Major facilitator superfamily domain containing protein

Overview
NameMajor facilitator superfamily domain containing protein
Smed IDSMED30001523
Length (bp)2013
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Major facilitator superfamily domain containing protein (SMED30001523) t-SNE clustered cells

Violin plots show distribution of expression levels for Major facilitator superfamily domain containing protein (SMED30001523) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Major facilitator superfamily domain containing protein (SMED30001523) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Major facilitator superfamily domain containing protein (SMED30001523) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001523

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30001523h1SMcG0001228 dd_Smed_v4_11210_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30001523h1SMcG0001228 dd_Smed_v6_11210_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30001523h1SMcG0001228 dd_Smed_v4_11210_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Human
Match: MFSD2A (major facilitator superfamily domain containing 2A [Source:HGNC Symbol;Acc:HGNC:25897])

HSP 1 Score: 278.87 bits (712), Expect = 4.212e-85
Identity = 165/504 (32.74%), Postives = 272/504 (53.97%), Query Frame = 1
Query:  133 SIFRKNDKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKF--IFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATR-----------NRIANQPVT-ANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKE----LEILKDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENG--CRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIENYS 1581
            SI +  ++     K     K+++ VC KL Y +GG P Q+   A+GFFL I+LL+ A + P+  S I  + RAWDAITDP++G  I+K+  T  G+  PWI  +TPL+ +A+FL ++VP+  +  + +  +FYC      +T +T FHVPYS++ M +++   +RD  T+ RM  E++G + G  + G +  +           + +A+Q     + T S R T+K  Y++A+  +  I+I C++ ++LG +E     E  + +   Y   L+ +M   PY+ ++  F+F+SL   LV+ N  L+ T+TL         +L ++  +   +P+  + L R+GKK   + G  + +P L  +A +  N  L + Y   V    +V  A +LPWSMLPDVID + ++       +  F+SFYVFF KFA GVSL IS ++L  AGY      Q   V   L   +  + I+  L+ ++    YPI E++R++    L+ +R E  S
Sbjct:   19 SILQSTERPAQVKKEPKKKKQQLSVCNKLCYALGGAPYQVTGCALGFFLQIYLLDVAQVGPFSASIILFVGRAWDAITDPLVGLCISKSPWTCLGRLMPWIIFSTPLAVIAYFLIWFVPDFPHGQTYWYLLFYC----LFETMVTCFHVPYSALTMFISTEQTERDSATAYRMTVEVLGTVLGTAIQGQIVGQADTPCFQDLNSSTVASQSANHTHGTTSHRETQKA-YLLAAGVIVCIYIICAVILILGVREQREPYEAQQSEPIAYFRGLRLVMSHGPYIKLITGFLFTSLAFMLVEGNFVLFCTYTLGFRNEFQNLLLAIMLSATLTIPIWQWFLTRFGKKTAVYVGISSAVPFLILVALMESN--LIITYAVAVAAGISVAAAFLLPWSMLPDVIDDFHLKQPHFHGTEPIFFSFYVFFTKFASGVSLGISTLSLDFAGYQTRGCSQPERVKFTLNMLVTMAPIVLILLGLLLFKMYPIDEERRRQNKKALQALRDEASS 515          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Human
Match: MFSD2A (major facilitator superfamily domain containing 2A [Source:HGNC Symbol;Acc:HGNC:25897])

HSP 1 Score: 269.626 bits (688), Expect = 1.459e-81
Identity = 165/517 (31.91%), Postives = 272/517 (52.61%), Query Frame = 1
Query:  133 SIFRKNDKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETAS-------------INPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKF--IFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATR-----------NRIANQPVT-ANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKE----LEILKDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENGC--RMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIENYS 1581
            SI +  ++     K     K+++ VC KL Y +GG P Q+   A+GFFL I+LL+ A              + P+  S I  + RAWDAITDP++G  I+K+  T  G+  PWI  +TPL+ +A+FL ++VP+  +  + +  +FYC      +T +T FHVPYS++ M +++   +RD  T+ RM  E++G + G  + G +  +           + +A+Q     + T S R T+K  Y++A+  +  I+I C++ ++LG +E     E  + +   Y   L+ +M   PY+ ++  F+F+SL   LV+ N  L+ T+TL         +L ++  +   +P+  + L R+GKK   + G  + +P L  +A +  N  L + Y   V    +V  A +LPWSMLPDVID + ++       +  F+SFYVFF KFA GVSL IS ++L  AGY      Q   V   L   +  + I+  L+ ++    YPI E++R++    L+ +R E  S
Sbjct:   19 SILQSTERPAQVKKEPKKKKQQLSVCNKLCYALGGAPYQVTGCALGFFLQIYLLDVAQKDEEVVFCFSSFQVGPFSASIILFVGRAWDAITDPLVGLCISKSPWTCLGRLMPWIIFSTPLAVIAYFLIWFVPDFPHGQTYWYLLFYCL----FETMVTCFHVPYSALTMFISTEQTERDSATAYRMTVEVLGTVLGTAIQGQIVGQADTPCFQDLNSSTVASQSANHTHGTTSHRETQKA-YLLAAGVIVCIYIICAVILILGVREQREPYEAQQSEPIAYFRGLRLVMSHGPYIKLITGFLFTSLAFMLVEGNFVLFCTYTLGFRNEFQNLLLAIMLSATLTIPIWQWFLTRFGKKTAVYVGISSAVPFLILVALMESN--LIITYAVAVAAGISVAAAFLLPWSMLPDVIDDFHLKQPHFHGTEPIFFSFYVFFTKFASGVSLGISTLSLDFAGYQTRGCSQPERVKFTLNMLVTMAPIVLILLGLLLFKMYPIDEERRRQNKKALQALRDEASS 528          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Human
Match: MFSD2B (major facilitator superfamily domain containing 2B [Source:HGNC Symbol;Acc:HGNC:37207])

HSP 1 Score: 219.935 bits (559), Expect = 2.434e-63
Identity = 153/480 (31.87%), Postives = 233/480 (48.54%), Query Frame = 1
Query:  196 RMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVP--NTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQP--VTANITDSMRNTEKND---YIIASAAVCVIFIACSISVLLGTKELEILKDKEEP-------YLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIE--NGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIENYSF 1584
            R+  C K+ YG+GG P Q+ S+A  F+L +FLL+ A I    +S +    +   A  DP+ GF IN++  T  G+  PW+   TP   LA+F  +++P   +   L    FYC      Q   T F VPY+++ M+LT   R+RD  T+ RM  E+ G L GA V G + +    A++P    A  T        N    Y IA+A V V +  C   + LG KE     D   P       +L  L    R  PYL ++ +F+F S  +Q+ QS L L+ TH   +  HV   +L +L  +    PL  ++L+R+GKK   F G   M+P    LA +P      V Y     +  ++ V+++LPWSMLPDV+D + ++  +G  ++  FYS YVFF K +   +L IS ++L  +GY     +Q   V   L+  IG       L  +  L      +   ++ + +L   R  +YS 
Sbjct:   38 RLSFCTKVCYGIGGVPNQIASSATAFYLQLFLLDIAQIPAAQVSLVLFGGKVSGAAADPVAGFFINRSQRTGSGRLMPWVLGCTPFIALAYFFLWFLPPFTSLRGLWYTTFYC----LFQALATFFQVPYTALTMLLTPCPRERDSATAYRMTVEMAGTLMGATVHGLIVSG---AHRPHRCEATATPGPVTVSPNAAHLYCIAAAVVVVTYPVCISLLCLGVKE---RPDPSAPASGPGLSFLAGLSLTTRHPPYLKLVISFLFISAAVQVEQSYLVLFCTHASQLHDHVQGLVLTVLVSAVLSTPLWEWVLQRFGKKTSAF-GIFAMVPFAILLAAVPTA---PVAYVVAFVSGVSIAVSLLLPWSMLPDVVDDFQLQHRHGPGLETIFYSSYVFFTKLSGACALGISTLSLEFSGYKAGVCKQAEEVVVTLKVLIGAVPTCMILAGLCILMVGSTPKTPSRDASSRLSLRRRTSYSL 503          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Human
Match: MFSD2B (major facilitator superfamily domain containing 2B [Source:HGNC Symbol;Acc:HGNC:37207])

HSP 1 Score: 216.853 bits (551), Expect = 3.452e-62
Identity = 151/474 (31.86%), Postives = 230/474 (48.52%), Query Frame = 1
Query:  196 RMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVP--NTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQP--VTANITDSMRNTEKND---YIIASAAVCVIFIACSISVLLGTKELEILKDKEEP-------YLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIE--NGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMR 1566
            R+  C K+ YG+GG P Q+ S+A  F+L +FLL+ A I    +S +    +   A  DP+ GF IN++  T  G+  PW+   TP   LA+F  +++P   +   L    FYC      Q   T F VPY+++ M+LT   R+RD  T+ RM  E+ G L GA V G + +    A++P    A  T        N    Y IA+A V V +  C   + LG KE     D   P       +L  L    R  PYL ++ +F+F S  +Q+ QS L L+ TH   +  HV   +L +L  +    PL  ++L+R+GKK   F G   M+P    LA +P      V Y     +  ++ V+++LPWSMLPDV+D + ++  +G  ++  FYS YVFF K +   +L IS ++L  +GY     +Q   V   L+  IG       L  +  L      +   ++ + +L   R
Sbjct:   38 RLSFCTKVCYGIGGVPNQIASSATAFYLQLFLLDIAQIPAAQVSLVLFGGKVSGAAADPVAGFFINRSQRTGSGRLMPWVLGCTPFIALAYFFLWFLPPFTSLRGLWYTTFYC----LFQALATFFQVPYTALTMLLTPCPRERDSATAYRMTVEMAGTLMGATVHGLIVSG---AHRPHRCEATATPGPVTVSPNAAHLYCIAAAVVVVTYPVCISLLCLGVKE---RPDPSAPASGPGLSFLAGLSLTTRHPPYLKLVISFLFISAAVQVEQSYLVLFCTHASQLHDHVQGLVLTVLVSAVLSTPLWEWVLQRFGKKTSAF-GIFAMVPFAILLAAVPTA---PVAYVVAFVSGVSIAVSLLLPWSMLPDVVDDFQLQHRHGPGLETIFYSSYVFFTKLSGACALGISTLSLEFSGYKAGVCKQAEEVVVTLKVLIGAVPTCMILAGLCILMVGSTPKTPSRDASSRLSLRR 497          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Human
Match: MFSD2B (major facilitator superfamily domain containing 2B [Source:HGNC Symbol;Acc:HGNC:37207])

HSP 1 Score: 213.772 bits (543), Expect = 9.006e-61
Identity = 152/505 (30.10%), Postives = 236/505 (46.73%), Query Frame = 1
Query:  196 RMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVP--NTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQ--------PVTA----------------------NITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEILKDKEEP-------YLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIE--NGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIENYSF 1584
            R+  C K+ YG+GG P Q+ S+A  F+L +FLL+ A I    +S +    +   A  DP+ GF IN++  T  G+  PW+   TP   LA+F  +++P   +   L    FYC      Q   T F VPY+++ M+LT   R+RD  T+ RM  E+ G L GA V G + +     ++        PVT                       ++ D +     + Y IA+A V V +  C   + LG KE     D   P       +L  L    R  PYL ++ +F+F S  +Q+ QS L L+ TH   +  HV   +L +L  +    PL  ++L+R+GKK   F G   M+P    LA +P      V Y     +  ++ V+++LPWSMLPDV+D + ++  +G  ++  FYS YVFF K +   +L IS ++L  +GY     +Q   V   L+  IG       L  +  L      +   ++ + +L   R  +YS 
Sbjct:   38 RLSFCTKVCYGIGGVPNQIASSATAFYLQLFLLDIAQIPAAQVSLVLFGGKVSGAAADPVAGFFINRSQRTGSGRLMPWVLGCTPFIALAYFFLWFLPPFTSLRGLWYTTFYCL----FQALATFFQVPYTALTMLLTPCPRERDSATAYRMTVEMAGTLMGATVHGLIVSGAHRPHRCEATATPGPVTVSPNAVEQSYLALFCTHASQLHDHVQDLVLAVLAHLYCIAAAVVVVTYPVCISLLCLGVKER---PDPSAPASGPGLSFLAGLSLTTRHPPYLKLVISFLFISAAVQVEQSYLVLFCTHASQLHDHVQGLVLTVLVSAVLSTPLWEWVLQRFGKKTSAF-GIFAMVPFAILLAAVPTA---PVAYVVAFVSGVSIAVSLLLPWSMLPDVVDDFQLQHRHGPGLETIFYSSYVFFTKLSGACALGISTLSLEFSGYKAGVCKQAEEVVVTLKVLIGAVPTCMILAGLCILMVGSTPKTPSRDASSRLSLRRRTSYSL 531          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Zebrafish
Match: mfsd2b (major facilitator superfamily domain containing 2B [Source:ZFIN;Acc:ZDB-GENE-041210-308])

HSP 1 Score: 298.516 bits (763), Expect = 2.288e-93
Identity = 168/490 (34.29%), Postives = 268/490 (54.69%), Query Frame = 1
Query:  166 ESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLAT----------RNRIANQPVTANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEILKDKEEPYLPNLKK----------IMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMI--ENGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMR 1566
            ++ PT +  +++ VC KL + +GG P Q+  +A  FFL I+LL+ A INP+  S +  + +AW A+TDPI+GF I K+  TK G+  PW+   TP   +++F  ++VP   N   +F++Y       QT +T FHVPYS++ M L+++ R+RD  T+ RM  E++G L GA + G +            RN  A     ++ T+ +R+  K  Y+IA+  +  +F+ C++ + LG KE      +++PY P   K          +M+   YL +  +F+F S+ IQL+QSN  L+ T+ + +  H    +L +L  +   +P   + L ++GKK   F G   ++P    L F+P   +L V Y   V +  +V  +++LPWSMLPDV+D + +   N    +A FYS Y FF KFA G+SL +S + L  AGYD  A +Q   V   L+  IG + + C    ++ L  YPI+E  R    + LEE+R
Sbjct:    6 DTLPT-LLDQKLSVCSKLCFAIGGAPNQVAGSATAFFLQIYLLDIAQINPFQASMVLFVGKAWGAVTDPIVGFFITKSKWTKIGRLMPWMVGCTPFMVVSYFYLWFVPPFTN--GRFMWYLGFYCLYQTLITCFHVPYSALTMFLSTDQRERDSATAYRMTVEVLGTLVGAAIQGQIVASAHTLKHCPHRNLTAAHLTNSSGTEIIRSL-KEVYMIAAGVIGGLFLVCTVVMFLGVKE------RDDPYAPKTDKAIPFHKGFILVMKHGSYLTLTASFLFISVAIQLIQSNFVLFCTYAVELRDHFQNIVLTILMSAAVSIPFWQWFLEKFGKKTAAFCGITWIMPFTVMLVFIP---NLIVAYVVAVSSGLSVAASLLLPWSMLPDVVDDFRLANRNSKGHEAIFYSLYAFFTKFAAGISLGVSTLCLQFAGYDTGACRQPLPVVYTLKLLIGAAPVACITTGLMILVVYPISEDVRLRNKVALEELR 482          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Zebrafish
Match: mfsd2b (major facilitator superfamily domain containing 2B [Source:ZFIN;Acc:ZDB-GENE-041210-308])

HSP 1 Score: 300.056 bits (767), Expect = 3.891e-93
Identity = 168/510 (32.94%), Postives = 271/510 (53.14%), Query Frame = 1
Query:  175 PTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLAT----------RNRIANQPVTANITDSMRNT---------EKNDYIIASAAVCVIFIACSISVLLGTKELEILKDKEEPYLPNLKK----------IMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMI--ENGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIENYSFISYHEDIK 1608
            P  +  +++ VC KL + +GG P Q+  +A  FFL I+LL+ A INP+  S +  + +AW A+TDPI+GF I K+  TK G+  PW+   TP   +++F  ++VP   N   +F++Y       QT +T FHVPYS++ M L+++ R+RD  T+ RM  E++G L GA + G +            RN  A     ++ T+ +R+           K  Y+IA+  +  +F+ C++ + LG KE      +++PY P   K          +M+   YL +  +F+F S+ IQL+QSN  L+ T+ + +  H    +L +L  +   +P   + L ++GKK   F G   ++P    L F+P   +L V Y   V +  +V  +++LPWSMLPDV+D + +   N    +A FYS Y FF KFA G+SL +S + L  AGYD  A +Q   V   L+  IG + + C    ++ L  YPI+E  R    + LEE+R ++ +  +   D+ 
Sbjct:   51 PQTLLDQKLSVCSKLCFAIGGAPNQVAGSATAFFLQIYLLDIAQINPFQASMVLFVGKAWGAVTDPIVGFFITKSKWTKIGRLMPWMVGCTPFMVVSYFYLWFVPPFTN--GRFMWYLGFYCLYQTLITCFHVPYSALTMFLSTDQRERDSATAYRMTVEVLGTLVGAAIQGQIVASAHTLKHCPHRNLTAAHLTNSSGTEIIRSLALSQDFLSHAKEVYMIAAGVIGGLFLVCTVVMFLGVKE------RDDPYAPKTDKAIPFHKGFILVMKHGSYLTLTASFLFISVAIQLIQSNFVLFCTYAVELRDHFQNIVLTILMSAAVSIPFWQWFLEKFGKKTAAFCGITWIMPFTVMLVFIP---NLIVAYVVAVSSGLSVAASLLLPWSMLPDVVDDFRLANRNSKGHEAIFYSLYAFFTKFAAGISLGVSTLCLQFAGYDTGACRQPLPVVYTLKLLIGAAPVACITTGLMILVVYPISEDVRLRNKVALEELRKQSITCKTLRADLS 549          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Zebrafish
Match: mfsd2ab (major facilitator superfamily domain containing 2ab [Source:NCBI gene;Acc:445176])

HSP 1 Score: 297.36 bits (760), Expect = 1.488e-92
Identity = 172/496 (34.68%), Postives = 272/496 (54.84%), Query Frame = 1
Query:  151 DKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQPVTA----------------NITDSMRNTE--KNDYIIASAAVCVIFIACSISVLLGTKEL-EILKDKEEP--YLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIEN--GCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMR 1566
            D+ K+    T   K R+ VC KL Y +GG P Q+   A+GFFL I+LL+ A ++P+Y S I  + RAWDA+TDP +GF++++T  T+FG+  PWI L+TP + L +FL +YVP+ D    K ++Y       QT  T FHVPYS++ M +++  ++RD  T+ RM  E++G L G  + G +     +AN P  +                NITD   + +  +N Y+IAS  +C I++ C++ + LG KE  +  + + EP  +   +  +M   PY  ++  F+F+SL   L++ N AL+  + L         +LV++  +   +P   + L ++GKK   + G  +++P L ++  +P +  LAV Y        +V  A +LPWSMLPDV+D + ++N      +A FYSFYVFF KFA GVSL +S ++L  AGY      Q   V   L+  +  + I+  +I ++    YPI E+KR+     L E R
Sbjct:   22 DEVKLAKHET---KSRLSVCSKLCYAIGGAPYQITGCAIGFFLQIYLLDVALLDPFYASIILFVGRAWDAVTDPTVGFLVSRTPWTRFGRMMPWIVLSTPFAVLCYFLIWYVPSVDQ--GKVVWYLIFYCCFQTLQTCFHVPYSALTMFISTEQKERDSATAYRMTVEVLGTLIGTAIQGQIV---GMANAPCISTEIDLNSTGLEVAPDVNITDPHVSLQDLRNAYMIASGVICAIYVVCAVVLFLGVKEQKDTCRVRTEPMSFFQGICMVMGHGPYAKLVMGFLFTSLAFMLLEGNFALFCIYNLGFRNDFQNVLLVIMLSATLAIPFWQWFLTKFGKKTAVYIGTTSVVPFLISVVLVPSS--LAVTYIASFAAGVSVAAAFLLPWSMLPDVVDDFKVQNPESQGHEAIFYSFYVFFTKFASGVSLGVSTLSLDFAGYVTRGCTQPGEVKLTLKILVSAAPIVLIIIGLLIFISYPINEEKRQGNRKLLNEQR 507          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Zebrafish
Match: mfsd2ab (major facilitator superfamily domain containing 2ab [Source:NCBI gene;Acc:445176])

HSP 1 Score: 290.812 bits (743), Expect = 7.045e-90
Identity = 173/504 (34.33%), Postives = 271/504 (53.77%), Query Frame = 1
Query:  151 DKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQPVTA----------------NITDSMRNTE--KNDYIIASAAVCVIFIACSISVLLGTKEL-EILKDKEEP--YLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQ--------SNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIEN--GCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMR 1566
            D+ K+    T   K R+ VC KL Y +GG P Q+   A+GFFL I+LL+ A ++P+Y S I  + RAWDA+TDP +GF++++T  T+FG+  PWI L+TP + L +FL +YVP+ D    K ++Y       QT  T FHVPYS++ M +++  ++RD  T+ RM  E++G L G  + G +     +AN P  +                NITD   + +  +N Y+IAS  +C I++ C++ + LG KE  +  + + EP  +   +  +M   PY  ++  F+F+SL   L Q         N AL+  + L         +LV++  +   +P   + L ++GKK   + G  +++P L ++  +P +  LAV Y        +V  A +LPWSMLPDV+D + ++N      +A FYSFYVFF KFA GVSL +S ++L  AGY      Q   V   L+  +  + I+  +I ++    YPI E+KR+     L E R
Sbjct:   22 DEVKLAKHET---KSRLSVCSKLCYAIGGAPYQITGCAIGFFLQIYLLDVALLDPFYASIILFVGRAWDAVTDPTVGFLVSRTPWTRFGRMMPWIVLSTPFAVLCYFLIWYVPSVDQ--GKVVWYLIFYCCFQTLQTCFHVPYSALTMFISTEQKERDSATAYRMTVEVLGTLIGTAIQGQIV---GMANAPCISTEIDLNSTGLEVAPDVNITDPHVSLQDLRNAYMIASGVICAIYVVCAVVLFLGVKEQKDTCRVRTEPMSFFQGICMVMGHGPYAKLVMGFLFTSLAFMLFQNFPYFLLEGNFALFCIYNLGFRNDFQNVLLVIMLSATLAIPFWQWFLTKFGKKTAVYIGTTSVVPFLISVVLVPSS--LAVTYIASFAAGVSVAAAFLLPWSMLPDVVDDFKVQNPESQGHEAIFYSFYVFFTKFASGVSLGVSTLSLDFAGYVTRGCTQPGEVKLTLKILVSAAPIVLIIIGLLIFISYPINEEKRQGNRKLLNEQR 515          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Zebrafish
Match: mfsd2aa (major facilitator superfamily domain containing 2aa [Source:NCBI gene;Acc:492810])

HSP 1 Score: 272.322 bits (695), Expect = 7.336e-83
Identity = 157/498 (31.53%), Postives = 264/498 (53.01%), Query Frame = 1
Query:  124 PIKSIFRKNDKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLA--------------------TRNRIANQPVTANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKEL----EILKDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENGCRM--DATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRK 1536
            P      +N+ + ++       KR + V  K+ + +GG P Q+   A+GFFL IFLL+ A +NP   S I  + RAWDA+TDP +GF++++T  T+ G+  PWI ++T  + L +FL + VP  +    K ++Y       QT  T FHVPYS++ M +++  R+RD  T+ RM  E+ G + G  + G +                      ++  ++ P+ +NI D     E+  Y+IASA + +I++ C+  +  G +E     E+   K   +   L+ +M   PY+ ++ AF+F+SL   L++ N A++I +TL   +     +LV++  +   +P+  + L R+GKK   + G    +P +  +  +  N  L V Y   +    +V  A +LPWSMLPDV+D + ++N      +A FYSFYVFF KFA GVSL +S +AL  AGY+     Q+ SV+  L+  +  + +    + ++    YPI E++R+
Sbjct:   16 PTAKSVTQNEIKMVKLSKQQERKRALTVWSKVCFAIGGAPYQITGTALGFFLQIFLLDVARLNPLNASVILFVGRAWDAVTDPTVGFLVSRTPWTRHGRMMPWILVSTIPAVLCYFLIWVVPPIEQ--GKMMWYLLFYCLFQTLQTCFHVPYSALTMFISTEQRERDSATAYRMTVEVFGTVVGTAIQGQIVGMANTPCKNNTSPNNSSNDSIQSNNSHIPLKSNIFD-----ERCAYMIASAVISLIYVVCAAVLFFGVREQDVQGELKAQKRVSFQKGLRLVMGHGPYVKLVLAFLFTSLAFMLLEGNFAVFIKYTLGFREDFQNILLVIMVSATVSIPMWQWFLCRFGKKTAVYIGITWAVPFM--ILVVSVNSSLIVSYIVSIAAGVSVGAAFLLPWSMLPDVVDDFKLQNPTSQGHEAIFYSFYVFFTKFASGVSLGVSTLALSFAGYETGVCVQSDSVNLTLKLLVSAAPVSLIALGLLIFMTYPIDEERRE 504          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Xenopus
Match: mfsd2a (major facilitator superfamily domain containing 2A [Source:NCBI gene;Acc:780091])

HSP 1 Score: 305.064 bits (780), Expect = 2.296e-95
Identity = 170/472 (36.02%), Postives = 272/472 (57.63%), Query Frame = 1
Query:  190 KRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQPVTANITDS-MRNTEKNDYIIASAAVCVIFIACSISVLLGTKE----LEILKDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIEN--GCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIENYS 1581
            K ++ VC K+ + +GG P Q+   A+GFFL IFLL+ A + P+Y S I    R WDAITDP++GF ++K++ T+ G+  PW+  +TP + +++ L ++VP     +S  I+Y       QT +T FHVPYS++ M ++    DRD  T  RM  E++G + G  + G +  R    N P   +I ++ + NT ++ Y+IA+  +C I++ C+I + LG +E     E+L D+   +   LK +M  KPY+ ++  F+F+SL   L++ N AL++T+T+   +     +LV++  +   VP   + L R+GKK   + G  ++IP L  +  +  N+ LA  Y   V    +V  A +LPWSMLPDVID ++++N      +  F+SFYVFF KFA GVSL IS ++L  AGY   A  Q   V+  L+  I  + +I  L+ ++    YPI E+KRK+    L+ +R  NY+
Sbjct:   35 KHKLSVCSKICFAIGGAPYQITGCALGFFLQIFLLDIAQVPPFYASIILFSGRVWDAITDPLVGFFVSKSSWTRLGRLLPWVVFSTPFAVVSYLLIWFVPGFSG-VSMVIWYLVFYCLFQTLVTCFHVPYSALTMFISKEQSDRDSATGYRMTVEVLGTVLGTAIQGQIVGRE---NTPCVEHIRETHLYNTSRDAYMIAAGVICAIYVLCAIILTLGVREKRDAYELLSDQPFSFWQGLKLVMSHKPYIKLITGFLFTSLAFMLLEGNFALFLTYTMGFRRDFQNILLVVMLSATLTVPFWQWFLTRFGKKTAVYFGISSVIPFLILVVLMESNLILA--YVVAVAAGLSVAAAFLLPWSMLPDVIDDFILKNPDSHGHEPIFFSFYVFFTKFASGVSLGISTLSLDFAGYQTRACSQPEQVNLTLKMLICVAPVILILLGLLLFILYPINEEKRKQNKKALQLIR--NYT 498          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Xenopus
Match: mfsd2a (major facilitator superfamily domain containing 2A [Source:NCBI gene;Acc:780091])

HSP 1 Score: 297.745 bits (761), Expect = 4.106e-93
Identity = 168/478 (35.15%), Postives = 270/478 (56.49%), Query Frame = 1
Query:  190 KRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQPVTANITDS-MRNT-----------EKNDYIIASAAVCVIFIACSISVLLGTKE----LEILKDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIEN--GCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMR 1566
            K ++ VC K+ + +GG P Q+   A+GFFL IFLL+ A + P+Y S I    R WDAITDP++GF ++K++ T+ G+  PW+  +TP + +++ L ++VP     +S  I+Y       QT +T FHVPYS++ M ++    DRD  T  RM  E++G + G  + G +  R    N P   +I ++ + NT           +++ Y+IA+  +C I++ C+I + LG +E     E+L D+   +   LK +M  KPY+ ++  F+F+SL   L++ N AL++T+T+   +     +LV++  +   VP   + L R+GKK   + G  ++IP L  +  +  N+ LA  Y   V    +V  A +LPWSMLPDVID ++++N      +  F+SFYVFF KFA GVSL IS ++L  AGY   A  Q   V+  L+  I  + +I  L+ ++    YPI E+KRK+    L+ +R
Sbjct:    4 KHKLSVCSKICFAIGGAPYQITGCALGFFLQIFLLDIAQVPPFYASIILFSGRVWDAITDPLVGFFVSKSSWTRLGRLLPWVVFSTPFAVVSYLLIWFVPGFSG-VSMVIWYLVFYCLFQTLVTCFHVPYSALTMFISKEQSDRDSATGYRMTVEVLGTVLGTAIQGQIVGRE---NTPCVEHIRETHLYNTSVIMEDLNITHDRDAYMIAAGVICAIYVLCAIILTLGVREKRDAYELLSDQPFSFWQGLKLVMSHKPYIKLITGFLFTSLAFMLLEGNFALFLTYTMGFRRDFQNILLVVMLSATLTVPFWQWFLTRFGKKTAVYFGISSVIPFLILVVLMESNLILA--YVVAVAAGLSVAAAFLLPWSMLPDVIDDFILKNPDSHGHEPIFFSFYVFFTKFASGVSLGISTLSLDFAGYQTRACSQPEQVNLTLKMLICVAPVILILLGLLLFILYPINEEKRKQNKKALQLIR 475          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Xenopus
Match: mfsd2a (major facilitator superfamily domain containing 2A [Source:NCBI gene;Acc:780091])

HSP 1 Score: 296.975 bits (759), Expect = 3.422e-92
Identity = 169/488 (34.63%), Postives = 270/488 (55.33%), Query Frame = 1
Query:  190 KRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQPVTANITDS-MRNTE------------------KNDYIIASAAVCVIFIACSISVLLGTKE----LEILKDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIEN--GCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIEN 1575
            K ++ VC K+ + +GG P Q+   A+GFFL IFLL+ A + P+Y S I    R WDAITDP++GF ++K++ T+ G+  PW+  +TP + +++ L ++VP     +S  I+Y       QT +T FHVPYS++ M ++    DRD  T  RM  E++G + G  + G +  R    N P   +I ++ + NT                   ++ Y+IA+  +C I++ C+I + LG +E     E+L D+   +   LK +M  KPY+ ++  F+F+SL   L++ N AL++T+T+   +     +LV++  +   VP   + L R+GKK   + G  ++IP L  +  +  N+ LA  Y   V    +V  A +LPWSMLPDVID ++++N      +  F+SFYVFF KFA GVSL IS ++L  AGY   A  Q   V+  L+  I  + +I  L+ ++    YPI E+KRK+    L+ +R  N
Sbjct:   30 KHKLSVCSKICFAIGGAPYQITGCALGFFLQIFLLDIAQVPPFYASIILFSGRVWDAITDPLVGFFVSKSSWTRLGRLLPWVVFSTPFAVVSYLLIWFVPGFSG-VSMVIWYLVFYCLFQTLVTCFHVPYSALTMFISKEQSDRDSATGYRMTVEVLGTVLGTAIQGQIVGRE---NTPCVEHIRETHLYNTSVIMEDLNITHDVESLSSTRDAYMIAAGVICAIYVLCAIILTLGVREKRDAYELLSDQPFSFWQGLKLVMSHKPYIKLITGFLFTSLAFMLLEGNFALFLTYTMGFRRDFQNILLVVMLSATLTVPFWQWFLTRFGKKTAVYFGISSVIPFLILVVLMESNLILA--YVVAVAAGLSVAAAFLLPWSMLPDVIDDFILKNPDSHGHEPIFFSFYVFFTKFASGVSLGISTLSLDFAGYQTRACSQPEQVNLTLKMLICVAPVILILLGLLLFILYPINEEKRKQNKKALQLIRESN 511          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Xenopus
Match: mfsd2a (major facilitator superfamily domain containing 2A [Source:NCBI gene;Acc:780091])

HSP 1 Score: 294.664 bits (753), Expect = 2.784e-91
Identity = 170/494 (34.41%), Postives = 272/494 (55.06%), Query Frame = 1
Query:  190 KRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQPVTANITDS-MRNTE------------------KNDYIIASAAVCVIFIACSISVLLGTKE----LEILKDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIEN--GCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIENYSFISY 1593
            K ++ VC K+ + +GG P Q+   A+GFFL IFLL+ A + P+Y S I    R WDAITDP++GF ++K++ T+ G+  PW+  +TP + +++ L ++VP     +S  I+Y       QT +T FHVPYS++ M ++    DRD  T  RM  E++G + G  + G +  R    N P   +I ++ + NT                   ++ Y+IA+  +C I++ C+I + LG +E     E+L D+   +   LK +M  KPY+ ++  F+F+SL   L++ N AL++T+T+   +     +LV++  +   VP   + L R+GKK   + G  ++IP L  +  +  N+ LA  Y   V    +V  A +LPWSMLPDVID ++++N      +  F+SFYVFF KFA GVSL IS ++L  AGY   A  Q   V+  L+  I  + +I  L+ ++    YPI E+KRK+    L+ +R  +   I Y
Sbjct:   34 KHKLSVCSKICFAIGGAPYQITGCALGFFLQIFLLDIAQVPPFYASIILFSGRVWDAITDPLVGFFVSKSSWTRLGRLLPWVVFSTPFAVVSYLLIWFVPGFSG-VSMVIWYLVFYCLFQTLVTCFHVPYSALTMFISKEQSDRDSATGYRMTVEVLGTVLGTAIQGQIVGRE---NTPCVEHIRETHLYNTSVIMEDLNITHDVESLSSTRDAYMIAAGVICAIYVLCAIILTLGVREKRDAYELLSDQPFSFWQGLKLVMSHKPYIKLITGFLFTSLAFMLLEGNFALFLTYTMGFRRDFQNILLVVMLSATLTVPFWQWFLTRFGKKTAVYFGISSVIPFLILVVLMESNLILA--YVVAVAAGLSVAAAFLLPWSMLPDVIDDFILKNPDSHGHEPIFFSFYVFFTKFASGVSLGISTLSLDFAGYQTRACSQPEQVNLTLKMLICVAPVILILLGLLLFILYPINEEKRKQNKKALQLIRSGHIIVIVY 521          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Xenopus
Match: mfsd2a (major facilitator superfamily domain containing 2A [Source:NCBI gene;Acc:780091])

HSP 1 Score: 290.426 bits (742), Expect = 9.066e-90
Identity = 164/472 (34.75%), Postives = 263/472 (55.72%), Query Frame = 1
Query:  190 KRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQPVTANITDS-MRNTE------------------KNDYIIASAAVCVIFIACSISVLLGTKELEILKDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIEN--GCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKE 1539
            K ++ VC K+ + +GG P Q+   A+GFFL IFLL+ A + P+Y S I    R WDAITDP++GF ++K++ T+ G+  PW+  +TP + +++ L ++VP     +S  I+Y       QT +T FHVPYS++ M ++    DRD  T  RM  E++G + G  + G +  R    N P   +I ++ + NT                   ++ Y+IA+  +C I++ C+I + LG +E    +D+   +   LK +M  KPY+ ++  F+F+SL   L++ N AL++T+T+   +     +LV++  +   VP   + L R+GKK   + G  ++IP L  +  +  N+ LA  Y   V    +V  A +LPWSMLPDVID ++++N      +  F+SFYVFF KFA GVSL IS ++L  AGY   A  Q   V+  L+  I  + +I  L+ ++    YPI E+KRK+
Sbjct:   30 KHKLSVCSKICFAIGGAPYQITGCALGFFLQIFLLDIAQVPPFYASIILFSGRVWDAITDPLVGFFVSKSSWTRLGRLLPWVVFSTPFAVVSYLLIWFVPGFSG-VSMVIWYLVFYCLFQTLVTCFHVPYSALTMFISKEQSDRDSATGYRMTVEVLGTVLGTAIQGQIVGRE---NTPCVEHIRETHLYNTSVIMEDLNITHDVESLSSTRDAYMIAAGVICAIYVLCAIILTLGVRE---KRDQPFSFWQGLKLVMSHKPYIKLITGFLFTSLAFMLLEGNFALFLTYTMGFRRDFQNILLVVMLSATLTVPFWQWFLTRFGKKTAVYFGISSVIPFLILVVLMESNLILA--YVVAVAAGLSVAAAFLLPWSMLPDVIDDFILKNPDSHGHEPIFFSFYVFFTKFASGVSLGISTLSLDFAGYQTRACSQPEQVNLTLKMLICVAPVILILLGLLLFILYPINEEKRKQ 492          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Mouse
Match: Mfsd2a (major facilitator superfamily domain containing 2A [Source:MGI Symbol;Acc:MGI:1923824])

HSP 1 Score: 274.633 bits (701), Expect = 1.286e-83
Identity = 164/508 (32.28%), Postives = 282/508 (55.51%), Query Frame = 1
Query:  133 SIFRKNDKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSK---FIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATR---------------NRIANQPVTANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEILKDKEE----PYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIE--NGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIENYS 1581
            SI + +++  ++ K  P  K+++ +C KL Y +GG P Q+   A+GFFL I+LL+ A + P   S I  + RAWDA TDP++GF I+K++ T+ G+  PWI  +TPL+ +A+FL ++VP+  +       F++Y       +T +T FHVPYS++ M +++   +RD  T+ RM  E++G + G  + G +  +               + +AN+      T S+++T+ N Y++A+  +  I++ C+  ++LG +E   L + ++    P+   L+ +M   PY+ ++  F+F+SL   LV+ N AL+ T+TL+        +L ++  +   +P+  + L R+GKK   + G  + +P L  +A + +N  L V Y   V    +V  A +LPWSMLPDVID + ++  +    +  F+SFYVFF KFA GVSL +S ++L  A Y +    Q   V   L+  +  + II  L+ ++    YPI E+KR++    L+ +R E  S
Sbjct:   19 SILQASER-PVQVKKEPKKKQQLSICNKLCYAVGGAPYQLTGCALGFFLQIYLLDVAKVEPLPASIILFVGRAWDAFTDPLVGFCISKSSWTRLGRLMPWIIFSTPLAIIAYFLIWFVPDFPSGTESSHGFLWYLLFYCLFETLVTCFHVPYSALTMFISTEQSERDSATAYRMTVEVLGTVIGTAIQGQIVGQAKAPCLQDQNGSVVVSEVANR---TQSTASLKDTQ-NAYLLAAGIIASIYVLCAFILILGVREQRELYESQQAESMPFFQGLRLVMGHGPYVKLIAGFLFTSLAFMLVEGNFALFCTYTLDFRNEFQNLLLAIMLSATFTIPIWQWFLTRFGKKTAVYIGISSAVPFLILVALMERN--LIVTYVVAVAAGVSVAAAFLLPWSMLPDVIDDFHLKHPHSPGTEPIFFSFYVFFTKFASGVSLGVSTLSLDFANYQRQGCSQPEQVKFTLKMLVTMAPIILILLGLLLFKLYPIDEEKRRQNKKALQALREEASS 519          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Mouse
Match: Mfsd2b (major facilitator superfamily domain containing 2B [Source:MGI Symbol;Acc:MGI:3583946])

HSP 1 Score: 229.565 bits (584), Expect = 3.686e-67
Identity = 155/481 (32.22%), Postives = 238/481 (49.48%), Query Frame = 1
Query:  196 RMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKT-NTKFGKYKPWISLATPLSCLAFFLQFYVP--NTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLAT------RNRIANQPVTANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEILKDKEEP-------YLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENGC--RMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIENYSF 1584
            R+ VC K+ YG+GG P Q+ S+A  F+L +FLL+ A I    +S      +   A+ DP+ GF INK+  T  G+  PW     PL  LA+F  +++P   +   L    FYC      Q   T F VPY+++ M+LT + R+RD  T+ RM  E+ G L GA V G + +      R      P +  ++  +       Y IA+A V + +  C   + LG KE     D   P       +   L    +  PYL ++ +F+F S  +Q+ QS L L+ TH   +  HV   +L++L  +    PL  ++L+R+GKK   F G   M+P    LA +P      V Y     +  ++ V+++LPWSMLPDV+D + +++ C   ++  FYS YVFF K +   +L IS ++L  AGY+  A QQ   V   L+  IG       LI +  L   P  +  R++ + +L   R  +YS 
Sbjct:   28 RLSVCTKVCYGIGGVPNQVASSASAFYLQLFLLDVAQIPAAQVSLALFGGKVSGAVADPVAGFFINKSRRTGSGRLMPWALGCMPLIALAYFFLWFLPPFTSLRGLWYTSFYC----LFQALATFFQVPYTALTMILTPSPRERDSATAYRMTMEMAGTLMGATVHGLIVSSAHGSQRCEDTVHPRSPAVSPDVARL----YCIAAAVVALTYPVCGSLLCLGVKE---QPDTSAPASGQGLNFFTGLAITSQHPPYLSLVVSFLFISAAVQVEQSYLVLFCTHASKLQDHVQNLVLIILVSAVLSTPLWEWVLQRFGKKTSAF-GICVMVPFSILLAAVPSA---PVAYVVAFVSGVSIAVSLLLPWSMLPDVVDDFQLQHRCGPGVETIFYSSYVFFTKLSGAGALGISTLSLEFAGYEAGACQQAEEVVVTLKVLIGAVPTCMILIGLCILLVGPTPKMPRQDTSSQLSLRRRTSYSL 493          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Mouse
Match: Mfsd2b (major facilitator superfamily domain containing 2B [Source:MGI Symbol;Acc:MGI:3583946])

HSP 1 Score: 175.252 bits (443), Expect = 2.997e-48
Identity = 125/404 (30.94%), Postives = 194/404 (48.02%), Query Frame = 1
Query:  424 PWISLATPLSCLAFFLQFYVP--NTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLAT------RNRIANQPVTANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEILKDKEEP-------YLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENGC--RMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIENYSF 1584
            PW     PL  LA+F  +++P   +   L    FYC      Q   T F VPY+++ M+LT + R+RD  T+ RM  E+ G L GA V G + +      R      P +  ++  +       Y IA+A V + +  C   + LG KE     D   P       +   L    +  PYL ++ +F+F S  +Q+ QS L L+ TH   +  HV   +L++L  +    PL  ++L+R+GKK   F G   M+P    LA +P      V Y     +  ++ V+++LPWSMLPDV+D + +++ C   ++  FYS YVFF K +   +L IS ++L  AGY+  A QQ   V   L+  IG       LI +  L   P  +  R++ + +L   R  +YS 
Sbjct:    2 PWALGCMPLIALAYFFLWFLPPFTSLRGLWYTSFYCL----FQALATFFQVPYTALTMILTPSPRERDSATAYRMTMEMAGTLMGATVHGLIVSSAHGSQRCEDTVHPRSPAVSPDVARL----YCIAAAVVALTYPVCGSLLCLGVKEQ---PDTSAPASGQGLNFFTGLAITSQHPPYLSLVVSFLFISAAVQVEQSYLVLFCTHASKLQDHVQNLVLIILVSAVLSTPLWEWVLQRFGKKTSAF-GICVMVPFSILLAAVPSA---PVAYVVAFVSGVSIAVSLLLPWSMLPDVVDDFQLQHRCGPGVETIFYSSYVFFTKLSGAGALGISTLSLEFAGYEAGACQQAEEVVVTLKVLIGAVPTCMILIGLCILLVGPTPKMPRQDTSSQLSLRRRTSYSL 390          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Mouse
Match: Mfsd2b (major facilitator superfamily domain containing 2B [Source:MGI Symbol;Acc:MGI:3583946])

HSP 1 Score: 154.451 bits (389), Expect = 3.759e-41
Identity = 104/325 (32.00%), Postives = 159/325 (48.92%), Query Frame = 1
Query:  196 RMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKT-NTKFGKYKPWISLATPLSCLAFFLQFYVP--NTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLAT------RNRIANQPVTANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEILKDKEEP-------YLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFA 1122
            R+ VC K+ YG+GG P Q+ S+A  F+L +FLL+ A I    +S      +   A+ DP+ GF INK+  T  G+  PW     PL  LA+F  +++P   +   L    FYC      Q   T F VPY+++ M+LT + R+RD  T+ RM  E+ G L GA V G + +      R      P +  ++  +       Y IA+A V + +  C   + LG KE     D   P       +   L    +  PYL ++ +F+F S  +Q+ QS L L+ TH   +  HV   +L++L  +    PL  ++L+R+GKK   F 
Sbjct:   28 RLSVCTKVCYGIGGVPNQVASSASAFYLQLFLLDVAQIPAAQVSLALFGGKVSGAVADPVAGFFINKSRRTGSGRLMPWALGCMPLIALAYFFLWFLPPFTSLRGLWYTSFYC----LFQALATFFQVPYTALTMILTPSPRERDSATAYRMTMEMAGTLMGATVHGLIVSSAHGSQRCEDTVHPRSPAVSPDVARL----YCIAAAVVALTYPVCGSLLCLGVKE---QPDTSAPASGQGLNFFTGLAITSQHPPYLSLVVSFLFISAAVQVEQSYLVLFCTHASKLQDHVQNLVLIILVSAVLSTPLWEWVLQRFGKKTSAFG 341          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Mouse
Match: Mfsd2a (major facilitator superfamily domain containing 2A [Source:MGI Symbol;Acc:MGI:1923824])

HSP 1 Score: 80.4925 bits (197), Expect = 7.387e-18
Identity = 34/74 (45.95%), Postives = 50/74 (67.57%), Query Frame = 1
Query:  181 PIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN 402
            P  K+++ +C KL Y +GG P Q+   A+GFFL I+LL+ A + P   S I  + RAWDA TDP++GF I+K++
Sbjct:   33 PKKKQQLSICNKLCYAVGGAPYQLTGCALGFFLQIYLLDVAKVEPLPASIILFVGRAWDAFTDPLVGFCISKSS 106          
BLAST of Major facilitator superfamily domain containing protein vs. UniProt/SwissProt
Match: sp|Q6DEJ6|NLS1B_DANRE (Sodium-dependent lysophosphatidylcholine symporter 1-B OS=Danio rerio OX=7955 GN=mfsd2ab PE=2 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 1.123e-91
Identity = 172/496 (34.68%), Postives = 272/496 (54.84%), Query Frame = 1
Query:  151 DKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQPVTA----------------NITDSMRNTE--KNDYIIASAAVCVIFIACSISVLLGTKEL-EILKDKEEP--YLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIEN--GCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMR 1566
            D+ K+    T   K R+ VC KL Y +GG P Q+   A+GFFL I+LL+ A ++P+Y S I  + RAWDA+TDP +GF++++T  T+FG+  PWI L+TP + L +FL +YVP+ D    K ++Y       QT  T FHVPYS++ M +++  ++RD  T+ RM  E++G L G  + G +     +AN P  +                NITD   + +  +N Y+IAS  +C I++ C++ + LG KE  +  + + EP  +   +  +M   PY  ++  F+F+SL   L++ N AL+  + L         +LV++  +   +P   + L ++GKK   + G  +++P L ++  +P +  LAV Y        +V  A +LPWSMLPDV+D + ++N      +A FYSFYVFF KFA GVSL +S ++L  AGY      Q   V   L+  +  + I+  +I ++    YPI E+KR+     L E R
Sbjct:   22 DEVKLAKHET---KSRLSVCSKLCYAIGGAPYQITGCAIGFFLQIYLLDVALLDPFYASIILFVGRAWDAVTDPTVGFLVSRTPWTRFGRMMPWIVLSTPFAVLCYFLIWYVPSVDQ--GKVVWYLIFYCCFQTLQTCFHVPYSALTMFISTEQKERDSATAYRMTVEVLGTLIGTAIQGQIV---GMANAPCISTEIDLNSTGLEVAPDVNITDPHVSLQDLRNAYMIASGVICAIYVVCAVVLFLGVKEQKDTCRVRTEPMSFFQGICMVMGHGPYAKLVMGFLFTSLAFMLLEGNFALFCIYNLGFRNDFQNVLLVIMLSATLAIPFWQWFLTKFGKKTAVYIGTTSVVPFLISVVLVPSS--LAVTYIASFAAGVSVAAAFLLPWSMLPDVVDDFKVQNPESQGHEAIFYSFYVFFTKFASGVSLGVSTLSLDFAGYVTRGCTQPGEVKLTLKILVSAAPIVLIIIGLLIFISYPINEEKRQGNRKLLNEQR 507          
BLAST of Major facilitator superfamily domain containing protein vs. UniProt/SwissProt
Match: sp|Q0IHM1|NLS1_XENTR (Sodium-dependent lysophosphatidylcholine symporter 1 OS=Xenopus tropicalis OX=8364 GN=mfsd2a PE=2 SV=1)

HSP 1 Score: 296.975 bits (759), Expect = 1.813e-91
Identity = 169/488 (34.63%), Postives = 270/488 (55.33%), Query Frame = 1
Query:  190 KRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQPVTANITDS-MRNTE------------------KNDYIIASAAVCVIFIACSISVLLGTKE----LEILKDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIEN--GCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIEN 1575
            K ++ VC K+ + +GG P Q+   A+GFFL IFLL+ A + P+Y S I    R WDAITDP++GF ++K++ T+ G+  PW+  +TP + +++ L ++VP     +S  I+Y       QT +T FHVPYS++ M ++    DRD  T  RM  E++G + G  + G +  R    N P   +I ++ + NT                   ++ Y+IA+  +C I++ C+I + LG +E     E+L D+   +   LK +M  KPY+ ++  F+F+SL   L++ N AL++T+T+   +     +LV++  +   VP   + L R+GKK   + G  ++IP L  +  +  N+ LA  Y   V    +V  A +LPWSMLPDVID ++++N      +  F+SFYVFF KFA GVSL IS ++L  AGY   A  Q   V+  L+  I  + +I  L+ ++    YPI E+KRK+    L+ +R  N
Sbjct:   30 KHKLSVCSKICFAIGGAPYQITGCALGFFLQIFLLDIAQVPPFYASIILFSGRVWDAITDPLVGFFVSKSSWTRLGRLLPWVVFSTPFAVVSYLLIWFVPGFSG-VSMVIWYLVFYCLFQTLVTCFHVPYSALTMFISKEQSDRDSATGYRMTVEVLGTVLGTAIQGQIVGRE---NTPCVEHIRETHLYNTSVIMEDLNITHDVESLSSTRDAYMIAAGVICAIYVLCAIILTLGVREKRDAYELLSDQPFSFWQGLKLVMSHKPYIKLITGFLFTSLAFMLLEGNFALFLTYTMGFRRDFQNILLVVMLSATLTVPFWQWFLTRFGKKTAVYFGISSVIPFLILVVLMESNLILA--YVVAVAAGLSVAAAFLLPWSMLPDVIDDFILKNPDSHGHEPIFFSFYVFFTKFASGVSLGISTLSLDFAGYQTRACSQPEQVNLTLKMLICVAPVILILLGLLLFILYPINEEKRKQNKKALQLIRESN 511          
BLAST of Major facilitator superfamily domain containing protein vs. UniProt/SwissProt
Match: sp|Q9DA75|NLS1_MOUSE (Sodium-dependent lysophosphatidylcholine symporter 1 OS=Mus musculus OX=10090 GN=Mfsd2a PE=1 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 8.996e-83
Identity = 164/508 (32.28%), Postives = 282/508 (55.51%), Query Frame = 1
Query:  133 SIFRKNDKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSK---FIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATR---------------NRIANQPVTANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEILKDKEE----PYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIE--NGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIENYS 1581
            SI + +++  ++ K  P  K+++ +C KL Y +GG P Q+   A+GFFL I+LL+ A + P   S I  + RAWDA TDP++GF I+K++ T+ G+  PWI  +TPL+ +A+FL ++VP+  +       F++Y       +T +T FHVPYS++ M +++   +RD  T+ RM  E++G + G  + G +  +               + +AN+      T S+++T+ N Y++A+  +  I++ C+  ++LG +E   L + ++    P+   L+ +M   PY+ ++  F+F+SL   LV+ N AL+ T+TL+        +L ++  +   +P+  + L R+GKK   + G  + +P L  +A + +N  L V Y   V    +V  A +LPWSMLPDVID + ++  +    +  F+SFYVFF KFA GVSL +S ++L  A Y +    Q   V   L+  +  + II  L+ ++    YPI E+KR++    L+ +R E  S
Sbjct:   19 SILQASER-PVQVKKEPKKKQQLSICNKLCYAVGGAPYQLTGCALGFFLQIYLLDVAKVEPLPASIILFVGRAWDAFTDPLVGFCISKSSWTRLGRLMPWIIFSTPLAIIAYFLIWFVPDFPSGTESSHGFLWYLLFYCLFETLVTCFHVPYSALTMFISTEQSERDSATAYRMTVEVLGTVIGTAIQGQIVGQAKAPCLQDQNGSVVVSEVANR---TQSTASLKDTQ-NAYLLAAGIIASIYVLCAFILILGVREQRELYESQQAESMPFFQGLRLVMGHGPYVKLIAGFLFTSLAFMLVEGNFALFCTYTLDFRNEFQNLLLAIMLSATFTIPIWQWFLTRFGKKTAVYIGISSAVPFLILVALMERN--LIVTYVVAVAAGVSVAAAFLLPWSMLPDVIDDFHLKHPHSPGTEPIFFSFYVFFTKFASGVSLGVSTLSLDFANYQRQGCSQPEQVKFTLKMLVTMAPIILILLGLLLFKLYPIDEEKRRQNKKALQALREEASS 519          
BLAST of Major facilitator superfamily domain containing protein vs. UniProt/SwissProt
Match: sp|Q5U3U7|NLS1A_DANRE (Sodium-dependent lysophosphatidylcholine symporter 1-A OS=Danio rerio OX=7955 GN=mfsd2aa PE=2 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 7.125e-82
Identity = 157/498 (31.53%), Postives = 264/498 (53.01%), Query Frame = 1
Query:  124 PIKSIFRKNDKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLA--------------------TRNRIANQPVTANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKEL----EILKDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENGCRM--DATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRK 1536
            P      +N+ + ++       KR + V  K+ + +GG P Q+   A+GFFL IFLL+ A +NP   S I  + RAWDA+TDP +GF++++T  T+ G+  PWI ++T  + L +FL + VP  +    K ++Y       QT  T FHVPYS++ M +++  R+RD  T+ RM  E+ G + G  + G +                      ++  ++ P+ +NI D     E+  Y+IASA + +I++ C+  +  G +E     E+   K   +   L+ +M   PY+ ++ AF+F+SL   L++ N A++I +TL   +     +LV++  +   +P+  + L R+GKK   + G    +P +  +  +  N  L V Y   +    +V  A +LPWSMLPDV+D + ++N      +A FYSFYVFF KFA GVSL +S +AL  AGY+     Q+ SV+  L+  +  + +    + ++    YPI E++R+
Sbjct:   16 PTAKSVTQNEIKMVKLPKQQERKRALTVWSKVCFAIGGAPYQITGTALGFFLQIFLLDVAQLNPLNASVILFVGRAWDAVTDPTVGFLVSRTPWTRHGRMMPWILVSTIPAVLCYFLIWVVPPIEQ--GKMMWYLLFYCLFQTLQTCFHVPYSALTMFISTEQRERDSATAYRMTVEVFGTVVGTAIQGQIVGMANTPCKNNTSPNNSSNDLIQSNNSHIPLKSNIFD-----ERCAYMIASAVISLIYVVCAAVLFFGVREQDVQGELKAQKRVSFQKGLRLVMGHGPYVKLVLAFLFTSLAFMLLEGNFAVFIKYTLGFREDFQNILLVIMVSATVSIPMWQWFLCRFGKKTAVYIGITWAVPFM--ILVVSVNSSLIVSYIVSIAAGVSVGAAFLLPWSMLPDVVDDFKLQNPTSQGHEAIFYSFYVFFTKFASGVSLGVSTLALSFAGYETGVCVQSDSVNLTLKLLVSAAPVSLIALGLLIFMTYPIDEERRE 504          
BLAST of Major facilitator superfamily domain containing protein vs. UniProt/SwissProt
Match: sp|Q8NA29|NLS1_HUMAN (Sodium-dependent lysophosphatidylcholine symporter 1 OS=Homo sapiens OX=9606 GN=MFSD2A PE=1 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 7.006e-81
Identity = 165/517 (31.91%), Postives = 272/517 (52.61%), Query Frame = 1
Query:  133 SIFRKNDKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETAS-------------INPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKF--IFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATR-----------NRIANQPVT-ANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKE----LEILKDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENGC--RMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIENYS 1581
            SI +  ++     K     K+++ VC KL Y +GG P Q+   A+GFFL I+LL+ A              + P+  S I  + RAWDAITDP++G  I+K+  T  G+  PWI  +TPL+ +A+FL ++VP+  +  + +  +FYC      +T +T FHVPYS++ M +++   +RD  T+ RM  E++G + G  + G +  +           + +A+Q     + T S R T+K  Y++A+  +  I+I C++ ++LG +E     E  + +   Y   L+ +M   PY+ ++  F+F+SL   LV+ N  L+ T+TL         +L ++  +   +P+  + L R+GKK   + G  + +P L  +A +  N  L + Y   V    +V  A +LPWSMLPDVID + ++       +  F+SFYVFF KFA GVSL IS ++L  AGY      Q   V   L   +  + I+  L+ ++    YPI E++R++    L+ +R E  S
Sbjct:   19 SILQSTERPAQVKKEPKKKKQQLSVCNKLCYALGGAPYQVTGCALGFFLQIYLLDVAQKDEEVVFCFSSFQVGPFSASIILFVGRAWDAITDPLVGLCISKSPWTCLGRLMPWIIFSTPLAVIAYFLIWFVPDFPHGQTYWYLLFYCL----FETMVTCFHVPYSALTMFISTEQTERDSATAYRMTVEVLGTVLGTAIQGQIVGQADTPCFQDLNSSTVASQSANHTHGTTSHRETQKA-YLLAAGVIVCIYIICAVILILGVREQREPYEAQQSEPIAYFRGLRLVMSHGPYIKLITGFLFTSLAFMLVEGNFVLFCTYTLGFRNEFQNLLLAIMLSATLTIPIWQWFLTRFGKKTAVYVGISSAVPFLILVALMESN--LIITYAVAVAAGISVAAAFLLPWSMLPDVIDDFHLKQPHFHGTEPIFFSFYVFFTKFASGVSLGISTLSLDFAGYQTRGCSQPERVKFTLNMLVTMAPIVLILLGLLLFKMYPIDEERRRQNKKALQALRDEASS 528          
BLAST of Major facilitator superfamily domain containing protein vs. TrEMBL
Match: A0A0X3NPM6 (Sodium-dependent lysophosphatidylcholine symporter 1-B OS=Schistocephalus solidus OX=70667 GN=NLS1B PE=4 SV=1)

HSP 1 Score: 408.297 bits (1048), Expect = 2.763e-131
Identity = 212/499 (42.48%), Postives = 292/499 (58.52%), Query Frame = 1
Query:  166 ESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTNTKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQPVTANI-----------------------------TDS-------MRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEILKDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKL 1554
              +P P++       RKLAY  GG PMQ+  N + FFLP+FLLETA I PYYLSAIQ  AR  DA+TDP +GF++ +T T+ G  +PWI  +TP+S + FFL FY     ++  KF+FY   +V +Q GLT+FHVPYSSM +VL+    +RD LT+ RM  E+  VL G  VFG +    R+ N  +  +                              TD+           E N Y++ + A CVIFI  S+   LGTKE E  ++    +   ++KI+ ++PYL +M AF+F SLGIQ VQ NL+LYITH+L +  ++ PGI+ LL  + AL+P+  FL+ R GKK     G +NM PIL   A LP +  L  F+  M W  FT+ +  +LPWSMLPDVID + +E+  R +A FYS YVFFNKFAVG+SL  SA  LG+ GYDK    Q  SV   LRY  G   ++ F+++++ LYFYP++  +  E+  K+
Sbjct:   43 SDEPLPLW-------RKLAYAAGGLPMQLTQNIISFFLPLFLLETAKITPYYLSAIQFAARVSDALTDPFVGFLVLRTKTRMGSKRPWIIFSTPVSVICFFLLFYTVPWHSEFGKFLFYMACVVVLQVGLTSFHVPYSSMVIVLSDVPEERDTLTAYRMFSEVAAVLLGVAVFGLIVAPYRVVNSCMDGDSVNRTVVAILTNATTPTTTTAATAAASSIGTDTNPQLHSFAAQMEINAYMVGAGATCVIFIIASLICFLGTKEKETFEEPLTAFFGVVRKILTYRPYLLLMGAFLFMSLGIQFVQGNLSLYITHSLKLSNYMIPGIMTLLATAIALLPVAQFLISRIGKKWTLAVGMLNMFPILLVSALLPIHPPLWAFFPVMAWAGFTIAIGFLLPWSMLPDVIDAFSLEHNMRQEAVFYSLYVFFNKFAVGLSLAFSAFVLGIVGYDKEKCSQPASVGLALRYLCGPGPVVFFVLALICLYFYPLSNARLSELRSKI 534          
BLAST of Major facilitator superfamily domain containing protein vs. TrEMBL
Match: A0A267E5S9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014320g2 PE=4 SV=1)

HSP 1 Score: 379.022 bits (972), Expect = 2.085e-120
Identity = 188/478 (39.33%), Postives = 295/478 (61.72%), Query Frame = 1
Query:  145 KNDKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTNTKFGKYKPWISLATPLSCLAFFLQFYV--PNT-DNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQPVTANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEILKD-KEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKN--ARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEE 1560
              D  + ++KP       + + RK  +G+  PP+QM SN +GFF  IF+LE A + PY++S I  + RAWDA+TDP+ G +++KTNT+ GK +PW+ +A P+ C  FF+ + V  P T D   +KF +Y    +   T +T +HVPY+S  M++     D+D  T+ RM+FE++G + G G+FG + +  RIA    ++         E++ Y+I +A +  IF  C ++   G KE    K   ++ +  N+K ++ F+PY+ +MFAF+F SL +Q+VQ+NLALY TH+L +  H + GIL +L  +   +PL + +++ +GKK IF  G +  IP L     +P++V  A FY  M  + F + ++++LPWSMLPDVID Y +++G R +ATFYS YVFFNKFAVG S+  S I + L GYD +  A +Q+Y V   LRY +G   I+C L S+  +Y YPI ++ R+E++++L +
Sbjct:    2 STDDAEADTKP------ELSLLRKFLFGLAAPPLQMSSNVVGFFFNIFMLEVAKVPPYFVSVILFVGRAWDAVTDPMAGHLVSKTNTRLGKTRPWMMIANPIGCAMFFILWIVLFPVTEDYNGAKFAYYLVVYLLYCTLITCYHVPYTSSTMLIARQSTDKDAATAFRMSFELLGTIVGVGLFGIIISTKRIAASCGSSREGQITVEEERSVYMIGAAVIVGIFFLCGLAGSFGIKEKYAEKQVSDDSFFSNVKAVLTFRPYVLLMFAFLFMSLAVQMVQTNLALYTTHSLGLGDHTSYGILCVLGIAILAIPLWNRMIQIFGKKNIFAVGVVMFIPCLLCAMLVPRDVVWA-FYLVMSVSGFAISISMLLPWSMLPDVIDDYFLKHGTRREATFYSLYVFFNKFAVGFSMAASQITMSLVGYDSSPEACEQSYEVGLALRYLVGPGPIVCLLASLSLIYTYPIDKQYRQELSVRLSQ 472          
BLAST of Major facilitator superfamily domain containing protein vs. TrEMBL
Match: A0A267EY15 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014320g1 PE=4 SV=1)

HSP 1 Score: 377.481 bits (968), Expect = 9.271e-120
Identity = 188/478 (39.33%), Postives = 294/478 (61.51%), Query Frame = 1
Query:  145 KNDKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTNTKFGKYKPWISLATPLSCLAFFLQFYV--PNT-DNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQPVTANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEILKD-KEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKN--ARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEE 1560
              D  + ++KP       + + RK  +G+  PP+QM SN +GFF  IF+LE A + PY++S I  + RAWDA+TDP+ G +++KTNT+ GK +PW+ +A P+ C  FF+ + V  P T D   +KF +Y    +   T +T +HVPY+S  M++     D+D  T+ RM+FE++G + G G+FG + +  RIA    ++         E+  Y+I +A +  IF  C ++   G KE    K   ++ +  N+K ++ F+PY+ +MFAF+F SL +Q+VQ+NLALY TH+L +  H + GIL +L  +   +PL + +++ +GKK IF  G +  IP L     +P++V  A FY  M  + F + ++++LPWSMLPDVID Y +++G R +ATFYS YVFFNKFAVG S+  S I + L GYD +  A +Q+Y V   LRY +G   I+C L S+  +Y YPI ++ R+E++++L +
Sbjct:    2 STDVAEADTKP------ELSLLRKFLFGLAAPPLQMSSNVVGFFFNIFMLEVAKVPPYFVSVILFVGRAWDAVTDPMAGHLVSKTNTRLGKTRPWMMIANPIGCAMFFILWIVLFPVTEDYNGAKFAYYLVVYLLYCTLITCYHVPYTSSTMLIARQSSDKDAATAFRMSFELLGTIVGVGLFGIIISTKRIAASCGSSREGQITVEEERAVYMIGAAVIVGIFFLCGLAGSFGIKEKYAEKQVSDDSFFTNVKAVLTFRPYVLLMFAFLFMSLAVQMVQTNLALYTTHSLGLGDHTSYGILCVLGIAILAIPLWNRMIQIFGKKNIFAVGVVMFIPCLLCAMLVPRDVVWA-FYLVMSVSGFAISISMLLPWSMLPDVIDDYFLKHGTRREATFYSLYVFFNKFAVGFSMAASQITMSLVGYDSSPEACEQSYEVGLALRYLVGPGPIVCLLASLSLIYTYPIDKQYRQELSVRLSQ 472          
BLAST of Major facilitator superfamily domain containing protein vs. TrEMBL
Match: A0A068YN46 (Major facilitator superfamily domain containing protein OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001129800 PE=4 SV=1)

HSP 1 Score: 372.089 bits (954), Expect = 1.748e-117
Identity = 211/527 (40.04%), Postives = 302/527 (57.31%), Query Frame = 1
Query:   94 KSKMTIFNTCPIKSIFRKNDKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTNTKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIA---------NQPVTANITD-----------SMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEI----------------LKDKEEPY--LPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYD--KNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKL 1554
            K ++T  NT    S+F  +D E   SKP P++       RKLA+  GG PMQM+ N + FFLP+FLLET ++ P +LS + + AR  DA+TDP++G ++ KT ++FG+ +PWI  +TP+   +FF  FY  +     +K  FY   IV +Q GLTAFH+PYSS+ MVLT    +RD LT+ RM  E++ +LFG  VFG++    R+          N    AN T+             R  E   Y+IA++  CVI    S+    GT+E  I                  +   P      ++K++ + PYLY+M AF+F SLGIQ +Q N+AL+ITH+L++  ++ PGIL LL  +  LVPL   LLRR GKK     G +N+IP+L  L F+ +   L +F+  M+W S T+ VA++LPWSMLPDVID + ++   R+++ FYS  VFFNKFAVG+SL +SA  L L GYD   N   Q   V   LR     + I   + ++VFLY+YP+  ++ +EM  KL
Sbjct:   14 KVEVTASNT----SVFCSSDGEPTISKPMPLW-------RKLAFASGGLPMQMMQNVISFFLPLFLLETVNLIPSFLSVVLLAARISDAVTDPLVGLLVLKTKSRFGQKRPWILFSTPVFVTSFFALFYAVHWPAP-AKLCFYLVAIVVLQFGLTAFHIPYSSLTMVLTHIPEERDLLTAFRMFSEVLAILFGVAVFGAIIAPYRVVSSCENSLFTNGTTVANFTEVTAISQPFVHPDARRREAWAYMIAASVTCVICTVASLICFFGTRETAINFTDTSADDVGAGDGDGGNATTPVGIFTAVRKVLTYPPYLYLMGAFLFLSLGIQFLQGNIALFITHSLHMSNYLIPGILCLLGFTILLVPLAQVLLRRLGKKTTMALGIVNVIPLLVLLNFISERPSLWIFFGMMIWASVTIAVAMLLPWSMLPDVIDAFQLQYSMRLESVFYSLIVFFNKFAVGISLAMSAGILELVGYDSSSNVCHQPPEVGKTLRLLSSVAPIGFLIPALVFLYYYPLGNQELEEMRSKL 528          
BLAST of Major facilitator superfamily domain containing protein vs. TrEMBL
Match: A0A068WSK7 (Major facilitator superfamily domain containing protein OS=Echinococcus granulosus OX=6210 GN=EgrG_001129800 PE=4 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 2.100e-116
Identity = 210/527 (39.85%), Postives = 302/527 (57.31%), Query Frame = 1
Query:   94 KSKMTIFNTCPIKSIFRKNDKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTNTKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRI---------ANQPVTANITD-----------SMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEI-LKDKEEPY-----------------LPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYD--KNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKL 1554
            K ++T  NT    S+   +D E   SKP P++       RKLA+  GG PMQM+ N + FFLP+FLLET ++ P +LS + + AR  DA+TDP++G ++ KT ++FG+ +PWI  +TP+   +FF  FY  +     +K  FY   IV +Q GLTAFH+PYSS+ MVLT    +RD LT+ RM  E++ +LFG  VFG++    R+          N    AN T+             +  E   Y++A++  CVI    S+    GT+E  I L D                         ++K++ + PYLY+M AF+F SLGIQ +Q N+AL+ITH+L++  ++ PGIL LL  +  LVPL   LLRR GKK     G +N+IP+L  L F+ +   L +F+  M+W S T+ VA++LPWSMLPDVID + ++   R+++ FYS  VFFNKFAVG+SL +SA  L L GYD   NA  Q   V   LR     + I   + ++VFLY+YP+  ++ +EM  KL
Sbjct:   14 KVEVTASNT----SVLCSSDGEPTISKPMPLW-------RKLAFASGGLPMQMMQNVISFFLPLFLLETVNLIPSFLSVVLLAARISDAVTDPLVGLLVLKTKSRFGQKRPWILFSTPVFVASFFALFYAVHWPAP-AKLCFYLVAIVVLQFGLTAFHIPYSSLTMVLTHVPEERDLLTAFRMFSEVLAILFGVAVFGAIIAPYRVVSSCENSLFTNGTTVANFTEVTAISQPFVHPDAKRREAWAYMLAASVTCVICTVASLICFFGTRETGINLADTTADDVGAGDGDGGNATTPVGIFTAVRKVLTYPPYLYLMGAFLFLSLGIQFLQGNIALFITHSLHMSNYLIPGILCLLGFTILLVPLAQVLLRRLGKKTTMALGIVNVIPLLVLLNFISERPSLWIFFGMMIWASVTIAVAMLLPWSMLPDVIDAFQLQYSMRLESVFYSLIVFFNKFAVGISLAMSAGILELVGYDSSSNACHQPPEVGKTLRLLSSVAPIGFLIPALVFLYYYPLGNRELEEMRSKL 528          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Cavefish
Match: mfsd2b (major facilitator superfamily domain-containing protein 2B [Source:NCBI gene;Acc:103027014])

HSP 1 Score: 299.286 bits (765), Expect = 7.265e-93
Identity = 170/523 (32.50%), Postives = 284/523 (54.30%), Query Frame = 1
Query:  136 IFRKNDKEKIESKPTPIY-KRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQPVTANITDS-MRNTE------------------KNDYIIASAAVCVIFIACSISVLLGTKELEILKDKEEPYLPNLKK----------IMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIEN--GCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIENYSFISYHEDI 1605
            + +K+ +      P   + ++++ VC KL + +GG P Q+  +A  FFL I+LL+ A INP+  S +  I +AW A++DPI+GF + K+  TK G+  PW+   TP   +++F  ++VP   N   +FI+Y       QT +T FHVPYS++ M L+++ R+RD  T+ RM  E++G L GA + G +             N++   + N+                   K  Y+IA+  +  +F+ C++ ++LG KE      +++PY P  +K          +M+  PYL +  AF+F S+ IQLVQSN  L+ T+ +++  H    +L +L  +   +P   + L+R+GKK   F G   ++P    L F+P   +L V Y   V +  +V  +++LPWSMLPDV+D + + N      +A FYSFYVFF KFA G+SL +S + L  AGYD  A +Q ++V+  L+  IG + +   +  ++ L  YPI+E  R++  + L+++R +  +     ED+
Sbjct:   42 LMKKHPEPAFTKVPVQTHLEQKLSVCSKLCFAIGGAPNQVAGSATAFFLQIYLLDVAQINPFQASMVLFIGKAWGAVSDPIVGFFVTKSRWTKIGRLMPWMVGCTPFVVVSYFYLWFVPPFTN--GRFIWYLGFYCLYQTLITCFHVPYSALTMFLSTDQRERDSATAYRMTMEVLGTLIGAAIQGQIVASAHTLKHCHHHNVSSGHLGNSSGAEVIRSLALSQDFLSHAKEVYMIAAGVIGGLFLICTVVMVLGVKE------RDDPYAPKTEKPIPFHEGFVLVMKHGPYLILTAAFLFISVAIQLVQSNFVLFCTYAVDLRDHFQNIVLTILMSAAVSIPFWQWFLQRFGKKTAAFCGITWIMPFTVMLVFIP---NLVVAYVVAVSSGLSVAASLLLPWSMLPDVVDDFRLANPNSKGHEAIFYSFYVFFTKFAAGISLGVSTLCLEFAGYDTGACRQPHAVAYTLKLLIGAAPVAFIITGLMILLLYPISEDVRRQNKLALDQLRNQTINCRPIREDL 553          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Cavefish
Match: mfsd2ab (major facilitator superfamily domain containing 2A [Source:NCBI gene;Acc:103026100])

HSP 1 Score: 293.893 bits (751), Expect = 3.038e-91
Identity = 167/500 (33.40%), Postives = 268/500 (53.60%), Query Frame = 1
Query:  133 SIFRKNDKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQPVTANITD----------------SMRNTEKNDYIIASAAVCVIFIACSISVLLGTKEL-EILKDKEEP--YLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIEN--GCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMR 1566
            S+  K+  +++++        R+ VC KL Y +GG P Q+   A+GFFL I+LL+ A ++P+Y S I  + RAWDAITDP +GF+++++  T+FGK  PWI+L+TPL+ + +FL +YVP  +    K I+Y       Q+  T FHVPYS++ M ++S  ++RD  T+ RM  E++G + G G+ G +         PV  +                   S+ +T K  Y+IAS  +C +++ C+I +  G KE  +  + + EP  +   ++ +M   PY  ++  F+F+SL   L++ N AL+  +TL         +LV++  +   +P   + L R+GKK   + G  + IP +     +  N  L V Y        ++  A +LPWSMLPDV+D + ++N      +A FYSFYVFF KFA GVSL IS ++L  AGY      Q   V   L+  +  + II  ++ ++    YPI E++R+     L E R
Sbjct:   14 SLLNKSKSDEVKAVEKRERGGRLSVCSKLCYAIGGAPYQITGCALGFFLQIYLLDVAQVDPFYASIILFVGRAWDAITDPTVGFLVSRSPWTRFGKMMPWIALSTPLAVVCYFLIWYVPPVET--GKIIWYLVFYCLFQSLQTCFHVPYSALTMFISSEQKERDSATAYRMTVEVLGTVIGTGIQGQIVGMASAPCIPVGGDFNSTGQEFGPEVNISQPHISLEHT-KQAYMIASGVICAMYVLCAIILFFGVKERKDTCRVRTEPMSFFQGIRMVMGHGPYAKLVMGFLFTSLAFMLLEGNFALFCCYTLGFRDDFQNILLVIMLSATLTIPFWQWFLTRFGKKTAVYVGTTSAIPFMIVCVLVKSN--LIVTYVISFAAGVSIAAAFLLPWSMLPDVVDDFKVQNPDSQGHEAIFYSFYVFFTKFASGVSLGISTLSLDFAGYITRGCTQPVEVDITLKVLVSAAPIILIIVGLIIFITYPINEERRQGNRKLLNEQR 508          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Cavefish
Match: mfsd2aa (sodium-dependent lysophosphatidylcholine symporter 1-B-like [Source:NCBI gene;Acc:103028962])

HSP 1 Score: 290.812 bits (743), Expect = 5.222e-90
Identity = 164/494 (33.20%), Postives = 269/494 (54.45%), Query Frame = 1
Query:  151 DKEKIESKPTPIYKRR-MHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSL--ATRNRIANQPV----------TANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEIL---KDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIE--NGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIEN 1575
            +KE +++  TP  K+  + +C KL Y +GG P Q+  +A+GFFL ++LL+ A ++P+Y S I  + R WDAITDP +GF+++++  T+ G+  PWI L+TPL+ +++FL + VP  +    K ++Y       Q+  T FHVPYS++ M ++S  ++RD  T+ RM  E++G + G  + G +      +  N               N +D   +  K  Y+IAS  +  I+I C+I + LG +E + +   K ++  +L  L+ + R  PY+ ++  F+F+SL   L++ N AL+IT+TL         +LV++      +PL    L R+GKK   + G    IP +     L  N+ L+  Y        +V  A +LPWSMLPDV+D + +   N    +A FYSFYVFF KFA GVSL +S + L  AGY      Q  SV   L+  +  + +   ++ ++    YPI EK+R++   +L+ +  +N
Sbjct:   22 NKEGLKTNKTPKEKKECLSICSKLCYAIGGAPYQITGSALGFFLQMYLLDVAQLDPFYASIILFVGRIWDAITDPTVGFLVSRSPWTRRGRMMPWIVLSTPLAVISYFLIWVVPPFEK--GKVVWYLIFYCLFQSMQTCFHVPYSALTMFISSEQKERDSATAYRMTIEVLGTVVGTAIQGQIVGGANAQCINHTTYLNGSNIHNPNGNASDISLDDTKQAYMIASGVISAIYILCAIVLFLGVREQKDVAGPKAEQLTFLEGLQLLQRHGPYVKLVMGFLFTSLAFMLMEGNFALFITYTLGFRDDFQNILLVIMLSGSLTIPLWQMFLTRFGKKTAVYIGISWAIPFMIIAVCLKSNLILS--YVVAFAAGISVAAAFLLPWSMLPDVVDDFKVNNPNSQGHEAIFYSFYVFFTKFASGVSLGVSTLCLHFAGYVARGCNQPDSVHLTLKLLVSAAPVSLIILGLIIFKTYPINEKRRQKNWRQLQALLQDN 511          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Cavefish
Match: mfsd2aa (sodium-dependent lysophosphatidylcholine symporter 1-B-like [Source:NCBI gene;Acc:103028962])

HSP 1 Score: 285.034 bits (728), Expect = 7.483e-88
Identity = 162/488 (33.20%), Postives = 264/488 (54.10%), Query Frame = 1
Query:  169 SKPTPIYKRR-MHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSL--ATRNRIANQPV----------TANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEIL---KDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIE--NGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIEN 1575
            +  TP  K+  + +C KL Y +GG P Q+  +A+GFFL ++LL+ A ++P+Y S I  + R WDAITDP +GF+++++  T+ G+  PWI L+TPL+ +++FL + VP  +    K ++Y       Q+  T FHVPYS++ M ++S  ++RD  T+ RM  E++G + G  + G +      +  N               N +D   +  K  Y+IAS  +  I+I C+I + LG +E + +   K ++  +L  L+ + R  PY+ ++  F+F+SL   L++ N AL+IT+TL         +LV++      +PL    L R+GKK   + G    IP +     L  N+ L+  Y        +V  A +LPWSMLPDV+D + +   N    +A FYSFYVFF KFA GVSL +S + L  AGY      Q  SV   L+  +  + +   ++ ++    YPI EK+R++   +L+ +  +N
Sbjct:   18 TDQTPKEKKECLSICSKLCYAIGGAPYQITGSALGFFLQMYLLDVAQLDPFYASIILFVGRIWDAITDPTVGFLVSRSPWTRRGRMMPWIVLSTPLAVISYFLIWVVPPFEK--GKVVWYLIFYCLFQSMQTCFHVPYSALTMFISSEQKERDSATAYRMTIEVLGTVVGTAIQGQIVGGANAQCINHTTYLNGSNIHNPNGNASDISLDDTKQAYMIASGVISAIYILCAIVLFLGVREQKDVAGPKAEQLTFLEGLQLLQRHGPYVKLVMGFLFTSLAFMLMEGNFALFITYTLGFRDDFQNILLVIMLSGSLTIPLWQMFLTRFGKKTAVYIGISWAIPFMIIAVCLKSNLILS--YVVAFAAGISVAAAFLLPWSMLPDVVDDFKVNNPNSQGHEAIFYSFYVFFTKFASGVSLGVSTLCLHFAGYVARGCNQPDSVHLTLKLLVSAAPVSLIILGLIIFKTYPINEKRRQKNWRQLQALLQDN 501          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Cavefish
Match: mfsd2aa (sodium-dependent lysophosphatidylcholine symporter 1-B-like [Source:NCBI gene;Acc:103028962])

HSP 1 Score: 283.493 bits (724), Expect = 9.651e-88
Identity = 161/484 (33.26%), Postives = 263/484 (54.34%), Query Frame = 1
Query:  169 SKPTPIYKRR-MHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSL--ATRNRIANQPV----------TANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEIL---KDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIE--NGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEM 1563
            ++ TP  K+  + +C KL Y +GG P Q+  +A+GFFL ++LL+ A ++P+Y S I  + R WDAITDP +GF+++++  T+ G+  PWI L+TPL+ +++FL + VP  +    K ++Y       Q+  T FHVPYS++ M ++S  ++RD  T+ RM  E++G + G  + G +      +  N               N +D   +  K  Y+IAS  +  I+I C+I + LG +E + +   K ++  +L  L+ + R  PY+ ++  F+F+SL   L++ N AL+IT+TL         +LV++      +PL    L R+GKK   + G    IP +     L  N+ L+  Y        +V  A +LPWSMLPDV+D + +   N    +A FYSFYVFF KFA GVSL +S + L  AGY      Q  SV   L+  +  + +   ++ ++    YPI EK+R++   +L+ +
Sbjct:    4 TETTPKEKKECLSICSKLCYAIGGAPYQITGSALGFFLQMYLLDVAQLDPFYASIILFVGRIWDAITDPTVGFLVSRSPWTRRGRMMPWIVLSTPLAVISYFLIWVVPPFEK--GKVVWYLIFYCLFQSMQTCFHVPYSALTMFISSEQKERDSATAYRMTIEVLGTVVGTAIQGQIVGGANAQCINHTTYLNGSNIHNPNGNASDISLDDTKQAYMIASGVISAIYILCAIVLFLGVREQKDVAGPKAEQLTFLEGLQLLQRHGPYVKLVMGFLFTSLAFMLMEGNFALFITYTLGFRDDFQNILLVIMLSGSLTIPLWQMFLTRFGKKTAVYIGISWAIPFMIIAVCLKSNLILS--YVVAFAAGISVAAAFLLPWSMLPDVVDDFKVNNPNSQGHEAIFYSFYVFFTKFASGVSLGVSTLCLHFAGYVARGCNQPDSVHLTLKLLVSAAPVSLIILGLIIFKTYPINEKRRQKNWRQLQAL 483          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006057.1 (pep scaffold:Pmarinus_7.0:GL483004:1981:7987:1 gene:ENSPMAG00000005466.1 transcript:ENSPMAT00000006057.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.701 bits (291), Expect = 4.788e-30
Identity = 71/209 (33.97%), Postives = 112/209 (53.59%), Query Frame = 1
Query:  886 NLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENG--CRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLY 1506
             +++I  ++PYL +M  ++ +S+ +QLVQ NLAL+  H L +       ++ +L  +   +P+  ++L+R  KK +   G +  IP L T+   P +  LA  +     +  TV  A  LPWSMLPD I  +   +G     +A FYSF+VFFNKFAVG +L IS + L  AGY     +Q  +V   L+  +  + II   + +  LY
Sbjct:   12 RMRRIFTYRPYLLLMGCYVSTSIALQLVQGNLALFFEHVLCMKGKFQIMVITVLVSAVLFLPVSQWMLKRIQKKNMIIFGMLWWIPFLITIVLAPSSDPLA--FVVCAASGITVATASFLPWSMLPDTITDFRQRHGDYPGQEALFYSFFVFFNKFAVGATLGISNLCLSFAGYVPRGVEQPKNVMLTLQVLMAPAPIILSFVGIAVLY 218          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Nematostella
Match: EDO26377 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TC62])

HSP 1 Score: 53.9138 bits (128), Expect = 3.255e-9
Identity = 28/87 (32.18%), Postives = 52/87 (59.77%), Query Frame = 1
Query:  286 FLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTNTKFGKYKPWISLATPLSCLAFFLQFYV-PNTDNQLSKFIFYCFTIVFV 543
            FLL    ++P+    +  + R +DAITDPIMG++ + TN+++G+ +P+I     +S L F + + + PN     + + F  F++VF+
Sbjct:    4 FLLTAFGMDPFLAGLLGGLPRIYDAITDPIMGYISDNTNSRWGRRRPYIFAGAIMSGLFFAILWQLDPNATQNYNFWYFLLFSLVFL 90          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Nematostella
Match: EDO41826 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3B7])

HSP 1 Score: 53.9138 bits (128), Expect = 1.124e-7
Identity = 77/333 (23.12%), Postives = 142/333 (42.64%), Query Frame = 1
Query:  214 KLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTNTKFGKYKPWISLATPLSCLAFFLQF--YVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQPVTANITDS-MRNTEKNDY--------------IIASAAV----CVIFIACSISVLLGTKELEILKDKEEPYL---PNLKKIMRFK-PYLYIM-FAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLG-HFLLRRYGKKKIFFAGNI 1131
            K ++G+G     + ++    +L I+L + A +   +   +  + +  DA+  P +G + ++T  ++G+ K W  L   L+ L+F L F   +PN      K  +Y       Q G     + + ++   ++    +R +L +IR A   I  ++  GV   L   +  + + +T N+    M     + Y              I+ S  V      +F     S  L   ELEI+ D+ E  L   P + K+   K P LYI+   +M + + + + QS L LY+T T+   K       +++  S  +  LG   L ++ G K  F  G++
Sbjct:    1 KASHGVGHILNDLAASVWFSYLIIYLTKVAGLPNRHTGLVLFLGQIADALFTPFVGILCDRTVCRYGRRKIWHLLGCILTSLSFPLIFIRILPNDATDTLKVCYYVGIAAVFQFGWGCVQISHLTLIPEISKKSSERVELNAIRSALTFICGIYVYGVTWILLGES--SEETLTPNVWKQFMVRCILDHYPTYPFSFENYLSFIIVGSGNVFNVIFHVFTKEPPSKALNL-ELEII-DRTEDSLHARPGMTKLQWLKNPNLYIVAMMYMSTRIVVNISQSYLPLYLTDTMKFNKEAIAYFPLVVLTSGVVASLGVKPLNKKLGNKMTFVLGSL 329          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Medaka
Match: mfsd2ab (major facilitator superfamily domain containing 2A [Source:NCBI gene;Acc:101167054])

HSP 1 Score: 299.671 bits (766), Expect = 2.242e-93
Identity = 173/499 (34.67%), Postives = 276/499 (55.31%), Query Frame = 1
Query:  130 KSIFRKNDKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATR------NRIANQPVTANITDSMRNTEKN--------DYIIASAAVCVIFIACSISVLLGTKEL-EILKDKEEP--YLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIEN--GCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMR 1566
            K +   +D  K+ +K     ++++ VC K+ YG+GG P Q+   A+GFFL ++LL+ A ++P   S I  + RAWDA+TDP +GF+++++  T+FG+  PWI L+TPL+ L++FL +YVP  +N   K  +Y F     Q   T FHVPYS++ M ++S+ ++RD  T+ RM  E++G L G  V G +         +  A+     N++ S+  TE           Y+IASA +  I+I C++ +  G KE  E  + + EP  +   +K +M + PY  ++  F+F+SL   L++ N AL+ ++TL         +LV++  +   +P   + L R+GKK   + G ++++P L  +  +  N  L V Y    +    V  A +LPWSMLPDV+D + + N      +A FYSFYVFF KFA GVSL +S ++L  AGY      Q  SV   L+  +    I+  +I +  LY YPI E +R +    L+E+R
Sbjct:   18 KGVGESSDVIKLPAKSE--CRKKLTVCNKICYGIGGAPYQITGCALGFFLQLYLLDIAQLDPSLASIILFVGRAWDAVTDPTVGFLVSRSPWTRFGRMMPWIMLSTPLAVLSYFLIWYVPPFEN--GKVFWYLFFYCTFQALQTCFHVPYSALTMFISSDQKERDSATAYRMTVEVLGTLIGTAVQGQIVGMFNAPCIHGPADMMSGMNVSLSLNQTEHTISLQHTRVAYMIASAVISSIYILCAVVLFFGVKEQKEAGRLQSEPLSFFQGIKLVMGYGPYAKLVMVFLFTSLAFMLLEGNFALFCSYTLGFRNDFQNVLLVIMLSATLTIPFWQWFLTRFGKKTAVYVGTLSVVPFLILVVCIKSN--LIVTYVVSFFAGVAVAAAFLLPWSMLPDVVDDFQVRNPESAGHEAIFYSFYVFFTKFASGVSLGVSTLSLDFAGYISRGCSQPSSVDLTLKILVSAGPIVFIIIGLGILYSYPIDEVRRTKNRKMLQELR 510          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Medaka
Match: ENSORLT00000021525.2 (sodium-dependent lysophosphatidylcholine symporter 1-B [Source:NCBI gene;Acc:101156211])

HSP 1 Score: 286.96 bits (733), Expect = 9.582e-89
Identity = 172/500 (34.40%), Postives = 277/500 (55.40%), Query Frame = 1
Query:  142 RKNDKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQ--LSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAG----VFGSLAT--------RNRIANQPVTANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKEL-EILKDKEEP--YLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENG--CRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIENYS 1581
            +K+  E ++ +     K ++ VC KL +  GG P Q+  +A+GFFL +FLL+ A ++P   S I    RAWDAITDP +GF+++ +  T+ G+  PWI  +TP + L +FL +YVP+ +    L   +FYC      Q+  T FHVPYS++ M +++   +RD  T+ RM  E++G + G      + GS++T          + +  P T N T +     K  Y+I+S  +C+I+I CS+ + LG KE  E +K K +P  +   LK ++   PY+ ++ AF+ ++LG  LV+ N +L++++ L   K     +LV++  +   +P   + L R+GKK   F GN+  IP +  +  +  N  LA+ Y   V    +V  + +LPWSMLPDV+D + + N      +A FYSFYVFF KFA G+SL IS + L  AGY      Q  SVS  L+  +    I   ++ ++ L  YPI E++R+  + K+ +  +E+ S
Sbjct:   20 QKDISETVKKQ-----KPQLSVCNKLCFAFGGAPYQITGSALGFFLQMFLLDVAQLDPLNASIILFAGRAWDAITDPTVGFLVSHSRWTRVGRMMPWILCSTPFAVLTYFLIWYVPHFEEGKVLWFLVFYC----LFQSMQTCFHVPYSALTMFISTKQEERDSATAYRMTVELLGSMLGTAIQGQIVGSVSTCPVDDDNDDYKNSTIPPTVNRTITSLEESKKAYMISSGVICIIYILCSVILFLGVKEQKECVKRKSKPLTFRQGLKLVVSHGPYVKLVSAFLCTTLGFLLVEGNFSLFLSYALGQRKDFQNILLVIMLSAGLTIPWWQWFLTRFGKKTAAFCGNLWAIPFIILIVSVKSN--LALSYVVSVAAGMSVGASFLLPWSMLPDVVDDFKVTNPNVHGHEAVFYSFYVFFIKFASGLSLGISTLCLKFAGYVTGNCFQPESVSTTLKVLVSAFPIALIIVGLLILRMYPIDEERRQSNS-KVLQASLESES 507          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Medaka
Match: ENSORLT00000021520.2 (sodium-dependent lysophosphatidylcholine symporter 1-B [Source:NCBI gene;Acc:101155975])

HSP 1 Score: 278.1 bits (710), Expect = 2.200e-85
Identity = 171/505 (33.86%), Postives = 272/505 (53.86%), Query Frame = 1
Query:  127 IKSIFRKNDKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVP--NTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAG----VFGSLAT--------RNRIANQPVTANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKEL-EILKDKEEP--YLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENG--CRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIENYS 1581
            ++++  + D    E K  P    ++ VC KL +  GG P Q+   A+GFFL IFLLE A ++P   S I    RAWD ITDP +GF+++ +  T+ G+  PWI  +TP + L +FL +YVP       L   +FYC      Q+  T FHVPYS++ M +++   +RD  T+ RM  E++G+L G      + GS++T          + +  P T N T +     K  ++I+S  +C+I+I CS+ + LG KE  E ++ + +P  +   LK ++   PY+ ++ AF+ ++LG  LV+ N ++++T+ L   K     +LV++      +P   + L R+GKK   F  N+  IP++  +  +  N  LA  Y   V    +V  +  LPWSMLPDV+D + + N      +A FYSFYVFF KFA G+SL IS + L  AGY      Q  SVS  L+  +    I   ++ ++ L  YPI E +R+  + K+ + R+++ S
Sbjct:   12 LQTVKPQKDISVKEKKQKP----QLSVCNKLCFAFGGAPYQITGCALGFFLQIFLLEVAQLDPLNASIILFAGRAWDGITDPTVGFLVSHSRWTRVGRMMPWILCSTPFAVLTYFLIWYVPPFEEGKVLWFLVFYC----LFQSMQTCFHVPYSALTMFISTKQEERDSATAYRMTVELLGILLGTAIQGQIVGSVSTCPVDDDNDDYKNSTIPPTVNRTITSLEESKKAHMISSGVICIIYILCSVILFLGVKEQKECVQGESKPLTFRQGLKLVVSHGPYVKLVSAFVCTTLGFLLVEGNFSIFLTYALGQRKDFQNILLVIMLSGTLTIPWWQWFLTRFGKKTAAFCSNLWAIPVIILIVSVKSN--LAFLYVVSVAAGVSVGASYFLPWSMLPDVLDDFKVTNPNVHGHEAVFYSFYVFFTKFASGLSLGISTLCLKFAGYVTGNCLQPESVSTTLKVLVSAFPIALIIVGLLILRMYPIDETRRQSNS-KVLQARLQSES 505          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Medaka
Match: mfsd2b (major facilitator superfamily domain-containing protein 2B [Source:NCBI gene;Acc:101174149])

HSP 1 Score: 275.404 bits (703), Expect = 2.909e-83
Identity = 160/503 (31.81%), Postives = 272/503 (54.08%), Query Frame = 1
Query:  175 PTPIYK----RRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSL-ATRNRIANQPV------------TANITDSMRNTE------KNDYIIASAAVCVIFIACSISVLLGTKELEILKDKEEPYLPNLKK----------IMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENG-CR-MDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIEN 1575
            P P ++    +++ +C KL + +GG P ++ ++A  FFL I+LL+ A IN +  S +  I + W A+ DP++GF I K+  TK G+  PW+   TP   +++   ++VP   +   +F++Y       QT +T FHVPYS++ M L+++ ++RD  T+ RM  E++G L GA + G + A+ + + + P              A + +S+   +      K  Y+IA+  +  +F+ C+  + LG KE      +++PY P  +K          +MR  PY  +  AF+F ++ +QL+QSN  L+ T+  ++  H    +L +L  +   +PL  + L R+GKK   F G   ++P    L F+P  V   V       +  +V  +++LPWSMLPDV+D + + N  C+  +A FYSFYVFF KFA G+SL +S + L  AGYD  A +Q   V   L+  +G + +   ++ ++ L  YPI+E  R+   + LEE+R ++
Sbjct:  101 PKPSHQTDLSQKLSICSKLCFAIGGAPKEVAASATAFFLQIYLLDVAQINAFQASMVLFIGKVWGAVNDPVVGFFITKSRWTKIGRLMPWMLGCTPFLVVSYVCLWFVPPFIS--GRFVWYLGFYCLYQTLITCFHVPYSALTMFLSTDQKERDSATAYRMTMEVLGTLLGAAIQGQIVASAHTLKHCPTHNVSAGYLGNSSGAEVVESVVRVQAYLSQAKELYMIAAGVIGGVFLICTFVMFLGVKE------RDDPYAPKTEKQIPFRQAFVLVMRHGPYFTLTAAFLFITVAVQLIQSNFVLFCTYAADLKDHFQNIVLTILVSAVVSIPLWQWFLERFGKKTAAFCGITWIMPFTMMLVFIPNVVVAYVVAVS---SGLSVAASLLLPWSMLPDVVDDFRLANPYCKGHEAIFYSFYVFFTKFAAGISLGVSTLCLEFAGYDTGACKQPAPVVYTLKLLMGATPVAFIIVGLLILLLYPISEDVRRRNKLCLEELRKQS 592          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Medaka
Match: zgc:171501 (sodium-dependent lysophosphatidylcholine symporter 1-B [Source:NCBI gene;Acc:101172657])

HSP 1 Score: 211.846 bits (538), Expect = 5.611e-60
Identity = 143/467 (30.62%), Postives = 237/467 (50.75%), Query Frame = 1
Query:  229 MGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN-TKFGKYKPWISLATPLSCLAFFLQFYVP-NTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSL-ATRNRIANQ---------PVTANITDSMRNTEKNDYIIASAAVC-VIFIACSISVLLGTKEL---EILKDKEEP-YLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIEN-GCR-MDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIE 1572
            MGG P QM + A+   L IFLL+   +   Y+S I  ++ AWDA+TDP++G++++++  T  GK  PW+ ++TP   L++ L + VP  + ++    +++       +  ++ ++VPY S+ M L +  +DRD  T+ RM+ E++ +L  + + G + A  N+   +         P + ++  S    E     + SA V   IF+ CS+ +  G +E       +DK  P YL ++K + R  PY  ++  F+FS    Q+   N AL+ +H   +  H    +LVLL  +   VP    +L + GKK   F G    IP +  +A +P N  L VF        F+V    +LPWSMLPDV+D +  ++  C+ ++  F+S Y F +K + G+S  +S + L +AGY   A      V   L        I   LI+MV  + YPI+EK+R +     EE+  E
Sbjct:    1 MGGVPYQMTTAALNISLQIFLLDVVQMKASYVSLILFVSHAWDAVTDPLVGYLVSRSKWTPVGKLTPWLLISTPFGVLSYVLLWSVPAGSMSEAGGVLWFLIATCLFEMSMSCYNVPYLSLSMFLGALKKDRDSATAYRMSVEMMAMLLASVIQGQVVAVYNKERQEACQLLDHKPPESTSVPQSASLQETQKAFLTSALVMGAIFLLCSLVLFFGVREQCDPVCSEDKIRPSYLSSVKMLTRHVPYQRLVLGFVFSVSAFQMSLGNFALFCSHAAGLGAHFQLLLLVLLLSASIAVPFWQVVLLKIGKKATLFIGLSLFIPAVIIVAVIPSN--LPVFINMCALMGFSVATMFLLPWSMLPDVVDDFASKHPTCKDLEPVFFSGYAFCSKLSGGLSAGLSTMTLQIAGYKAEACNHGDGVLTALIVLFSPVPIALLLIAMVIFHTYPISEKQRSQTE---EELHPE 462          
BLAST of Major facilitator superfamily domain containing protein vs. Planmine SMEST
Match: SMESG000018848.1 (SMESG000018848.1)

HSP 1 Score: 1221.45 bits (3159), Expect = 0.000e+0
Identity = 590/592 (99.66%), Postives = 590/592 (99.66%), Query Frame = 1
Query:  103 MTIFNTCPIKSIFRKNDKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTNTKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQPVTANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEILKDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIENYSFISYHEDIKFKKLYKFIVLNNNGHSDSLLRDNIEIRQNFNLCKMPMVSTYESELEIHCDKNEPTDCQLQNADLAAENVVKNSNPDNIEFLIGSNQNLRK 1878
            MTIFNTCPIKSIFRKNDKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTNTKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQP TANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEILKDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKN RQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIENYSFISYHEDIKFKKLYKFIVLNNNGHSDSLLRDNIEIRQNFNLCKMPMVSTYESELEIHCDKNEPTDCQLQNADLAAENVVKNSNPDNIEFLIGSNQNLRK
Sbjct:    1 MTIFNTCPIKSIFRKNDKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTNTKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQPSTANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEILKDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNVRQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIENYSFISYHEDIKFKKLYKFIVLNNNGHSDSLLRDNIEIRQNFNLCKMPMVSTYESELEIHCDKNEPTDCQLQNADLAAENVVKNSNPDNIEFLIGSNQNLRK 592          
BLAST of Major facilitator superfamily domain containing protein vs. Planmine SMEST
Match: SMESG000018848.1 (SMESG000018848.1)

HSP 1 Score: 1204.5 bits (3115), Expect = 0.000e+0
Identity = 589/616 (95.62%), Postives = 589/616 (95.62%), Query Frame = 1
Query:  103 MTIFNTCPIKSIFRKNDKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTNTKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQPVTANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEILKDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMR------------------------IENYSFISYHEDIKFKKLYKFIVLNNNGHSDSLLRDNIEIRQNFNLCKMPMVSTYESELEIHCDKNEPTDCQLQNADLAAENVVKNSNPDNIEFLIGSNQNLRK 1878
            MTIFNTCPIKSIFRKNDKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTNTKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQP TANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEILKDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKN RQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEM                         IENYSFISYHEDIKFKKLYKFIVLNNNGHSDSLLRDNIEIRQNFNLCKMPMVSTYESELEIHCDKNEPTDCQLQNADLAAENVVKNSNPDNIEFLIGSNQNLRK
Sbjct:    1 MTIFNTCPIKSIFRKNDKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTNTKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQPSTANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEILKDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNVRQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMSNKTELYTYCTIASCVWWDLWTRSMIENYSFISYHEDIKFKKLYKFIVLNNNGHSDSLLRDNIEIRQNFNLCKMPMVSTYESELEIHCDKNEPTDCQLQNADLAAENVVKNSNPDNIEFLIGSNQNLRK 616          
BLAST of Major facilitator superfamily domain containing protein vs. Planmine SMEST
Match: SMESG000018848.1 (SMESG000018848.1)

HSP 1 Score: 1117.06 bits (2888), Expect = 0.000e+0
Identity = 549/592 (92.74%), Postives = 549/592 (92.74%), Query Frame = 1
Query:  103 MTIFNTCPIKSIFRKNDKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTNTKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQPVTANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEILKDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIENYSFISYHEDIKFKKLYKFIVLNNNGHSDSLLRDNIEIRQNFNLCKMPMVSTYESELEIHCDKNEPTDCQLQNADLAAENVVKNSNPDNIEFLIGSNQNLRK 1878
            MTIFNTCPIKSIFRKNDKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTNTKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQP TANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEILKDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKN RQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEM                                         RQNFNLCKMPMVSTYESELEIHCDKNEPTDCQLQNADLAAENVVKNSNPDNIEFLIGSNQNLRK
Sbjct:    1 MTIFNTCPIKSIFRKNDKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTNTKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQPSTANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEILKDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNVRQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEM-----------------------------------------RQNFNLCKMPMVSTYESELEIHCDKNEPTDCQLQNADLAAENVVKNSNPDNIEFLIGSNQNLRK 551          
BLAST of Major facilitator superfamily domain containing protein vs. Planmine SMEST
Match: SMESG000074723.1 (SMESG000074723.1)

HSP 1 Score: 364.77 bits (935), Expect = 2.432e-118
Identity = 187/451 (41.46%), Postives = 290/451 (64.30%), Query Frame = 1
Query:  211 RKLAYGMGGPPMQMLSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTNTKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTGLTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNRIANQPVTA-NITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEILKDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEE 1560
            RK AYG+GG P Q+ S+A+ F+L IFLLE + + PY L  +    R WDAITDPI G++++KTNT++G++KP++ ++    C +FF  FY P  +N+  K  +Y   ++  QT  T F +PY SMCMVLT +   RD+LT+ RM FEIIG+L G+  FG + +  + +N  +    I+  +   ++  Y+IAS++ C I + C    + G+ E EI  + +   +   K I+ F+PY+ +MF F  +++GI LVQ+N+ALYIT+ L +P H++  ILV++  S  L+P+G  L +++GKK  +F+G + + P+L +L FLP + +L +FY  MVW+S+ VM+A  LPWSMLPD ID + + +  R +AT +S +VFF KFA+G ++ ++ I L LA Y+     Q   VS  LRY++G    + +LI M+ LYFYPI E KR E+ +K++E
Sbjct:   57 RKYAYGIGGIPTQLPSSALSFYLSIFLLEVSHMVPYNLFYVIAAGRIWDAITDPIAGYIVSKTNTRWGQFKPFMLVSALPLCCSFFGLFYNPGFENESHKLCYYVIIMLIFQTCTTFFFIPYGSMCMVLTVDMHRRDELTAYRMIFEIIGLLIGSVYFGGVVSIFKESNICLNNFTISPKVSQNQQMGYMIASSSSCGIILICICITVFGSVEQEIFIESDTFNVGFYKLILTFRPYMILMFTFAATAIGIMLVQANMALYITYVLEMPNHISKSILVMIVISVILIPVGQILNKKFGKKLTYFSGMVTIFPVLISLIFLPSSPNLILFYGIMVWSSYPVMIAFFLPWSMLPDCIDYFSVTHDIRNEATIFSLFVFFQKFALGFAVGMTGIVLWLANYNSRLCVQPEMVSLSLRYFVGFGSSLFYLIGMILLYFYPINEVKRDEIQLKIKE 507          
BLAST of Major facilitator superfamily domain containing protein vs. Planmine SMEST
Match: SMESG000074657.1 (SMESG000074657.1)

HSP 1 Score: 251.906 bits (642), Expect = 1.083e-77
Identity = 135/333 (40.54%), Postives = 206/333 (61.86%), Query Frame = 1
Query:  583 MCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATRNR-----IANQPVTANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELEILKDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHTLNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILATLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENGCRMDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRYYIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMR 1566
            MCMVLT +   RD+LT+ RM FEIIG+L G+  FG + +  +     + N  V+  + D     ++  Y+IAS+  C I I C    + G+ E +I  + E   L   K I+ F+PYL +M  F  +++GI LVQ+N+ALYIT+ L IP H++  ILV++  S   +P+G  L ++ GKK  +F+G + + P+L +L FLP + ++ +FY  M+W+S+ +MVA  LPWSMLPD ID + + +  R  AT +S +VFF KFA+G ++ ++ I LGLA Y+     Q   VS  LRY++G      +L SM+FLYFYPI E KR E+ ++++E+ 
Sbjct:    1 MCMVLTVDMHQRDELTAYRMIFEIIGLLIGSVYFGGVVSMYKNTDICVDNFTVSTKLVDE----QEMGYMIASSTSCCILIICVCITVFGSVEQDIFIEHEPFSLKFYKLILTFRPYLLLMLTFACTAIGIMLVQANMALYITYVLKIPNHMSKSILVMIILSVIFIPVGQILNKKLGKKLTYFSGMLTIFPVLISLIFLPSHPNIILFYGIMIWSSYPIMVAFFLPWSMLPDCIDYFSVTHDIRNQATIFSLFVFFQKFALGFAVGMTGIVLGLADYNSRLCVQPELVSLSLRYFVGFGSSFFYLASMLFLYFYPINEAKRVEIQVQMKEVH 329          
The following BLAST results are available for this feature:
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MFSD2A4.212e-8532.74major facilitator superfamily domain containing 2A... [more]
MFSD2A1.459e-8131.91major facilitator superfamily domain containing 2A... [more]
MFSD2B2.434e-6331.88major facilitator superfamily domain containing 2B... [more]
MFSD2B3.452e-6231.86major facilitator superfamily domain containing 2B... [more]
MFSD2B9.006e-6130.10major facilitator superfamily domain containing 2B... [more]
back to top
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfsd2b2.288e-9334.29major facilitator superfamily domain containing 2B... [more]
mfsd2b3.891e-9332.94major facilitator superfamily domain containing 2B... [more]
mfsd2ab1.488e-9234.68major facilitator superfamily domain containing 2a... [more]
mfsd2ab7.045e-9034.33major facilitator superfamily domain containing 2a... [more]
mfsd2aa7.336e-8331.53major facilitator superfamily domain containing 2a... [more]
back to top
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfsd2a2.296e-9536.02major facilitator superfamily domain containing 2A... [more]
mfsd2a4.106e-9335.15major facilitator superfamily domain containing 2A... [more]
mfsd2a3.422e-9234.63major facilitator superfamily domain containing 2A... [more]
mfsd2a2.784e-9134.41major facilitator superfamily domain containing 2A... [more]
mfsd2a9.066e-9034.75major facilitator superfamily domain containing 2A... [more]
back to top
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mfsd2a1.286e-8332.28major facilitator superfamily domain containing 2A... [more]
Mfsd2b3.686e-6732.22major facilitator superfamily domain containing 2B... [more]
Mfsd2b2.997e-4830.94major facilitator superfamily domain containing 2B... [more]
Mfsd2b3.759e-4132.00major facilitator superfamily domain containing 2B... [more]
Mfsd2a7.387e-1845.95major facilitator superfamily domain containing 2A... [more]
back to top
BLAST of Major facilitator superfamily domain containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DEJ6|NLS1B_DANRE1.123e-9134.68Sodium-dependent lysophosphatidylcholine symporter... [more]
sp|Q0IHM1|NLS1_XENTR1.813e-9134.63Sodium-dependent lysophosphatidylcholine symporter... [more]
sp|Q9DA75|NLS1_MOUSE8.996e-8332.28Sodium-dependent lysophosphatidylcholine symporter... [more]
sp|Q5U3U7|NLS1A_DANRE7.125e-8231.53Sodium-dependent lysophosphatidylcholine symporter... [more]
sp|Q8NA29|NLS1_HUMAN7.006e-8131.91Sodium-dependent lysophosphatidylcholine symporter... [more]
back to top
BLAST of Major facilitator superfamily domain containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3NPM62.763e-13142.48Sodium-dependent lysophosphatidylcholine symporter... [more]
A0A267E5S92.085e-12039.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EY159.271e-12039.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A068YN461.748e-11740.04Major facilitator superfamily domain containing pr... [more]
A0A068WSK72.100e-11639.85Major facilitator superfamily domain containing pr... [more]
back to top
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfsd2b7.265e-9332.50major facilitator superfamily domain-containing pr... [more]
mfsd2ab3.038e-9133.40major facilitator superfamily domain containing 2A... [more]
mfsd2aa5.222e-9033.20sodium-dependent lysophosphatidylcholine symporter... [more]
mfsd2aa7.483e-8833.20sodium-dependent lysophosphatidylcholine symporter... [more]
mfsd2aa9.651e-8833.26sodium-dependent lysophosphatidylcholine symporter... [more]
back to top
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000006057.14.788e-3033.97pep scaffold:Pmarinus_7.0:GL483004:1981:7987:1 gen... [more]
back to top
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO263773.255e-932.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418261.124e-723.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfsd2ab2.242e-9334.67major facilitator superfamily domain containing 2A... [more]
ENSORLT00000021525.29.582e-8934.40sodium-dependent lysophosphatidylcholine symporter... [more]
ENSORLT00000021520.22.200e-8533.86sodium-dependent lysophosphatidylcholine symporter... [more]
mfsd2b2.909e-8331.81major facilitator superfamily domain-containing pr... [more]
zgc:1715015.611e-6030.62sodium-dependent lysophosphatidylcholine symporter... [more]
back to top
BLAST of Major facilitator superfamily domain containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018848.10.000e+099.66SMESG000018848.1[more]
SMESG000018848.10.000e+095.62SMESG000018848.1[more]
SMESG000018848.10.000e+092.74SMESG000018848.1[more]
SMESG000074723.12.432e-11841.46SMESG000074723.1[more]
SMESG000074657.11.083e-7740.54SMESG000074657.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001523 ID=SMED30001523|Name=Major facilitator superfamily domain containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2013bp
GATGAAGATATATTTGAATTTTTTAAAGTTTATTATTATTGTTATATAAA
GAATTTTACAAAAAGTGAAAAATATTGATTGACTTCTTAGCTCAAAAGTA
AAATGACTATCTTTAATACTTGTCCAATTAAATCAATATTTCGAAAAAAT
GACAAAGAAAAAATTGAATCAAAACCAACTCCAATTTATAAGAGACGAAT
GCACGTTTGCCGTAAATTAGCATATGGGATGGGTGGACCTCCGATGCAAA
TGCTATCGAATGCTATGGGATTTTTCTTGCCGATATTTCTATTAGAAACT
GCATCGATCAATCCTTACTACCTTTCAGCCATTCAAATTATTGCAAGAGC
TTGGGATGCCATAACTGATCCAATTATGGGTTTTATGATTAATAAAACTA
ATACAAAATTTGGAAAATATAAACCATGGATAAGTTTAGCTACTCCTCTA
TCTTGTCTGGCATTTTTTCTCCAGTTTTATGTACCGAATACTGATAATCA
ACTATCCAAATTTATATTTTATTGCTTTACAATTGTGTTCGTTCAAACAG
GTCTGACGGCTTTCCATGTTCCTTATTCATCAATGTGTATGGTTCTTACA
TCGAATTGTCGTGATAGAGATCAACTAACGTCTATAAGAATGGCTTTTGA
AATAATCGGTGTTCTATTTGGTGCTGGGGTATTTGGCAGTTTAGCTACCC
GAAATCGCATAGCTAATCAACCTGTCACTGCTAATATTACAGATAGTATG
AGGAATACCGAGAAAAACGATTATATAATAGCCTCGGCAGCTGTTTGTGT
AATATTCATAGCCTGTTCGATAAGTGTTTTACTTGGCACCAAAGAATTGG
AAATCTTGAAAGACAAAGAAGAACCATATTTACCAAATCTAAAAAAGATT
ATGAGATTCAAGCCATATCTCTACATTATGTTTGCATTTATGTTCTCGTC
CTTGGGAATTCAACTCGTCCAAAGCAATCTCGCACTTTACATAACCCACA
CACTCAACATTCCAAAGCATGTCACTCCAGGAATACTAGTATTGTTATGC
TGTTCCTTTGCCTTGGTTCCACTGGGTCACTTTTTATTAAGAAGATACGG
AAAGAAAAAAATATTTTTTGCTGGAAATATTAATATGATTCCTATTTTGG
CTACCTTGGCCTTCCTACCTCAAAATGTTCATTTGGCTGTTTTTTATACT
TATATGGTTTGGACTTCTTTTACAGTTATGGTAGCTATAGTTTTACCATG
GTCAATGCTACCGGATGTCATTGATTTATATATGATTGAGAATGGATGTC
GCATGGACGCAACATTCTATTCTTTTTATGTTTTTTTCAATAAATTTGCT
GTTGGTGTTTCATTGTTTATTTCTGCAATTGCTCTTGGATTGGCAGGATA
TGATAAAAACGCTCGACAACAGACATATTCAGTTTCTAATATGCTACGCT
ATTATATAGGCACTAGTGGCATAATATGCTTTTTGATTTCTATGGTATTT
CTTTATTTTTACCCCATAACCGAAAAAAAACGAAAAGAAATGACAATCAA
ATTGGAAGAAATGAGGATTGAAAATTACAGTTTTATTTCTTACCATGAGG
ATATTAAATTTAAGAAATTGTATAAATTCATTGTTTTAAACAATAATGGT
CACAGTGACAGTCTGTTGAGAGATAACATAGAAATTAGACAAAATTTTAA
TTTATGCAAAATGCCAATGGTTTCCACTTATGAAAGTGAACTTGAGATCC
ATTGTGATAAAAACGAACCTACTGATTGCCAATTACAAAATGCAGATTTA
GCTGCTGAAAATGTGGTCAAAAATAGTAATCCAGATAACATCGAATTTCT
CATTGGTTCGAATCAAAATTTGCGCAAATAATAGATCATATCAATTATAA
ATATTTTCTATAATTTATTTCTCCAAATAAGTTTTTGTTTAAAAAATAAA
TGCTTTTCTTCAGAAGTACGTAATTAGATTTTTAAGGGAAAATATTTGAT
TCTAATATTTTGT
back to top

protein sequence of SMED30001523-orf-1

>SMED30001523-orf-1 ID=SMED30001523-orf-1|Name=SMED30001523-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=593bp
MTIFNTCPIKSIFRKNDKEKIESKPTPIYKRRMHVCRKLAYGMGGPPMQM
LSNAMGFFLPIFLLETASINPYYLSAIQIIARAWDAITDPIMGFMINKTN
TKFGKYKPWISLATPLSCLAFFLQFYVPNTDNQLSKFIFYCFTIVFVQTG
LTAFHVPYSSMCMVLTSNCRDRDQLTSIRMAFEIIGVLFGAGVFGSLATR
NRIANQPVTANITDSMRNTEKNDYIIASAAVCVIFIACSISVLLGTKELE
ILKDKEEPYLPNLKKIMRFKPYLYIMFAFMFSSLGIQLVQSNLALYITHT
LNIPKHVTPGILVLLCCSFALVPLGHFLLRRYGKKKIFFAGNINMIPILA
TLAFLPQNVHLAVFYTYMVWTSFTVMVAIVLPWSMLPDVIDLYMIENGCR
MDATFYSFYVFFNKFAVGVSLFISAIALGLAGYDKNARQQTYSVSNMLRY
YIGTSGIICFLISMVFLYFYPITEKKRKEMTIKLEEMRIENYSFISYHED
IKFKKLYKFIVLNNNGHSDSLLRDNIEIRQNFNLCKMPMVSTYESELEIH
CDKNEPTDCQLQNADLAAENVVKNSNPDNIEFLIGSNQNLRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0008643carbohydrate transport
GO:0055085transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0015293symporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR039672MFS_2
IPR036259MFS_trans_sf
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF13347MFS_2coord: 40..474
e-value: 7.0E-90
score: 301.6
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 48..248
e-value: 2.6E-7
score: 32.2
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 262..484
e-value: 8.1E-8
score: 33.7
NoneNo IPR availableCDDcd17392MFS_MFSD2coord: 38..474
e-value: 8.4988E-103
score: 316.334
NoneNo IPR availableTMHMMTMhelixcoord: 307..329
NoneNo IPR availableTMHMMTMhelixcoord: 450..472
NoneNo IPR availableTMHMMTMhelixcoord: 272..294
NoneNo IPR availableTMHMMTMhelixcoord: 224..246
NoneNo IPR availableTMHMMTMhelixcoord: 365..387
NoneNo IPR availableTMHMMTMhelixcoord: 336..355
NoneNo IPR availableTMHMMTMhelixcoord: 408..430
NoneNo IPR availableTMHMMTMhelixcoord: 137..159
NoneNo IPR availableTMHMMTMhelixcoord: 180..199
NoneNo IPR availableTMHMMTMhelixcoord: 108..127
IPR039672Lactose permease-likePANTHERPTHR11328MAJOR FACILITATOR SUPERFAMILY DOMAIN-CONTAINING PROTEINcoord: 30..486
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 41..478