEVNEPDRSGCTPLHYSA 488          

HSP 4 Score: 31.9574 bits (71), Expect = 7.235e-6
Identity = 21/78 (26.92%), Postives = 40/78 (51.28%), Query Frame = 2
Query:  272 GWRPLSYACANNHINAVKTLIEWKSNVN-KFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACE 502
            G+ P+ Y+ A+ +  +++ L+    N +         SPLH+AA  G+ + V VL+E G  V   +   ++ + VA +
Sbjct:  514 GYSPVHYSAAHGNKQSLELLLVMSFNTSGDAESCGPVSPLHLAASAGHWECVNVLLESGMQVEVCDSVGRSVLYVASQ 591          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000376.1 (pep scaffold:Pmarinus_7.0:GL476650:183420:196917:-1 gene:ENSPMAG00000000338.1 transcript:ENSPMAT00000000376.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 5.022e-12
Identity = 28/80 (35.00%), Postives = 47/80 (58.75%), Query Frame = 2
Query:  272 GWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACEIII 511
            GW PL  AC + +    K L+   ++VN   L ++++PLH AA  GY+ +V++LM + A  + +N K +  +DVAC   +
Sbjct:  213 GWTPLHEACNHGYYAVAKQLLLAGADVNTRGL-DDDTPLHDAASNGYLGVVRLLMRYNADPYQKNAKGECPVDVACSTTV 291          

HSP 2 Score: 31.187 bits (69), Expect = 5.022e-12
Identity = 14/46 (30.43%), Postives = 24/46 (52.17%), Query Frame = 3
Query:  153 IDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFH 290
            ++ ++  G T+LH AA  G +  +  L++RGA +   D     P H
Sbjct:  173 VNKRNERGETSLHMAAIRGEVRQLRELISRGADVNVKDFAGWTPLH 218          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.2098 bits (108), Expect = 7.970e-11
Identity = 23/50 (46.00%), Postives = 33/50 (66.00%), Query Frame = 3
Query:  156 DVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHMRALI 305
            +V D +G TALH+AA +G+ EM+ +LVA+GA I + DK D    H  A +
Sbjct:  132 NVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYM 181          

HSP 2 Score: 38.5058 bits (88), Expect = 7.970e-11
Identity = 24/74 (32.43%), Postives = 38/74 (51.35%), Query Frame = 2
Query:  278 RPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVAC 499
            R + +A    H   VK L+   ++V +    +  SPLH A+  G I +VK+L++ G  +   N    TA+ VAC
Sbjct:  173 RAIHWAAYMGHTEVVKVLVAHGADV-RCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVAC 245          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007954.1 (pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gene:ENSPMAG00000007165.1 transcript:ENSPMAT00000007954.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 42.743 bits (99), Expect = 1.277e-8
Identity = 19/47 (40.43%), Postives = 34/47 (72.34%), Query Frame = 3
Query:  150 DIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFH 290
            +++V D +G TALH+AA +GN+EM+  L+++GA + ++DK +    H
Sbjct:   39 NVNVSDRAGRTALHHAAFNGNLEMVNLLISKGANVNAMDKRERRAVH 85          

HSP 2 Score: 34.6538 bits (78), Expect = 1.277e-8
Identity = 23/74 (31.08%), Postives = 40/74 (54.05%), Query Frame = 2
Query:  278 RPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVAC 499
            R + +A    H   VK L+   ++VN +   +  +PLH AA  G++ +V++L+   A ++  N    TA+ VAC
Sbjct:   82 RAVHWAGYMGHTEVVKMLLSNGADVN-WKDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFNGFGNTALHVAC 154          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: invs (inversin [Source:NCBI gene;Acc:245946])

HSP 1 Score: 38.891 bits (89), Expect = 1.371e-8
Identity = 18/52 (34.62%), Postives = 31/52 (59.62%), Query Frame = 3
Query:  132 KLKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPF 287
            +L  N+D+++ D  G TALH AA  G++  +  L+A GA +++ + M   P 
Sbjct:  340 RLIPNLDVNLADKYGGTALHAAALSGHVSTVRLLLAHGAQVDAANVMKHTPL 391          

HSP 2 Score: 38.1206 bits (87), Expect = 1.371e-8
Identity = 26/87 (29.89%), Postives = 43/87 (49.43%), Query Frame = 2
Query:  281 PLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA-------CEIIIMGS 520
            PL  AC   H   ++TLIE  + V+     + +SPLH AA  G  DI  +L+ +G     ++  ++T +  A       C +++M S
Sbjct:  390 PLFRACEMGHKEVIETLIEGGARVDLVD-QDGHSPLHWAALGGNADICLILIRNGIHPDVRDHVRRTPLQCAAYGGYINCMVVLMDS 475          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010338.1 (pep scaffold:Pmarinus_7.0:GL476759:135524:215537:1 gene:ENSPMAG00000009360.1 transcript:ENSPMAT00000010338.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 39.2762 bits (90), Expect = 1.477e-8
Identity = 19/45 (42.22%), Postives = 28/45 (62.22%), Query Frame = 3
Query:  135 LKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDK 269
            LK   ++DV D  G TAL  A+  G+I  + YL+++GA I  +DK
Sbjct: 1039 LKRGAEVDVMDRQGRTALMVASCEGHIGTVEYLLSKGASIGCVDK 1083          

HSP 2 Score: 37.7354 bits (86), Expect = 1.477e-8
Identity = 21/77 (27.27%), Postives = 41/77 (53.25%), Query Frame = 2
Query:  266 QNGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            + G   LS+AC   H   V++L+   + ++  +     +PL +AA +G   +V+ L+EHGA++ + +      +D A
Sbjct: 1083 KEGLSALSWACLKGHQPVVQSLVGRGAAIDH-TDKNGRTPLDLAAFYGDAGVVQYLVEHGAMIEHVDYSGMRPLDRA 1158          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO34688 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNN7])

HSP 1 Score: 53.9138 bits (128), Expect = 4.407e-9
Identity = 28/75 (37.33%), Postives = 48/75 (64.00%), Query Frame = 2
Query:  272 GWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            G  P+  A AN H+ A+K L+E   ++N+  +   +SPLH+++  G++  VK L+E+GA    ++KK  TA++VA
Sbjct:    6 GSSPVHKAAANGHLEALKLLLEHGGDINQCDITG-SSPLHVSSRNGHLTCVKYLIENGADHKLKSKKGNTALNVA 79          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO28023 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7M5])

HSP 1 Score: 53.1434 bits (126), Expect = 8.180e-9
Identity = 31/80 (38.75%), Postives = 45/80 (56.25%), Query Frame = 2
Query:  275 WRPLSYACANNHINAVKTLIEWKSNVNKFSLMEE----NSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACE 502
            W PL +A    H+  V+TL+   +    +SL  E    N+PL  AAG G   +V+VL++H A V  +N K  TA+D+A E
Sbjct:   10 WTPLHHAAGAGHVRTVETLMRATNIGFSYSLEAEDWRGNTPLMTAAGRGRDRVVQVLIQHKADVTARNAKGMTALDIAIE 89          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO41101 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5D3])

HSP 1 Score: 53.1434 bits (126), Expect = 1.014e-8
Identity = 31/80 (38.75%), Postives = 45/80 (56.25%), Query Frame = 2
Query:  275 WRPLSYACANNHINAVKTLIEWKSNVNKFSLMEE----NSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACE 502
            W PL +A    H+  V+TL+   +    +SL  E    N+PL  AAG G   +V+VL++H A V  +N K  TA+D+A E
Sbjct:   10 WTPLHHAAGAGHVRTVETLMRATNIGFSYSLEAEDWRGNTPLMTAAGRGRDRVVQVLIQHKADVTARNAKGMTALDIAIE 89          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO41104 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5D3])

HSP 1 Score: 53.1434 bits (126), Expect = 1.014e-8
Identity = 31/80 (38.75%), Postives = 45/80 (56.25%), Query Frame = 2
Query:  275 WRPLSYACANNHINAVKTLIEWKSNVNKFSLMEE----NSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACE 502
            W PL +A    H+  V+TL+   +    +SL  E    N+PL  AAG G   +V+VL++H A V  +N K  TA+D+A E
Sbjct:   10 WTPLHHAAGAGHVRTVETLMRATNIGFSYSLEAEDWRGNTPLMTAAGRGRDRVVQVLIQHKADVTARNAKGMTALDIAIE 89          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 39.2762 bits (90), Expect = 5.778e-7
Identity = 19/76 (25.00%), Postives = 39/76 (51.32%), Query Frame = 2
Query:  275 WRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACE 502
            W PL  A A   +     L++  + V+      + +PLH+A+  G++++VK+L+   A +   +   +  +D+A E
Sbjct:  351 WTPLDCAAARGMVEVANILLDEDAPVDPTD-KAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIE 425          

HSP 2 Score: 32.7278 bits (73), Expect = 5.778e-7
Identity = 19/51 (37.25%), Postives = 25/51 (49.02%), Query Frame = 3
Query:  153 IDVKDSSGTTALHYAAKHGNIEMMVYLVAR-GACIESIDKMDGDPFHMRAL 302
            ID K+    T +HYAAK G +  +  L+ R  A I   D     P H+ AL
Sbjct:  276 IDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAAL 326          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: tonsl (tonsoku like, DNA repair protein [Source:NCBI gene;Acc:101173594])

HSP 1 Score: 57.3806 bits (137), Expect = 7.684e-11
Identity = 30/75 (40.00%), Postives = 42/75 (56.00%), Query Frame = 2
Query:  272 GWRPLSYACANNHINAVKTLIEWKSNVNKFS--LMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMD 490
            GW PL  AC + H + V  L+E  +N+N     L E  +PLH A   G   + ++L+E GA V  QN K +TA+D
Sbjct:  479 GWTPLHEACNHGHYDVVAVLLERGANINDAGGPLCEGVTPLHDALTCGNFRVARLLVERGAAVTLQNSKGETALD 553          

HSP 2 Score: 29.6462 bits (65), Expect = 7.684e-11
Identity = 13/43 (30.23%), Postives = 22/43 (51.16%), Query Frame = 3
Query:  162 KDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFH 290
            ++  G T+LH A   GN++ + YL+ +G  +   D     P H
Sbjct:  442 RNEKGETSLHRACIDGNLKQVQYLIEQGHPVNPRDYCGWTPLH 484          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: tonsl (tonsoku like, DNA repair protein [Source:NCBI gene;Acc:101173594])

HSP 1 Score: 57.3806 bits (137), Expect = 7.739e-11
Identity = 30/75 (40.00%), Postives = 42/75 (56.00%), Query Frame = 2
Query:  272 GWRPLSYACANNHINAVKTLIEWKSNVNKFS--LMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMD 490
            GW PL  AC + H + V  L+E  +N+N     L E  +PLH A   G   + ++L+E GA V  QN K +TA+D
Sbjct:  558 GWTPLHEACNHGHYDVVAVLLERGANINDAGGPLCEGVTPLHDALTCGNFRVARLLVERGAAVTLQNSKGETALD 632          

HSP 2 Score: 29.6462 bits (65), Expect = 7.739e-11
Identity = 13/43 (30.23%), Postives = 22/43 (51.16%), Query Frame = 3
Query:  162 KDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFH 290
            ++  G T+LH A   GN++ + YL+ +G  +   D     P H
Sbjct:  521 RNEKGETSLHRACIDGNLKQVQYLIEQGHPVNPRDYCGWTPLH 563          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ankrd52a (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C [Source:NCBI gene;Acc:101155432])

HSP 1 Score: 44.2838 bits (103), Expect = 5.304e-10
Identity = 20/52 (38.46%), Postives = 34/52 (65.38%), Query Frame = 3
Query:  150 DIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHMRALI 305
            ++++ D +G TALH+AA+ G  EM+  L+ +GA + +IDK +  P H  A +
Sbjct:  132 NLNIADRTGRTALHHAAQSGFQEMVKLLLNKGANLSAIDKKERQPIHCAAYL 183          

HSP 2 Score: 40.0466 bits (92), Expect = 5.304e-10
Identity = 26/74 (35.14%), Postives = 38/74 (51.35%), Query Frame = 2
Query:  278 RPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVAC 499
            +P+  A    H+  VK L+  +SN          +PLH AA  G+I+IVK L+  GA +   N    TA+ +AC
Sbjct:  175 QPIHCAAYLGHLEVVKLLLS-RSNDKSCKDKLGYTPLHAAAASGHIEIVKYLLRMGAEIDEPNTFGNTALHMAC 247          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000022337.3 (ankyrin repeat and SOCS box protein 9 [Source:NCBI gene;Acc:101170477])

HSP 1 Score: 56.225 bits (134), Expect = 3.645e-9
Identity = 28/82 (34.15%), Postives = 50/82 (60.98%), Query Frame = 2
Query:  281 PLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACEIIIMGSLM 526
            PL  AC+N H+++V+ L++  +NVN+  L  ++SPLH+AA     ++V VL++HGA     N + +  +D+  +    G L+
Sbjct:  161 PLHAACSNLHLSSVEKLLQLGANVNQSRL--DDSPLHVAARLSSPELVFVLLDHGADPRLTNSEGKRPVDLVPQNSPAGRLL 240          

HSP 2 Score: 25.409 bits (54), Expect = 3.645e-9
Identity = 15/55 (27.27%), Postives = 24/55 (43.64%), Query Frame = 3
Query:  135 LKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHMRA 299
            L+   D++     G TAL  A   G++  +  L+ RGA      +    P H+ A
Sbjct:   80 LENGADVNRSTVDGRTALTEACARGHVTCVSLLLQRGAAPLGTSQ-PSSPIHLAA 133          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:101166639])

HSP 1 Score: 47.3654 bits (111), Expect = 6.846e-9
Identity = 22/74 (29.73%), Postives = 44/74 (59.46%), Query Frame = 2
Query:  275 WRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVA 496
            W PL  A A  +   ++ L++  ++ N     + N+PLH+A     ++  K+L+EHGA ++ +NK+++T + +A
Sbjct:  140 WTPLHRASAKGNYRLIQLLLKQSASTN-IQDCQGNTPLHLACEEERVEAAKLLVEHGASIYIENKEEKTPLQIA 212          

HSP 2 Score: 33.4982 bits (75), Expect = 6.846e-9
Identity = 15/42 (35.71%), Postives = 23/42 (54.76%), Query Frame = 3
Query:  165 DSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFH 290
            + +G T LHYAA     E+ + L+  GA   + DK++  P H
Sbjct:  103 NQNGCTPLHYAASKDRYEIALMLLENGADPNATDKLEWTPLH 144          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000070878.1 (SMESG000070878.1)

HSP 1 Score: 937.562 bits (2422), Expect = 0.000e+0
Identity = 610/626 (97.44%), Postives = 615/626 (98.24%), Query Frame = 1
Query:  463 KQKETNCNGRGVRDNHYGVVNVLLTASSKLIEDTAEKNMASKNXXXXXXXXXXXXXXXXXXXXVNIAHNIHPRIKSDFQRNGNFEYKRRTIGSQCQLNVSPDKPKPQKSESLNTVFLNDKLYEEYNRNRGEHGGQETPIIKSNLSEIEVNLPYPSKFSSSGKMKIKSPLLASKNWKLDKKNQLINPNIKNSFNSDQCSAQFVYPAGQQTSPSIITLPPEMFFSISHPLSSCKLQKNNSVEQTSTYSINNLYAVSRNDPHXXXXXXXXXXXXXXXXXHFRKFQSVRRGFGXXXXXXXXXXXXXXXXXXXXXXXAFQDSVLTQNEENPPLGPTDEYTCCKWIKNLGLERIWDTLFKEGFDSFXXXXXXXXXXXXXXCDNNIEDLDCLKTNLDSLNIPLLKKLNFSNKISDFLFQLGLECYINNFNKNGYIYVHQTIGFEETDLNKLQIYKIGHRXXXXXXXXXXXXXXXXXXXECNTSQTSNGLIPKNASPRMNIYDELKYFVDIQNSPIFXXXXXXXXXXXXXXXXXXGFESSRKDAIETNHXXXXXXXXXXXXXXFRTSSFMNIINTDNITLQDIISPSDSEKKKILNKPIPVDQHSTDPSCLDDLVNLLQNLGKELENELNSVSV 2340
            K+K+T  +     +NHYGVVNVLLTASSKLIEDT+EKNMAS NFSQSIPSSLSRSSLFIKSPSVNIAHNIHPRIKSDFQRNGNFEYKRRTIGSQCQLNVSPDKPKPQKSESLNTVFLNDKLYEEYNRNRGEHGGQETPIIKSNLSEIEVNLPYPSKFSSSGKMKIKSPLLASKNWKLDKKNQLINPNIKNSFNSDQCSAQFVYPAGQQTSPSIITLPPEMFFSISHPLSSCKLQKNNS EQTSTYSINNLYAVSRNDPHNSPSSKSSTDADSASNSHFRKFQSVRRGFGSESDIVDSSDKIKRSKSTSKSKKAFQDSVLTQNEENPPLGPTDEYTCCKWIKNLGLERIWDTLFKEGFDSFLALSLASNEELLLLCDNNIEDLDCLKTNLDSLNIP LKKLNFSNKISDFLFQLGLECYINNFNKNGYIYVHQTIGFEETDLNKLQIYKIGHRKLILKSLSILNNNKININNECNTSQTSNGLIPKNASPRMNIYDELKYFVDIQNSPIFKNEDENENLIEDLEIKENGFESSRKDA ETNHSSIILSKKPPPPIPFRTSSFMNIINTDNITLQDIISPSDSEKKKILNKPIPVDQHSTDPSCLDDLVNLLQNLGKELENELNSVSV
Sbjct:  147 KKKQTAMD-VACENNHYGVVNVLLTASSKLIEDTSEKNMASNNFSQSIPSSLSRSSLFIKSPSVNIAHNIHPRIKSDFQRNGNFEYKRRTIGSQCQLNVSPDKPKPQKSESLNTVFLNDKLYEEYNRNRGEHGGQETPIIKSNLSEIEVNLPYPSKFSSSGKMKIKSPLLASKNWKLDKKNQLINPNIKNSFNSDQCSAQFVYPAGQQTSPSIITLPPEMFFSISHPLSSCKLQKNNSGEQTSTYSINNLYAVSRNDPHNSPSSKSSTDADSASNSHFRKFQSVRRGFGSESDIVDSSDKIKRSKSTSKSKKAFQDSVLTQNEENPPLGPTDEYTCCKWIKNLGLERIWDTLFKEGFDSFLALSLASNEELLLLCDNNIEDLDCLKTNLDSLNIPFLKKLNFSNKISDFLFQLGLECYINNFNKNGYIYVHQTIGFEETDLNKLQIYKIGHRKLILKSLSILNNNKININNECNTSQTSNGLIPKNASPRMNIYDELKYFVDIQNSPIFKNEDENENLIEDLEIKENGFESSRKDANETNHSSIILSKKPPPPIPFRTSSFMNIINTDNITLQDIISPSDSEKKKILNKPIPVDQHSTDPSCLDDLVNLLQNLGKELENELNSVSV 771          

HSP 2 Score: 170.629 bits (431), Expect = 1.971e-85
Identity = 78/79 (98.73%), Postives = 79/79 (100.00%), Query Frame = 2
Query:  266 QNGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACE 502
            +NGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACE
Sbjct:   80 KNGWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVACE 158          

HSP 3 Score: 166.392 bits (420), Expect = 1.971e-85
Identity = 81/86 (94.19%), Postives = 81/86 (94.19%), Query Frame = 3
Query:   30 MHRKESKLLTAAKNNKYDDLRKIFDKIDKAKNKRKLKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPF 287
            MHRKESKLLTAAKNNKYDDLRKIFDKIDKAKNKRKLKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDK    P 
Sbjct:    1 MHRKESKLLTAAKNNKYDDLRKIFDKIDKAKNKRKLKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKNGWRPL 86          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000065361.1 (SMESG000065361.1)

HSP 1 Score: 65.855 bits (159), Expect = 3.387e-18
Identity = 30/76 (39.47%), Postives = 49/76 (64.47%), Query Frame = 2
Query:  272 GWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVAC 499
            G RP+SYACA  H+  V+ L+ + S  N+ + +E  +PLH+AA +GY +IV +L+   A     N++ +T +D+AC
Sbjct:   83 GLRPISYACALGHLKVVEYLLRYGSCPNRINTIEYLTPLHLAAMYGYAEIVHLLLHCKADPFALNRESKTPLDLAC 158          

HSP 2 Score: 45.8246 bits (107), Expect = 3.387e-18
Identity = 24/78 (30.77%), Postives = 46/78 (58.97%), Query Frame = 3
Query:   39 KESKLLTAAKNNKYDDLRKIFDKIDK--AKNKRKLKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESID 266
            KE+KL TA K+N   ++ K+ +K  K  ++      + +D+D +D+ G T  H+AA++G +E++  +++ G   E  D
Sbjct:    3 KENKLHTAVKSNNLPNVLKVLEKYAKQSSRTSSTKPKKLDLDSRDNLGLTVTHHAARNGYLEILEAILSYGCKYEVFD 80          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000065361.1 (SMESG000065361.1)

HSP 1 Score: 65.855 bits (159), Expect = 3.441e-18
Identity = 30/76 (39.47%), Postives = 49/76 (64.47%), Query Frame = 2
Query:  272 GWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIVHYQNKKKQTAMDVAC 499
            G RP+SYACA  H+  V+ L+ + S  N+ + +E  +PLH+AA +GY +IV +L+   A     N++ +T +D+AC
Sbjct:   83 GLRPISYACALGHLKVVEYLLRYGSCPNRINTIEYLTPLHLAAMYGYAEIVHLLLHCKADPFALNRESKTPLDLAC 158          

HSP 2 Score: 45.8246 bits (107), Expect = 3.441e-18
Identity = 24/78 (30.77%), Postives = 46/78 (58.97%), Query Frame = 3
Query:   39 KESKLLTAAKNNKYDDLRKIFDKIDK--AKNKRKLKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESID 266
            KE+KL TA K+N   ++ K+ +K  K  ++      + +D+D +D+ G T  H+AA++G +E++  +++ G   E  D
Sbjct:    3 KENKLHTAVKSNNLPNVLKVLEKYAKQSSRTSSTKPKKLDLDSRDNLGLTVTHHAARNGYLEILEAILSYGCKYEVFD 80          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000065361.1 (SMESG000065361.1)

HSP 1 Score: 52.373 bits (124), Expect = 3.277e-14
Identity = 23/61 (37.70%), Postives = 39/61 (63.93%), Query Frame = 2
Query:  272 GWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIV 454
            G RP+SYACA  H+  V+ L+ + S  N+ + +E  +PLH+AA +GY +I ++  +   +V
Sbjct:   83 GLRPISYACALGHLKVVEYLLRYGSCPNRINTIEYLTPLHLAAMYGYAEIKQIHCQPDELV 143          

HSP 2 Score: 45.8246 bits (107), Expect = 3.277e-14
Identity = 24/78 (30.77%), Postives = 46/78 (58.97%), Query Frame = 3
Query:   39 KESKLLTAAKNNKYDDLRKIFDKIDK--AKNKRKLKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESID 266
            KE+KL TA K+N   ++ K+ +K  K  ++      + +D+D +D+ G T  H+AA++G +E++  +++ G   E  D
Sbjct:    3 KENKLHTAVKSNNLPNVLKVLEKYAKQSSRTSSTKPKKLDLDSRDNLGLTVTHHAARNGYLEILEAILSYGCKYEVFD 80          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000065361.1 (SMESG000065361.1)

HSP 1 Score: 52.373 bits (124), Expect = 3.388e-14
Identity = 23/61 (37.70%), Postives = 39/61 (63.93%), Query Frame = 2
Query:  272 GWRPLSYACANNHINAVKTLIEWKSNVNKFSLMEENSPLHIAAGFGYIDIVKVLMEHGAIV 454
            G RP+SYACA  H+  V+ L+ + S  N+ + +E  +PLH+AA +GY +I ++  +   +V
Sbjct:   83 GLRPISYACALGHLKVVEYLLRYGSCPNRINTIEYLTPLHLAAMYGYAEIKQIHCQPDELV 143          

HSP 2 Score: 45.8246 bits (107), Expect = 3.388e-14
Identity = 24/78 (30.77%), Postives = 46/78 (58.97%), Query Frame = 3
Query:   39 KESKLLTAAKNNKYDDLRKIFDKIDK--AKNKRKLKENIDIDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESID 266
            KE+KL TA K+N   ++ K+ +K  K  ++      + +D+D +D+ G T  H+AA++G +E++  +++ G   E  D
Sbjct:    3 KENKLHTAVKSNNLPNVLKVLEKYAKQSSRTSSTKPKKLDLDSRDNLGLTVTHHAARNGYLEILEAILSYGCKYEVFD 80          
The following BLAST results are available for this feature:
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANKRD277.879e-1134.62ankyrin repeat domain 27 [Source:HGNC Symbol;Acc:H... [more]
ANKEF12.143e-1033.78ankyrin repeat and EF-hand domain containing 1 [So... [more]
ANKEF12.143e-1033.78ankyrin repeat and EF-hand domain containing 1 [So... [more]
CASKIN11.025e-933.77CASK interacting protein 1 [Source:HGNC Symbol;Acc... [more]
EHMT19.860e-932.00euchromatic histone lysine methyltransferase 1 [So... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-442.708e-634.67AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.708e-634.67AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.794e-634.67AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.794e-634.67AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.889e-634.67AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tnks1.786e-935.44gene:FBgn0027508 transcript:FBtr0084890[more]
Tnks2.241e-935.44gene:FBgn0027508 transcript:FBtr0330383[more]
Ank26.331e-933.77gene:FBgn0261788 transcript:FBtr0334062[more]
Ank21.322e-833.77gene:FBgn0261788 transcript:FBtr0303120[more]
Ank21.891e-733.77gene:FBgn0261788 transcript:FBtr0303121[more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmd101.100e-933.33proteasome 26S subunit, non-ATPase 10 [Source:ZFIN... [more]
psmd101.100e-933.33proteasome 26S subunit, non-ATPase 10 [Source:ZFIN... [more]
tanc1b1.175e-936.36tetratricopeptide repeat, ankyrin repeat and coile... [more]
tanc1b1.294e-936.36tetratricopeptide repeat, ankyrin repeat and coile... [more]
dapk11.701e-938.78death-associated protein kinase 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANKRD273.362e-1443.59ankyrin repeat domain 27 [Source:NCBI gene;Acc:100... [more]
ANKRD274.223e-1443.59ankyrin repeat domain 27 [Source:NCBI gene;Acc:100... [more]
ANKRD275.549e-1443.59ankyrin repeat domain 27 [Source:NCBI gene;Acc:100... [more]
ANKRD275.594e-1443.59ankyrin repeat domain 27 [Source:NCBI gene;Acc:100... [more]
ANKRD275.921e-1443.59ankyrin repeat domain 27 [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ankef11.629e-1031.08ankyrin repeat and EF-hand domain containing 1 [So... [more]
Ankef11.629e-1031.08ankyrin repeat and EF-hand domain containing 1 [So... [more]
Ankef11.629e-1031.08ankyrin repeat and EF-hand domain containing 1 [So... [more]
Ankrd275.284e-1033.33ankyrin repeat domain 27 (VPS9 domain) [Source:MGI... [more]
Ankrd276.125e-1033.33ankyrin repeat domain 27 (VPS9 domain) [Source:MGI... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96NW4|ANR27_HUMAN3.473e-1034.62Ankyrin repeat domain-containing protein 27 OS=Hom... [more]
sp|Q5REW9|ANR27_PONAB4.541e-1035.90Ankyrin repeat domain-containing protein 27 OS=Pon... [more]
sp|Q9NU02|ANKE1_HUMAN9.446e-1033.78Ankyrin repeat and EF-hand domain-containing prote... [more]
sp|Q9D2J7|ANKE1_MOUSE9.919e-1031.08Ankyrin repeat and EF-hand domain-containing prote... [more]
sp|Q3UMR0|ANR27_MOUSE3.216e-933.33Ankyrin repeat domain-containing protein 27 OS=Mus... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P8V9R61.350e-1236.67CASK interacting protein 2 OS=Cynoglossus semilaev... [more]
A0A3P8V9U01.631e-1236.67CASK interacting protein 2 OS=Cynoglossus semilaev... [more]
A0A429GPX42.526e-1236.36ANK_REP_REGION domain-containing protein OS=Candid... [more]
A0A3P8VI362.847e-1236.67CASK interacting protein 2 OS=Cynoglossus semilaev... [more]
J9HSB74.623e-1237.66AAEL017480-PA (Fragment) OS=Aedes aegypti OX=7159 ... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000048191.17.049e-1033.78pep primary_assembly:Astyanax_mexicanus-2.0:15:310... [more]
ankrd271.149e-934.18ankyrin repeat domain 27 (VPS9 domain) [Source:ZFI... [more]
ankrd271.874e-934.18ankyrin repeat domain 27 (VPS9 domain) [Source:ZFI... [more]
dapk11.980e-940.82death-associated protein kinase 1 [Source:ZFIN;Acc... [more]
ankrd52a2.352e-935.59ankyrin repeat domain 52a [Source:NCBI gene;Acc:55... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000376.15.022e-1235.00pep scaffold:Pmarinus_7.0:GL476650:183420:196917:-... [more]
ENSPMAT00000003991.17.970e-1146.00pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
ENSPMAT00000007954.11.277e-840.43pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gen... [more]
invs1.371e-834.62inversin [Source:NCBI gene;Acc:245946][more]
ENSPMAT00000010338.11.477e-842.22pep scaffold:Pmarinus_7.0:GL476759:135524:215537:1... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO346884.407e-937.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO280238.180e-938.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411011.014e-838.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411041.014e-838.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387025.778e-725.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tonsl7.684e-1140.00tonsoku like, DNA repair protein [Source:NCBI gene... [more]
tonsl7.739e-1140.00tonsoku like, DNA repair protein [Source:NCBI gene... [more]
ankrd52a5.304e-1038.46serine/threonine-protein phosphatase 6 regulatory ... [more]
ENSORLT00000022337.33.645e-934.15ankyrin repeat and SOCS box protein 9 [Source:NCBI... [more]
psmd106.846e-929.73proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070878.11.971e-8597.44SMESG000070878.1[more]
SMESG000065361.13.387e-1839.47SMESG000065361.1[more]
SMESG000065361.13.441e-1839.47SMESG000065361.1[more]
SMESG000065361.13.277e-1437.70SMESG000065361.1[more]
SMESG000065361.13.388e-1437.70SMESG000065361.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001527 ID=SMED30001527|Name=ANK_REP_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2345bp
CATTTGTAAATACTAATGGATATTTAGAAATGCATAGAAAGGAATCAAAA
CTTCTAACAGCAGCTAAAAATAATAAATATGACGATTTGCGAAAGATTTT
TGATAAAATCGATAAAGCAAAAAATAAAAGAAAATTGAAAGAAAATATTG
ATATTGATGTCAAAGATTCTTCAGGGACGACTGCTTTACACTATGCCGCA
AAACATGGGAATATAGAAATGATGGTATATTTAGTGGCAAGAGGAGCCTG
CATTGAATCAATTGACAAAATGGATGGAGACCCCTTTCATATGCGTGCGC
TAATAATCATATCAATGCAGTTAAGACTCTGATTGAGTGGAAGAGTAACG
TCAACAAATTTTCATTAATGGAAGAAAATTCACCCCTTCACATAGCTGCT
GGATTTGGATACATTGATATAGTAAAAGTCCTAATGGAACACGGCGCAAT
CGTACACTATCAAAACAAAAAGAAACAAACTGCAATGGACGTGGCGTGCG
AGATAATCATTATGGGGTCGTTAATGTTCTCTTGACAGCATCATCAAAGC
TGATTGAAGACACTGCGGAGAAAAATATGGCATCTAAAAATTTTTCACAA
TCCATCCCATCTTCATTGTCAAGATCTTCATTGTTTATTAAATCTCCATC
TGTCAATATTGCCCATAATATCCATCCACGGATTAAATCAGATTTCCAAA
GAAATGGAAATTTCGAATACAAACGCCGAACAATCGGCTCCCAGTGTCAA
TTAAACGTGTCTCCAGATAAACCGAAACCTCAAAAATCCGAAAGCTTAAA
TACTGTGTTTTTAAACGATAAATTATACGAAGAGTACAATAGAAATCGAG
GTGAACATGGAGGACAAGAGACCCCTATAATCAAATCAAATCTTTCAGAG
ATTGAAGTCAATTTACCCTATCCTTCCAAGTTTTCCTCGTCGGGAAAAAT
GAAAATCAAATCCCCGCTTCTTGCCTCCAAGAACTGGAAATTAGATAAAA
AAAATCAACTTATTAATCCAAATATTAAAAATTCGTTTAATTCTGATCAA
TGTTCAGCTCAGTTTGTTTACCCAGCTGGGCAGCAGACTTCTCCAAGTAT
CATCACACTTCCTCCTGAAATGTTCTTTTCAATCTCCCATCCTCTTAGTT
CTTGTAAACTCCAAAAGAATAATTCAGTTGAACAAACTTCTACGTATAGC
ATCAACAATCTATATGCAGTTTCACGTAATGATCCCCATAATTCACCGTC
TTCAAAATCCTCAACAGACGCAGATTCAGCTTCGAATTCGCATTTCAGAA
AATTTCAGTCAGTCCGAAGAGGATTTGGCTCAGAAAGTGACATTGTTGAC
TCGTCAGATAAAATAAAACGCAGCAAAAGTACATCGAAATCAAAGAAAGC
CTTTCAAGACTCTGTTTTAACACAAAATGAGGAGAATCCCCCACTCGGTC
CAACCGACGAATATACTTGTTGCAAATGGATCAAAAATTTGGGCCTCGAA
AGAATATGGGATACGTTATTCAAAGAAGGTTTTGATAGTTTCTTAGCACT
GTCACTGGCTTCAAATGAGGAGCTACTTTTGCTATGCGACAATAACATTG
AAGATTTGGATTGCTTGAAAACGAATCTGGATTCATTAAATATACCTTTG
TTAAAAAAATTGAATTTTTCGAACAAAATATCAGATTTTCTCTTTCAACT
TGGTCTTGAGTGTTACATTAATAACTTCAATAAAAATGGTTACATTTATG
TCCATCAAACCATCGGGTTTGAGGAGACTGATCTCAATAAATTGCAAATA
TACAAAATAGGCCATCGGAAACTCATATTGAAAAGCTTGTCTATTCTTAA
CAATAATAAAATCAACATTAATAATGAATGCAATACTAGTCAAACATCAA
ATGGTTTAATTCCAAAAAATGCTTCACCAAGGATGAATATTTATGATGAA
CTGAAATACTTTGTGGACATTCAAAATTCACCCATATTTAAAAATGAGGA
TGAAAACGAAAACTTGATTGAAGATTTAGAAATTAAAGAAAACGGTTTTG
AATCATCAAGAAAAGATGCTATTGAAACAAATCACAGTTCAATTATTTTG
TCCAAAAAACCTCCTCCGCCTATTCCTTTTAGGACAAGCTCTTTCATGAA
TATTATAAATACTGACAATATAACTCTTCAGGATATTATAAGTCCGTCAG
ATTCAGAAAAAAAGAAAATTCTAAACAAACCTATTCCTGTTGATCAACAC
TCAACAGATCCTTCATGTCTTGATGACCTCGTCAATCTTCTGCAAAATTT
AGGAAAGGAATTGGAAAACGAGCTAAATTCTGTTTCTGTTTAAAA
back to top

protein sequence of SMED30001527-orf-1

>SMED30001527-orf-1 ID=SMED30001527-orf-1|Name=SMED30001527-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=110bp
FVNTNGYLEMHRKESKLLTAAKNNKYDDLRKIFDKIDKAKNKRKLKENID
IDVKDSSGTTALHYAAKHGNIEMMVYLVARGACIESIDKMDGDPFHMRAL
IIISMQLRL*
back to top

protein sequence of SMED30001527-orf-2

>SMED30001527-orf-2 ID=SMED30001527-orf-2|Name=SMED30001527-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=589bp
MASKNFSQSIPSSLSRSSLFIKSPSVNIAHNIHPRIKSDFQRNGNFEYKR
RTIGSQCQLNVSPDKPKPQKSESLNTVFLNDKLYEEYNRNRGEHGGQETP
IIKSNLSEIEVNLPYPSKFSSSGKMKIKSPLLASKNWKLDKKNQLINPNI
KNSFNSDQCSAQFVYPAGQQTSPSIITLPPEMFFSISHPLSSCKLQKNNS
VEQTSTYSINNLYAVSRNDPHNSPSSKSSTDADSASNSHFRKFQSVRRGF
GSESDIVDSSDKIKRSKSTSKSKKAFQDSVLTQNEENPPLGPTDEYTCCK
WIKNLGLERIWDTLFKEGFDSFLALSLASNEELLLLCDNNIEDLDCLKTN
LDSLNIPLLKKLNFSNKISDFLFQLGLECYINNFNKNGYIYVHQTIGFEE
TDLNKLQIYKIGHRKLILKSLSILNNNKININNECNTSQTSNGLIPKNAS
PRMNIYDELKYFVDIQNSPIFKNEDENENLIEDLEIKENGFESSRKDAIE
TNHSSIILSKKPPPPIPFRTSSFMNIINTDNITLQDIISPSDSEKKKILN
KPIPVDQHSTDPSCLDDLVNLLQNLGKELENELNSVSV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005829cytosol
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002063non-ciliated epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR001660SAM
IPR013761SAM/pointed_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 57..86
e-value: 1.1E-4
score: 31.6
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 57..89
score: 12.957
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 5..110
e-value: 4.0E-22
score: 80.5
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 17..110
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 42..110
e-value: 2.7E-13
score: 50.3
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 45..110
score: 21.163
NoneNo IPR availablePANTHERPTHR24134FAMILY NOT NAMEDcoord: 10..110