Transmembrane p24 trafficking protein 5

Overview
NameTransmembrane p24 trafficking protein 5
Smed IDSMED30001521
Length (bp)1105
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane p24 trafficking protein 5 (SMED30001521) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane p24 trafficking protein 5 (SMED30001521) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane p24 trafficking protein 5 (SMED30001521) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane p24 trafficking protein 5 (SMED30001521) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001521

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30001521SMESG000063382.1 Contig4918GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001521SMESG000078204.1 Contig4918GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
cephalic gangliaSMED30001521SMESG000078204.1 dd_Smed_v4_3127_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001521SMESG000078204.1 dd_Smed_v4_3127_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Human
Match: TMED5 (transmembrane p24 trafficking protein 5 [Source:HGNC Symbol;Acc:HGNC:24251])

HSP 1 Score: 82.0333 bits (201), Expect = 1.725e-17
Identity = 61/193 (31.61%), Postives = 100/193 (51.81%), Query Frame = 3
Query:  372 FTLIVPSQSVECYYYTA--ADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVY--MMIDVANVNAINTPEYAQL--------NKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            FT  +P+   EC+Y       S EI+YQVL G   DI   +     K + F++  +DG   V    +    DY  CFDN  S+   K ++  +++D     A    ++ +          KL+ +  S+ SI + L++  H+Q   R+ EA DR+I E N++ V  W ++ + VM+VVSAIQ+ +++SLF+ K
Sbjct:   36 FTFTLPAGQKECFYQPMPLKASLEIEYQVLDGAGLDIDFHLASPEGKTLVFEQRKSDGVHTV----ETEVGDYMFCFDNTFSTISEKVIFFELILDNMGEQAQEQEDWKKYITGTDILDMKLEDILESINSIKSRLSKSGHIQTLLRAFEARDRNIQESNFDRVNFWSMVNLVVMVVVSAIQVYMLKSLFEDK 224          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Human
Match: TMED3 (transmembrane p24 trafficking protein 3 [Source:HGNC Symbol;Acc:HGNC:28889])

HSP 1 Score: 63.1586 bits (152), Expect = 5.644e-11
Identity = 49/195 (25.13%), Postives = 80/195 (41.03%), Query Frame = 3
Query:  354 NPSYVTFTLIVPSQSVECYYYTAADS--FEIDYQVLKGGDYDIALGVYD------YNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
             P     T  +P  + +C++        F +DYQV+ GG YD+   V D      Y   K  +   +    +K +         Y  CF N  S+   K VY    V +   I      ++  L  M ++  +I+ +L  +   Q   R  EA DR+  E     V+ W + +   + VVS  Q++L++S F  K
Sbjct:   23 QPCGAELTFELPDNAKQCFHEEVEQGVKFSLDYQVITGGHYDVDCYVEDPQGNTIYRETKKQYDSFTYRAEVKGV---------YQFCFSNEFSTFSHKTVYFDFQVGDEPPILPDMGNRVTALTQMESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEK 208          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Human
Match: TMED7 (transmembrane p24 trafficking protein 7 [Source:HGNC Symbol;Acc:HGNC:24253])

HSP 1 Score: 61.2326 bits (147), Expect = 3.295e-10
Identity = 53/196 (27.04%), Postives = 86/196 (43.88%), Query Frame = 3
Query:  333 GGAYYIHNPSYVTFTLIVPSQSVECYYYTAADSFE--IDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            GGA      S +TF L  P  + +C+Y   A   +  +++QV+ GG YD+   + D + K +  +      +      K   N  Y  CF N  S+   K VY    V     +  P   +++ L  M ++  SI+ +L  +   Q   R  EA  RS  E     V  W + +  +++VVS  Q+ L++S F  K
Sbjct:   32 GGA------SEITFEL--PDNAKQCFYEDIAQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASK---NGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPL-FPSENRVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSVGEALILLVVSIGQVFLLKSFFSDK 215          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Human
Match: TMED1 (transmembrane p24 trafficking protein 1 [Source:HGNC Symbol;Acc:HGNC:17291])

HSP 1 Score: 60.077 bits (144), Expect = 8.152e-10
Identity = 46/187 (24.60%), Postives = 79/187 (42.25%), Query Frame = 3
Query:  309 MNPTDTISGGAYYIHNPSYVTFTLIVPSQSVECYYYTAAD--SFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMI---------DVANVNAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMW 836
            M P +    G   I +     FT ++P+   +C+Y +A    S E +YQV+ G   D+   +       +  +    DG +  + P +    DY +CFDN  S+   K V+  +         +V        PE     K++ +  S+ ++ T L +   +    R+ EA DR++ E N E V  W
Sbjct:   16 MPPVEVGGAGPPPIQDGE---FTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDFTLESPQGVLLVSESRKADG-VHTVEPTEA--GDYKLCFDNSFSTISEKLVFFELIFDSLQDDEEVEGWAEAVEPEEMLDVKMEDIKESIETMRTRLERSIQMLTLLRAFEARDRNLQEGNLERVNFW 196          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Human
Match: TMED2 (transmembrane p24 trafficking protein 2 [Source:HGNC Symbol;Acc:HGNC:16996])

HSP 1 Score: 50.8322 bits (120), Expect = 6.448e-7
Identity = 39/180 (21.67%), Postives = 79/180 (43.89%), Query Frame = 3
Query:  384 VPSQSVECYY--YTAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANV-NAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            + + + EC++   T+     + ++V +GG  DI + +   +NK +   K   + + K      M +  Y  CF N  S+   K V   ID+       +    A  NKL+ M   +  +  ++  ++H QE     E I R+I +     V +W   +  V++ ++  Q+  ++  F+ +
Sbjct:   25 IDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKGI--YKGDRESSGKYTFAAHM-DGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKLEEM---INELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVLVAMTLGQIYYLKRFFEVR 198          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Celegans
Match: K08E4.6 (pep chromosome:WBcel235:IV:12077107:12078162:-1 gene:WBGene00010670.1 transcript:K08E4.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K08E4.6)

HSP 1 Score: 92.4337 bits (228), Expect = 1.389e-21
Identity = 64/212 (30.19%), Postives = 108/212 (50.94%), Query Frame = 3
Query:  372 FTLIVPSQSVECYY----YTAADSFEIDYQVLKGGDYDIALGV-YDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMI---------DVANVNAINTPEY---AQLNKL----DLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSKGGLGAKIWQK 944
            FT+ VP+   +C++         + E+DYQV+ GGD +I   + +  N  K    K      I++  P D     Y +CFDN  S +  K V+  I         D A+++A+   +    A++N+L    D  H     I  +LN++E+ Q   R+ EA DR++M  N++ VT W ++   VM+ V+ +Q+ +IRSLF+    +G K+ +K
Sbjct:   25 FTVEVPAGKFQCFFQPVDLAKHKTLEVDYQVIDGGDLNINFMILHGANILKQDQLKVDGSHRIELNQPGD-----YQVCFDNSFSYQSRKVVFFEIFLFDAHGNLDEADLSAMARTDSDLSAKMNELGVTIDEFHRRANGIKNNLNKVEYHQALLRAHEARDRAVMSANFDRVTFWSVVHTLVMVGVAGVQVFMIRSLFEENSKIG-KVLRK 230          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Celegans
Match: F57B10.5 (pep chromosome:WBcel235:I:6562699:6563660:1 gene:WBGene00019003.1 transcript:F57B10.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F57B10.5)

HSP 1 Score: 58.9214 bits (141), Expect = 5.470e-10
Identity = 46/185 (24.86%), Postives = 80/185 (43.24%), Query Frame = 3
Query:  366 VTFTLIVPSQSVECYYYTAADSFE--IDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            +  T  +P  + +C+Y       +   ++QV+ GG YD+ L + D  N KV ++ +        I  K  +   Y  CF N  S+   K VYM     + NA++       + +  +     +I   L  ++  Q   R  EA  R   E   E V +W + Q  V++ +   Q+ L++S F+ K
Sbjct:   18 IELTFELPDNANQCFYEDLKKDVDTVFEFQVVTGGHYDVDLIIED-PNGKVLYKDTKK--QYDSINFKAEVEGTYKACFSNEFSTFSHKIVYMDWQFGDQNALHAAVTQGAHAMTQLENYAVAIGDKLRTIDDYQTHHRLREATGRKRAEELNERVMIWSLGQSAVVVFIGIGQVFLLKSFFNDK 199          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Fly
Match: opm (gene:FBgn0264389 transcript:FBtr0073968)

HSP 1 Score: 78.9518 bits (193), Expect = 1.349e-16
Identity = 61/215 (28.37%), Postives = 102/215 (47.44%), Query Frame = 3
Query:  375 TLIVPSQSVECYYYTA--ADSFEIDYQVLKGG--DYDIALGVYDYNNKKVA--FQKSSNDGNIKVIVPKDMLNK--DYSICFDNYQSSRDTKKVYMMI----------------DVANVNAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSKGGLGAKIWQKL 947
            T+ V +   EC Y++    ++ + +YQV+ GG  D DI+  + D     +   F+K  N       V +  + K  DY  CFDN  S  + K V+  +                +   +  ++  EY  +   D+M   +  I   L +   LQ+  RS EA DR++ E N++ V  W ++QI+ MI V  IQ+ ++RS+F + GG    +W+KL
Sbjct:   35 TVYVDAGKTECLYHSVRQGETIDFEYQVIDGGHGDLDISFTLLDPIGLVIVSDFKKPEN-------VHRHEVAKEGDYRFCFDNSFSMFNRKTVFFELIVEREGEELQGDTQWNEADELTGLSRDEYYDMKVQDIM-DFIGRIRLQLTKARQLQDVLRSHEARDRNLAESNFQKVNHWSMVQISAMIGVGLIQVFMLRSIF-ATGGRMHNLWRKL 240          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Fly
Match: opm (gene:FBgn0264389 transcript:FBtr0340429)

HSP 1 Score: 78.9518 bits (193), Expect = 1.349e-16
Identity = 61/215 (28.37%), Postives = 102/215 (47.44%), Query Frame = 3
Query:  375 TLIVPSQSVECYYYTA--ADSFEIDYQVLKGG--DYDIALGVYDYNNKKVA--FQKSSNDGNIKVIVPKDMLNK--DYSICFDNYQSSRDTKKVYMMI----------------DVANVNAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSKGGLGAKIWQKL 947
            T+ V +   EC Y++    ++ + +YQV+ GG  D DI+  + D     +   F+K  N       V +  + K  DY  CFDN  S  + K V+  +                +   +  ++  EY  +   D+M   +  I   L +   LQ+  RS EA DR++ E N++ V  W ++QI+ MI V  IQ+ ++RS+F + GG    +W+KL
Sbjct:   35 TVYVDAGKTECLYHSVRQGETIDFEYQVIDGGHGDLDISFTLLDPIGLVIVSDFKKPEN-------VHRHEVAKEGDYRFCFDNSFSMFNRKTVFFELIVEREGEELQGDTQWNEADELTGLSRDEYYDMKVQDIM-DFIGRIRLQLTKARQLQDVLRSHEARDRNLAESNFQKVNHWSMVQISAMIGVGLIQVFMLRSIF-ATGGRMHNLWRKL 240          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Fly
Match: CG31787 (gene:FBgn0051787 transcript:FBtr0081055)

HSP 1 Score: 67.3958 bits (163), Expect = 1.380e-12
Identity = 55/212 (25.94%), Postives = 95/212 (44.81%), Query Frame = 3
Query:  357 PSYVTFTLIVPSQSVECYYYTAA--DSFEIDYQVLKGG--DYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQLNK-------LDLMHTSLTS----IYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSKGGLGAKIWQKL 947
            P     T+   +   EC+Y   A  ++ +IDYQV+ GG  +  I   + D + + +  +     G   +   +      Y  CFDN  S+ + K V   ++VA  +     E   L +        D+ +T + S    I+ +L +    Q+  R+IEA DR++ E  Y  V  W   Q   MI V  +Q++++RS+F++ G    K W+  
Sbjct:   26 PHNKQLTVFAEAGRQECFYQPIATTENIKIDYQVIHGGLGETHINFNLMDPSRRLLIAETKRQMGKHSIQANE---TGSYKFCFDNTISTFNQKIVSFTLEVAPADR-EERELRDLRQEMLTDYHFDVAYTGIDSYVGKIHVNLMRSRQTQDFIRAIEARDRNVAESTYSMVNKWSWAQFLSMIFVGFLQVLMVRSIFNTTGTF-YKFWKSF 232          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Fly
Match: CHOp24 (gene:FBgn0029709 transcript:FBtr0343566)

HSP 1 Score: 61.6178 bits (148), Expect = 7.859e-11
Identity = 44/188 (23.40%), Postives = 85/188 (45.21%), Query Frame = 3
Query:  369 TFTLIVPSQSVECYY--YTAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANV--NAINTPEYAQLN--KLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
             F + V + + EC++        F + ++V+ GG  D+ + +   +N  +   +  + G    + P       Y++CF+N +SS   K V   IDV +    A   P   ++   KL+ M   L+   TS+   +H QE     + I RS+ E     V +W   +  V+++++  Q+  ++  F+ K
Sbjct:   24 AFIVSVDAHNEECFFENVEGGTKFGVTFEVIDGGFLDVDIKISGPDNHVMHESEKESSGKYTFVAPA---KGTYTVCFNNERSSMTPKLVMFSIDVGDAPQRAPGAPGEEEVGHTKLEDMIRELSGTLTSV---KHEQEYMHVRDKIHRSVNENTNSRVVLWSTFEALVLVLMTVGQVYYLKRFFEVK 205          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Fly
Match: CHOp24 (gene:FBgn0029709 transcript:FBtr0070675)

HSP 1 Score: 61.6178 bits (148), Expect = 7.859e-11
Identity = 44/188 (23.40%), Postives = 85/188 (45.21%), Query Frame = 3
Query:  369 TFTLIVPSQSVECYY--YTAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANV--NAINTPEYAQLN--KLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
             F + V + + EC++        F + ++V+ GG  D+ + +   +N  +   +  + G    + P       Y++CF+N +SS   K V   IDV +    A   P   ++   KL+ M   L+   TS+   +H QE     + I RS+ E     V +W   +  V+++++  Q+  ++  F+ K
Sbjct:   24 AFIVSVDAHNEECFFENVEGGTKFGVTFEVIDGGFLDVDIKISGPDNHVMHESEKESSGKYTFVAPA---KGTYTVCFNNERSSMTPKLVMFSIDVGDAPQRAPGAPGEEEVGHTKLEDMIRELSGTLTSV---KHEQEYMHVRDKIHRSVNENTNSRVVLWSTFEALVLVLMTVGQVYYLKRFFEVK 205          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Zebrafish
Match: tmed1b (transmembrane p24 trafficking protein 1b [Source:ZFIN;Acc:ZDB-GENE-070112-1112])

HSP 1 Score: 97.0561 bits (240), Expect = 4.571e-23
Identity = 63/209 (30.14%), Postives = 107/209 (51.20%), Query Frame = 3
Query:  324 TISGGAYYIHNPSYVTFTLIVPSQSVECYYYTAA--DSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVY--MMIDVANVNAINTPEYAQLN--------KLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            T+  GA    +P+   FT ++P+ S EC+Y +A    S EI+YQV+ G   D+   V       +  +   +DG + ++ P +    DY ICFDN  S    K V+  +++D  + +A    E+A L         KLD +  S+ +++  L +   +Q   R+ EA DR+++E N   V+ W  + + V++ V+ IQ+  +R LFD K
Sbjct:   16 TLLFGAVNAFSPADTEFTFLLPAASKECFYQSAVHNGSVEIEYQVIAGAGMDVDFSVVSPQGIHLISEFRRSDG-VHMVEPTE--EGDYQICFDNTFSRFSEKMVFFEVILDHPSNDAGADDEWAGLGEPESILEYKLDDIKESMETVHRRLERSRQMQTFLRAFEARDRNLLEDNLWRVSFWSCVNLLVLLSVAFIQVYTLRRLFDDK 221          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Zebrafish
Match: tmed1a (transmembrane p24 trafficking protein 1a [Source:ZFIN;Acc:ZDB-GENE-040801-229])

HSP 1 Score: 84.7297 bits (208), Expect = 1.124e-18
Identity = 56/193 (29.02%), Postives = 93/193 (48.19%), Query Frame = 3
Query:  372 FTLIVPSQSVECYYYTAA--DSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVN----------AINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            FT ++P+ + EC++ TA    S E++YQV+ G   D+   +      ++      +DG   V   ++    DY ICFDN  S    K VY+ + +              A+  PE +   KL+ +  S+ +++ SL +   LQ   R+ EA DR ++E N   V+ W    + VMI V+  Q+  +R LF+ K
Sbjct:   32 FTFLLPAGATECFFQTATKNSSMEVEYQVIAGSGLDVGFTLISPRGYRLVSDFRKSDGIHTVDSTEE---GDYRICFDNSFSRISEKMVYVEVIMDGPEGEDEDDEDWAALAEPEDSLEYKLEDIRDSMDAVHKSLERSRQLQTTLRAFEARDRYLLEDNLWRVSFWSCASLLVMISVALTQVYTLRRLFNDK 221          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Zebrafish
Match: tmed5 (transmembrane p24 trafficking protein 5 [Source:ZFIN;Acc:ZDB-GENE-040426-1302])

HSP 1 Score: 83.9593 bits (206), Expect = 2.408e-18
Identity = 57/192 (29.69%), Postives = 92/192 (47.92%), Query Frame = 3
Query:  372 FTLIVPSQSVECYYYTAAD--SFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPE--YAQLNKLDLMHTSLTSIYTSLNQME-------HLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            FT  + +   EC++ T     S EI+YQVL G   D+   +   +   +A     +DG   V   +     DY  CFDN  S+   K ++  + + N+      E   A +   DL+   L  I  ++N ++        +Q   R+ EA DR++ E NYE V +W    + VM++VS +Q+ L+RSLF+ K
Sbjct:   33 FTFTLAAGRRECFFQTMKKDASLEIEYQVLDGASLDVDFQLNSPSGHIIASDYRKSDGVHTVETEE----GDYMFCFDNTFSAVSEKVIFFELILDNMGEDEESEDWKAYVQGADLLDMKLEDIMDTINNVKSRLGKSLQIQTLLRAFEARDRNLQESNYERVNLWSCTNVLVMVIVSGVQVYLLRSLFEDK 220          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Zebrafish
Match: tmed5 (transmembrane p24 trafficking protein 5 [Source:ZFIN;Acc:ZDB-GENE-040426-1302])

HSP 1 Score: 83.5741 bits (205), Expect = 2.908e-18
Identity = 57/192 (29.69%), Postives = 92/192 (47.92%), Query Frame = 3
Query:  372 FTLIVPSQSVECYYYTAAD--SFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPE--YAQLNKLDLMHTSLTSIYTSLNQME-------HLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            FT  + +   EC++ T     S EI+YQVL G   D+   +   +   +A     +DG   V   +     DY  CFDN  S+   K ++  + + N+      E   A +   DL+   L  I  ++N ++        +Q   R+ EA DR++ E NYE V +W    + VM++VS +Q+ L+RSLF+ K
Sbjct:   33 FTFTLAAGRRECFFQTMKKDASLEIEYQVLDGASLDVDFQLNSPSGHIIASDYRKSDGVHTVETEE----GDYMFCFDNTFSAVSEKVIFFELILDNMGEDEESEDWKAYVQGADLLDMKLEDIMDTINNVKSRLGKSLQIQTLLRAFEARDRNLQESNYERVNLWSCTNVLVMVIVSGVQVYLLRSLFEDK 220          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Zebrafish
Match: tmed3 (transmembrane p24 trafficking protein 3 [Source:ZFIN;Acc:ZDB-GENE-030131-8335])

HSP 1 Score: 67.0106 bits (162), Expect = 1.578e-12
Identity = 55/190 (28.95%), Postives = 87/190 (45.79%), Query Frame = 3
Query:  354 NPSYVTFTLIVPSQSVECYYYTAADS--FEIDYQVLKGGDYDIALGVYD-YNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            N + +TF L  P    +C+Y        F+ID+QV+ GG+YD+   V D  NN     +K   D      V K +    Y +CF N  S+   K VY+       + +  P+  +   L  M ++  SI+  L  +   Q   R  EA DR   E  +E V  W I +  ++ VV   Q+++++S F+ K
Sbjct:   16 NATELTFEL--PDNEKQCFYEELEQGVKFDIDFQVIAGGNYDVDCFVTDPINNMLYQERKKQYDSFSHTTVMKGV----YKVCFSNEFSTFSHKTVYLDFRSGEDDRL-FPDQNRATALTQMESACLSIHEILKVVSDSQTWYRLREAQDRLRAEDLHERVHFWSIGETVILFVVCIGQVLMLKSFFNEK 198          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Xenopus
Match: tmed5 (transmembrane p24 trafficking protein 5 [Source:NCBI gene;Acc:549314])

HSP 1 Score: 89.3521 bits (220), Expect = 4.026e-20
Identity = 55/193 (28.50%), Postives = 100/193 (51.81%), Query Frame = 3
Query:  372 FTLIVPSQSVECYY--YTAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVY--MMIDVANVNAINTPEY-AQLNKLDLMHTSLTSIYTSLNQME-------HLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            +T  +P+   EC++       + EI+YQVL G   D+   +   N + +  ++  +DG   V    + ++ DY  CFDN  S    K ++  +++D  N       ++ + +   DL+   L  I  ++N ++        +Q   ++ EA DR++ E N+E VT W +  +TVM+VVSA+Q+ ++RSLF+ K
Sbjct:   30 YTFTLPAGQKECFFQPMKRDATLEIEYQVLDGAGLDVDFSLTSPNGELLLSEERQSDGVHSV----ETIDGDYQFCFDNSFSRMSEKVIFFELILDHLNDEGNELEDWKSYITGTDLLDMKLEDILETINSVKGRLTKSAQIQTLLKAFEARDRNLQESNFERVTFWSVFNLTVMVVVSALQVYMLRSLFEDK 218          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Xenopus
Match: tmed1 (transmembrane p24 trafficking protein 1 [Source:NCBI gene;Acc:734138])

HSP 1 Score: 85.5001 bits (210), Expect = 7.038e-19
Identity = 56/198 (28.28%), Postives = 97/198 (48.99%), Query Frame = 3
Query:  354 NPSYVTFTLIVPSQSVECYYYTAA--DSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPE-YAQLN--------KLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
             P     T ++P+   EC+Y T     S EI+YQV+ G   D+   V   +   +  ++  +DG +  + P +    DY ICFDN  S+   K V+  +   N      P+ +A +         KL+ +  S+ S+ + L +   +Q   R+ EA DR++ + N E V  W  I + V++ V+ +Q+ +++SLFD K
Sbjct:   21 QPQDTELTFLLPAGRQECFYQTTLYNGSMEIEYQVIGGAGLDVDFSVTTPSGILLIMERRRSDG-VHTVEPTEA--GDYMICFDNSFSTISEKLVFFELIFDNQQGDEEPDSWADVVEPDELLDIKLEDIKESIESVKSRLERSIQMQTVLRAFEARDRNLQDSNLERVNFWSAINVGVLVTVAFLQVYMLKSLFDDK 215          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Xenopus
Match: serinc2 (serine incorporator 2 [Source:Xenbase;Acc:XB-GENE-968901])

HSP 1 Score: 56.6102 bits (135), Expect = 8.946e-9
Identity = 47/182 (25.82%), Postives = 77/182 (42.31%), Query Frame = 3
Query:  375 TLIVPSQSVECYY--YTAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            T  +P  + +C+Y   T      +++QV+ GG YD+   + D +   +  +      +      +   N  Y  CF N  S+   K VY    V +   +  P   +   L  M +S  SI+ +L  +   Q   R  EA  RS  E     V  W I +  +++VVS  Q+ L++S F  K
Sbjct:   39 TFELPDNAKQCFYEDITQGTKCTLEFQVITGGHYDVDCRLEDPDGIVLYKEMKKQYDSFTFTATR---NGTYKFCFSNEFSTFTHKTVYFDFQVGDDPPL-FPNENRATALTQMESSCVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNSRVAYWSIGEAIILLVVSIGQVFLLKSFFSDK 216          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Xenopus
Match: serinc2 (serine incorporator 2 [Source:Xenbase;Acc:XB-GENE-968901])

HSP 1 Score: 55.4546 bits (132), Expect = 2.295e-8
Identity = 47/182 (25.82%), Postives = 77/182 (42.31%), Query Frame = 3
Query:  375 TLIVPSQSVECYY--YTAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            T  +P  + +C+Y   T      +++QV+ GG YD+   + D +   +  +      +      +   N  Y  CF N  S+   K VY    V +   +  P   +   L  M +S  SI+ +L  +   Q   R  EA  RS  E     V  W I +  +++VVS  Q+ L++S F  K
Sbjct:   33 TFELPDNAKQCFYEDITQGTKCTLEFQVITGGHYDVDCRLEDPDGIVLYKEMKKQYDSFTFTATR---NGTYKFCFSNEFSTFTHKTVYFDFQVGDDPPL-FPNENRATALTQMESSCVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNSRVAYWSIGEAIILLVVSIGQVFLLKSFFSDK 210          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Xenopus
Match: tmed2 (transmembrane p24 trafficking protein 2 [Source:NCBI gene;Acc:734103])

HSP 1 Score: 52.373 bits (124), Expect = 2.099e-7
Identity = 39/180 (21.67%), Postives = 79/180 (43.89%), Query Frame = 3
Query:  384 VPSQSVECYY--YTAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANV-NAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            + + + EC++   T+     + ++V +GG  DI + +   +NK +   K   + + K      M +  Y  CF N  S+   K V   ID+       +    A  NKL+ M   +  +  ++  ++H QE     E I R+I +     V +W   +  V++ ++  Q+  ++  F+ +
Sbjct:   25 IDAHAEECFFEQVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKGI--HKGDRESSGKYTFAAHM-DGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKLEEM---INELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVLVAMTLGQIYYLKRFFEVR 198          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Mouse
Match: Tmed5 (transmembrane p24 trafficking protein 5 [Source:MGI Symbol;Acc:MGI:1921586])

HSP 1 Score: 85.8853 bits (211), Expect = 4.765e-19
Identity = 61/194 (31.44%), Postives = 102/194 (52.58%), Query Frame = 3
Query:  372 FTLIVPSQSVECYYYTA--ADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNA-----------INTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            FT  +P+   EC+Y       S EI+YQVL GG+ DI   +     + + F++  +DG +  I  +D    DY  CFDN  S+   K ++  + + N+             I   +  ++   D++  S+ SI + L++  H+Q   R+ EA DR+I E N++ V  W ++ + VM+VVSAIQ+  ++SLF+ K
Sbjct:   36 FTFTLPAGRKECFYQPMPLKASLEIEYQVLDGGELDIDFHLTSPEGRTLVFEQRKSDG-VHTIETED---GDYMFCFDNTFSTISEKVIFFELILDNMGEEVQGQEDWKKYITNTDVLEMKLEDILE-SINSIKSRLSKSGHIQTLLRAFEARDRNIQESNFDRVNFWSVVNLMVMVVVSAIQVYTLKSLFEDK 224          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Mouse
Match: Tmed1 (transmembrane p24 trafficking protein 1 [Source:MGI Symbol;Acc:MGI:106201])

HSP 1 Score: 60.8474 bits (146), Expect = 2.921e-10
Identity = 47/192 (24.48%), Postives = 87/192 (45.31%), Query Frame = 3
Query:  372 FTLIVPSQSVECYYYTAAD--SFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMI---------DVANVNAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            FT ++P+   +C+Y +A    S E +YQV+ G   D+   +       +  +    DG +  + P +    DY +CFDN  S+   K V+  +         +V        PE     K++ +  S+ ++ T L +   +    R+ EA DR++ E N E V  W    + V+++V+ +Q+  ++  F  K
Sbjct:   34 FTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDFTLESPQGVLLVSESRKADG-VHTVEPTEA--GDYRLCFDNSFSTISEKLVFFELIFDSFQDEEEVEGWAEAVEPEEMLDVKMEDIKESIETMRTRLERSIQMLTLLRAFEARDRNLQEDNLERVNFWSAANVAVLLLVAVLQVCTLKRFFHDK 222          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Mouse
Match: Tmed7 (transmembrane p24 trafficking protein 7 [Source:MGI Symbol;Acc:MGI:1913926])

HSP 1 Score: 60.8474 bits (146), Expect = 2.974e-10
Identity = 49/189 (25.93%), Postives = 82/189 (43.39%), Query Frame = 3
Query:  354 NPSYVTFTLIVPSQSVECYY--YTAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
              S +TF L  P  + +C+Y   T      +++QV+ GG YD+   + D + K +  +      +      +   N  Y  CF N  S+   K VY    V     +  P   +++ L  M ++  SI+ +L  +   Q   R  EA  RS  E     V  W + +  +++VVS  Q+ L++S F  K
Sbjct:   33 GGSEITFEL--PDNAKQCFYEDITQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASR---NGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPL-FPSENRVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSVGEALILLVVSVGQVFLLKSFFSDK 215          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Mouse
Match: Tmed3 (transmembrane p24 trafficking protein 3 [Source:MGI Symbol;Acc:MGI:1913361])

HSP 1 Score: 59.3066 bits (142), Expect = 7.706e-10
Identity = 48/188 (25.53%), Postives = 78/188 (41.49%), Query Frame = 3
Query:  375 TLIVPSQSVECYYYTAADS--FEIDYQVLKGGDYDIALGVYD------YNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            T  +P  + +C++        F +DYQV+ GG YD+   V D      Y   K  +   +     K +         Y  CF N  S+   K VY    V +   I      ++  L  M ++  +I+ +L  +   Q   R  EA DR+  E     V+ W + +   + VVS  Q++L++S F  K
Sbjct:   34 TFELPDNAKQCFHEEVEQGVKFSLDYQVITGGHYDVDCYVEDPRGNVIYRETKKQYDSFTYKTEAKGV---------YRFCFSNEFSTFSHKTVYFDFQVGDEPPILPDMGNRVTALTQMESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEK 212          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Mouse
Match: Tmed5 (transmembrane p24 trafficking protein 5 [Source:MGI Symbol;Acc:MGI:1921586])

HSP 1 Score: 53.1434 bits (126), Expect = 5.441e-8
Identity = 31/99 (31.31%), Postives = 50/99 (50.51%), Query Frame = 3
Query:  372 FTLIVPSQSVECYY--YTAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVN 662
            FT  +P+   EC+Y       S EI+YQVL GG+ DI   +     + + F++  +DG +  I  +D    DY  CFDN  S+   K ++  + + N+ 
Sbjct:   36 FTFTLPAGRKECFYQPMPLKASLEIEYQVLDGGELDIDFHLTSPEGRTLVFEQRKSDG-VHTIETED---GDYMFCFDNTFSTISEKVIFFELILDNMG 130          
BLAST of Transmembrane p24 trafficking protein 5 vs. UniProt/SwissProt
Match: sp|Q6AXN3|TMED5_RAT (Transmembrane emp24 domain-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Tmed5 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.660e-19
Identity = 66/214 (30.84%), Postives = 111/214 (51.87%), Query Frame = 3
Query:  315 PTDTISGGAYYIHNPSYVT-FTLIVPSQSVECYY--YTAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNA-----------INTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            P   +SG A +   PS  + FT  +P+   EC+Y       S EI+YQVL GG+ DI   +     + + F++  +DG +  +  +D    DY  CFDN  S+   K ++  + + N+             I   +  ++   D++  S+ SI + L++  H+Q   R+ EA DR+I E N++ V  W ++ + VM+VVSAIQ+  ++SLF+ K
Sbjct:   18 PATLLSGAAGF--TPSLDSDFTFTLPAGQKECFYQPMPLKASLEIEYQVLDGGELDIDFHLASPEGRTLVFEQRKSDG-VHTVETED---GDYMFCFDNTFSTISEKVIFFELILDNMGEEVEGQEDWKKYITNTDVLEMKLEDILE-SINSIKSRLSKSGHIQTLLRAFEARDRNIQESNFDRVNFWSVVNLMVMVVVSAIQVYTLKSLFEDK 224          
BLAST of Transmembrane p24 trafficking protein 5 vs. UniProt/SwissProt
Match: sp|Q9CXE7|TMED5_MOUSE (Transmembrane emp24 domain-containing protein 5 OS=Mus musculus OX=10090 GN=Tmed5 PE=1 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.333e-18
Identity = 61/194 (31.44%), Postives = 102/194 (52.58%), Query Frame = 3
Query:  372 FTLIVPSQSVECYYYTA--ADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNA-----------INTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            FT  +P+   EC+Y       S EI+YQVL GG+ DI   +     + + F++  +DG +  I  +D    DY  CFDN  S+   K ++  + + N+             I   +  ++   D++  S+ SI + L++  H+Q   R+ EA DR+I E N++ V  W ++ + VM+VVSAIQ+  ++SLF+ K
Sbjct:   36 FTFTLPAGRKECFYQPMPLKASLEIEYQVLDGGELDIDFHLTSPEGRTLVFEQRKSDG-VHTIETED---GDYMFCFDNTFSTISEKVIFFELILDNMGEEVQGQEDWKKYITNTDVLEMKLEDILE-SINSIKSRLSKSGHIQTLLRAFEARDRNIQESNFDRVNFWSVVNLMVMVVVSAIQVYTLKSLFEDK 224          
BLAST of Transmembrane p24 trafficking protein 5 vs. UniProt/SwissProt
Match: sp|Q28BQ6|TMED1_XENTR (Transmembrane emp24 domain-containing protein 1 OS=Xenopus tropicalis OX=8364 GN=tmed1 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 3.728e-18
Identity = 56/198 (28.28%), Postives = 97/198 (48.99%), Query Frame = 3
Query:  354 NPSYVTFTLIVPSQSVECYYYTAA--DSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPE-YAQLN--------KLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
             P     T ++P+   EC+Y T     S EI+YQV+ G   D+   V   +   +  ++  +DG +  + P +    DY ICFDN  S+   K V+  +   N      P+ +A +         KL+ +  S+ S+ + L +   +Q   R+ EA DR++ + N E V  W  I + V++ V+ +Q+ +++SLFD K
Sbjct:   21 QPQDTELTFLLPAGRQECFYQTTLYNGSMEIEYQVIGGAGLDVDFSVTTPSGILLIMERRRSDG-VHTVEPTEA--GDYMICFDNSFSTISEKLVFFELIFDNQQGDEEPDSWADVVEPDELLDIKLEDIKESIESVKSRLERSIQMQTVLRAFEARDRNLQDSNLERVNFWSAINVGVLVTVAFLQVYMLKSLFDDK 215          
BLAST of Transmembrane p24 trafficking protein 5 vs. UniProt/SwissProt
Match: sp|Q9Y3A6|TMED5_HUMAN (Transmembrane emp24 domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TMED5 PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 8.285e-17
Identity = 61/193 (31.61%), Postives = 100/193 (51.81%), Query Frame = 3
Query:  372 FTLIVPSQSVECYYYTA--ADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVY--MMIDVANVNAINTPEYAQL--------NKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            FT  +P+   EC+Y       S EI+YQVL G   DI   +     K + F++  +DG   V    +    DY  CFDN  S+   K ++  +++D     A    ++ +          KL+ +  S+ SI + L++  H+Q   R+ EA DR+I E N++ V  W ++ + VM+VVSAIQ+ +++SLF+ K
Sbjct:   36 FTFTLPAGQKECFYQPMPLKASLEIEYQVLDGAGLDIDFHLASPEGKTLVFEQRKSDGVHTV----ETEVGDYMFCFDNTFSTISEKVIFFELILDNMGEQAQEQEDWKKYITGTDILDMKLEDILESINSIKSRLSKSGHIQTLLRAFEARDRNIQESNFDRVNFWSMVNLVVMVVVSAIQVYMLKSLFEDK 224          
BLAST of Transmembrane p24 trafficking protein 5 vs. UniProt/SwissProt
Match: sp|Q5R809|TMED5_PONAB (Transmembrane emp24 domain-containing protein 5 OS=Pongo abelii OX=9601 GN=TMED5 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 8.533e-17
Identity = 61/193 (31.61%), Postives = 100/193 (51.81%), Query Frame = 3
Query:  372 FTLIVPSQSVECYYYTA--ADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVY--MMIDVANVNAINTPEYAQL--------NKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            FT  +P+   EC+Y       S EI+YQVL G   DI   +     K + F++  +DG   V    +    DY  CFDN  S+   K ++  +++D     A    ++ +          KL+ +  S+ SI + L++  H+Q   R+ EA DR+I E N++ V  W ++ + VM+VVSAIQ+ +++SLF+ K
Sbjct:   36 FTFTLPAGQRECFYQPMPLKASLEIEYQVLDGAGLDIDFHLASPEGKTLVFEQRKSDGVHTV----ETEVGDYMFCFDNTFSTISEKVIFFELILDNMGEQAQEQEDWKKYITGTDMLDMKLEDILESINSIKSRLSKSGHIQTLLRAFEARDRNIQESNFDRVNFWSMVNLVVMVVVSAIQVYMLKSLFEDK 224          
BLAST of Transmembrane p24 trafficking protein 5 vs. TrEMBL
Match: A0A4Z2DV04 (Transmembrane emp24 domain-containing protein isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_004547 PE=3 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 9.228e-27
Identity = 68/215 (31.63%), Postives = 110/215 (51.16%), Query Frame = 3
Query:  363 YVTFTLIVPSQSVECYYYTAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEY-----------------------AQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSKGGLGAKIW 938
            +V+  +IVP     CY+Y     FE++YQV+KGG  D+ + + D   + VA +   +D  + V VPK      Y+IC DN ++S   K VY  +DV N+N  N  E                        A +  ++ +   L  I+  L ++EH+Q++  + ++ D+S+ME N E +T   + Q+ +MI V+ +Q+ LIRSLFD +     KIW
Sbjct:  270 FVSLVVIVPPGVKHCYFYKPIADFEVEYQVVKGGHLDVGIFIRDPEGEPVAIRPPLSDSQVSVSVPKHFRLMPYAICLDNRKASYAYKNVYFSVDV-NLNWDNPNELERQAIETLRNNALANSQAQEANAAHVENIEKLMAQLDMIFGRLRRIEHMQQRSSNFDSADKSLMEENLERITTGSLFQVILMIAVATVQVGLIRSLFDQQSYF-YKIW 482          
BLAST of Transmembrane p24 trafficking protein 5 vs. TrEMBL
Match: A0A0V0J4W8 (GOLD domain-containing protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR157388 PE=3 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.744e-26
Identity = 69/223 (30.94%), Postives = 113/223 (50.67%), Query Frame = 3
Query:  336 GAYYIHNPSYVTFTLIVPSQSVECYYYTAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAIN-TPEYAQL---------------------NKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSKGGLGAKIW 938
            G  +    ++V+  ++V   S +CY+Y     F++++QVLKG   DI L V D N   + F+    + +  + V  +   + +++C DN ++S   K VY+ ID+  +N  N TPE  QL                       L+ M   + +I T L++ + LQ++ R+  A+DR +ME N + V  W   QI VM+ V  +Q +LIRSLFD K  L  ++W
Sbjct:  152 GETFFSTENFVSMVVVVRPSSKDCYFYEPETHFDVEFQVLKGDKLDIGLIVIDPNGVPIVFRDPVAEASTPIQVLDEFKRRPFAVCLDNRKASYGEKVVYLAIDL-RLNWRNPTPEDMQLMNSINFRIGQDKTKEQVRQHIENLERMSMIVDTIATRLHRAQRLQQRSRNNAAVDRVLMETNQQRVMAWSTFQIFVMVFVGIVQTLLIRSLFDEKSSL-YRLW 372          
BLAST of Transmembrane p24 trafficking protein 5 vs. TrEMBL
Match: A0A0R3VTA6 (NTF2 domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS459 PE=4 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 2.677e-26
Identity = 65/205 (31.71%), Postives = 108/205 (52.68%), Query Frame = 3
Query:  363 YVTFTLIVPSQSVECYYYTAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQL-------------NKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSKGGLGAKIW 938
            ++  T+ V     +CY+Y AA  F++D QVL G   DI L V+D +   V  +  + + ++ + VP     + Y+IC DN ++S   KKV++ ID+  +N  N     Q              N +++   SL  I   L++ + L ++ R+  A+DR++ME N + VT W   Q+ ++I+V  IQ  LIRSLFD +  L  ++W
Sbjct:  403 FIPLTVNVTPAVKDCYFYEAATGFDVDVQVLGGDGMDIGLAVFDPSGTPVVLRDPAGEASVSIAVPPHYQGRAYAICLDNRKASYGRKKVFLGIDL-RINWDNPSPAEQKIINQMKRNLKIDDNSVEIRRDSLDRISGLLHRTQRLNQRSRNNAAMDRAMMEANKDRVTSWSTFQVVLLILVGIIQTRLIRSLFDEQSSL-YRLW 605          
BLAST of Transmembrane p24 trafficking protein 5 vs. TrEMBL
Match: A0A504YPF8 (GOLD domain-containing protein OS=Fasciola gigantica OX=46835 GN=FGIG_01029 PE=3 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 3.664e-26
Identity = 69/226 (30.53%), Postives = 111/226 (49.12%), Query Frame = 3
Query:  363 YVTFTLIVPSQSVECYYYTAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQLNKLDLMHT------------------------SLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSKGGLGAKIWQKLHDLTGGR 968
            +V+  +IVPS S  CY+YT    F + +QV++GG  DI L V D   + V  Q+ S DG   + VP     + Y+ICFDN +++   K V +M+DV +VN  N P       LD++                           +  +Y  L++++ LQ++  +  A D+++ME N   V+   I+Q+ +M  V+  Q+ILIR+ FD       +IW     + G R
Sbjct:  180 FVSMAIIVPSGSKNCYFYTPILDFIVYHQVIRGGGMDIGLRVVDPEGRNVISQRPSEDGKFSITVPSHFRMRPYAICFDNRKATFGEKYVSVMVDV-DVNWDN-PSEEDKKALDILRKRSFAGAHIPEMKREYIESWRTIDERVEGLYGRLHRIKLLQQRSNNFAAADKALMESNLSRVSSRSIVQVILMFGVATFQVILIRAFFDPNSRF-YRIWFGKRSVAGAR 402          
BLAST of Transmembrane p24 trafficking protein 5 vs. TrEMBL
Match: A0A5K4F6B7 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 2.269e-25
Identity = 66/215 (30.70%), Postives = 109/215 (50.70%), Query Frame = 3
Query:  363 YVTFTLIVPSQSVECYYYTAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQ-----------------------LNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSKGGLGAKIW 938
            +V+  +IVP     CY+Y    +F+++YQVLKGG  DI + + D   + +  +   +D  + + VPK      Y+IC DN ++S   K VY  +D AN+N  N  E  +                          +D +   L  ++  L ++EH+Q++  + ++ D+S+ME N E +T   + Q+ +MI V+ +Q+ LIRSLFD K     KIW
Sbjct:  323 FVSLVVIVPPGVKHCYFYKPITNFDVEYQVLKGGHLDIGIFIRDPEGEPITIRPPLSDSQVSISVPKYFRLMPYAICLDNRKASYAYKNVYFSVD-ANLNWDNPSELERQAIETLRNNPLVNSQAQAASAEHAENIDKLMAQLDILFGRLRRIEHMQQRSSNFDSADKSLMEENLERITTGSLFQVVLMIAVATVQVGLIRSLFDQKSYF-YKIW 535          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Cavefish
Match: tmed1b (transmembrane emp24 domain-containing protein 1-like [Source:NCBI gene;Acc:103026656])

HSP 1 Score: 90.1225 bits (222), Expect = 1.499e-20
Identity = 54/192 (28.12%), Postives = 99/192 (51.56%), Query Frame = 3
Query:  375 TLIVPSQSVECYYYTAA--DSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVY--MMIDVANVNAINTPEYAQLN--------KLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            T ++P+   EC+Y +AA   + E++YQV+ G   D+   +   +  ++  +   +DG + ++ P +    DY  CFDN  S    K V+  ++++ +  +A    E+A L         KL+ +  S+ S++  L +   +Q   R+ EA DR+++E N   V+ W    + VM+VV+  Q+  +R LFD K
Sbjct:   38 TFVLPAGHTECFYQSAARNGTMEVEYQVIAGAGMDVDFSIISPHGVQLVSEFRRSDG-VHMVEPTE--EGDYQFCFDNSFSRFSEKMVFFEVILESSANDAGADDEWAGLGEPENLLEYKLEDIRESMDSVHRHLERSRQMQTVLRAFEARDRNLLEDNLWRVSFWSCTSLMVMLVVAFTQVYTVRRLFDDK 226          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Cavefish
Match: tmed5 (transmembrane emp24 domain-containing protein 5 [Source:NCBI gene;Acc:103032944])

HSP 1 Score: 86.2705 bits (212), Expect = 3.102e-19
Identity = 64/205 (31.22%), Postives = 98/205 (47.80%), Query Frame = 3
Query:  333 GGAYYIHNPSYVTFTLIVPSQSVECYYYTAAD--SFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQ--LNKLDLMHTSLTSIYTSLNQME-------HLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
             GA+     S  TFTL  P    EC++ T     S EI+YQVL G   D+   +   +   +      +DG   V   +     DY  CFDN  S+   K ++  + + N++    PE  +  +   DL+   L  I  ++N ++        +Q   R+ EA DR++ E NYE V +W    + +M+VVS IQ+ L+RSLFD K
Sbjct:   24 AGAFSQSLDSDFTFTL--PPGHKECFFQTMRKDASLEIEYQVLDGAGLDVDFYLSSPSGHVLVSDFRKSDGVHTVETEE----GDYMFCFDNTFSTVSEKIIFFELILDNMDDGQDPEDWKEFVQGADLLDMKLEDIMDTINSVKARLGKSLQIQTVLRAFEARDRNLQESNYERVNVWSCTNVVLMVVVSCIQVYLLRSLFDDK 222          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Cavefish
Match: tmed5 (transmembrane emp24 domain-containing protein 5 [Source:NCBI gene;Acc:103032944])

HSP 1 Score: 86.2705 bits (212), Expect = 3.164e-19
Identity = 64/205 (31.22%), Postives = 98/205 (47.80%), Query Frame = 3
Query:  333 GGAYYIHNPSYVTFTLIVPSQSVECYYYTAAD--SFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQ--LNKLDLMHTSLTSIYTSLNQME-------HLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
             GA+     S  TFTL  P    EC++ T     S EI+YQVL G   D+   +   +   +      +DG   V   +     DY  CFDN  S+   K ++  + + N++    PE  +  +   DL+   L  I  ++N ++        +Q   R+ EA DR++ E NYE V +W    + +M+VVS IQ+ L+RSLFD K
Sbjct:   24 AGAFSQSLDSDFTFTL--PPGHKECFFQTMRKDASLEIEYQVLDGAGLDVDFYLSSPSGHVLVSDFRKSDGVHTVETEE----GDYMFCFDNTFSTVSEKIIFFELILDNMDDGQDPEDWKEFVQGADLLDMKLEDIMDTINSVKARLGKSLQIQTVLRAFEARDRNLQESNYERVNVWSCTNVVLMVVVSCIQVYLLRSLFDDK 222          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Cavefish
Match: tmed5 (transmembrane emp24 domain-containing protein 5 [Source:NCBI gene;Acc:103032944])

HSP 1 Score: 85.8853 bits (211), Expect = 3.603e-19
Identity = 64/205 (31.22%), Postives = 98/205 (47.80%), Query Frame = 3
Query:  333 GGAYYIHNPSYVTFTLIVPSQSVECYYYTAAD--SFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQ--LNKLDLMHTSLTSIYTSLNQME-------HLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
             GA+     S  TFTL  P    EC++ T     S EI+YQVL G   D+   +   +   +      +DG   V   +     DY  CFDN  S+   K ++  + + N++    PE  +  +   DL+   L  I  ++N ++        +Q   R+ EA DR++ E NYE V +W    + +M+VVS IQ+ L+RSLFD K
Sbjct:   22 AGAFSQSLDSDFTFTL--PPGHKECFFQTMRKDASLEIEYQVLDGAGLDVDFYLSSPSGHVLVSDFRKSDGVHTVETEE----GDYMFCFDNTFSTVSEKIIFFELILDNMDDGQDPEDWKEFVQGADLLDMKLEDIMDTINSVKARLGKSLQIQTVLRAFEARDRNLQESNYERVNVWSCTNVVLMVVVSCIQVYLLRSLFDDK 220          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Cavefish
Match: tmed1a (transmembrane emp24 domain-containing protein 1-like [Source:NCBI gene;Acc:103031378])

HSP 1 Score: 70.0922 bits (170), Expect = 1.242e-13
Identity = 50/190 (26.32%), Postives = 86/190 (45.26%), Query Frame = 3
Query:  375 TLIVPSQSVECYYYTAAD--SFEIDYQVLKGGDYDIALGVYDYNNKKVA--FQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYM-------MIDVANVNAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDS 911
            T ++P  S +C++ T  +  S  ++YQVL G   D+   +   +  ++   F+KS     + ++ P      DY ICFDN  S    K V+M        +D      +  PE      LD +   + ++  +L +    Q   R+ EA DR ++E N   V+ W  I + +M+ V+  Q+  +R  F S
Sbjct:   34 TFLLPVGSTQCFFQTTVENSSMAVEYQVLAGSGLDVGFTLISPHGHRLVSVFRKSEG---LHLVDPTA--EGDYRICFDNSFSRLAEKIVFMEVVLGSQEVDDKTWTNLKEPEIMLGYNLDYIKEVIKAVDRNLERSAQTQAFLRAFEARDRYLLEDNLWRVSFWSSINLLLMLTVALAQVYTVRRFFQS 218          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Sea Lamprey
Match: tmed5 (transmembrane p24 trafficking protein 5 [Source:ZFIN;Acc:ZDB-GENE-040426-1302])

HSP 1 Score: 83.5741 bits (205), Expect = 5.920e-19
Identity = 54/193 (27.98%), Postives = 94/193 (48.70%), Query Frame = 3
Query:  372 FTLIVPSQSVECYY--YTAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVY--MMIDVANVNAINTPEYAQL--------NKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            FT  +P+   EC+Y   TA  S E++YQV+ G   D+   +     + +  +   ++G   V   +D    DY  CFDN  S    K V+  +++D   V   + P +            KL+ +  ++ +I T L +   +Q   R  EA DR + E N+E V +W  I + V+++V+ +Q+  +RSLF+ +
Sbjct:   30 FTFSLPAGRTECFYQALTAGASMEVEYQVIDGAGMDVDFSISSPTGQVLFAEYRKSEGLQSVEAKQD---GDYMFCFDNSFSHVSEKVVFFEVILDNMEVEKDDKPAWKDFVEVDEIIDMKLEDLQETMDNIKTRLGKSIQMQSVLRVYEARDRKLQETNFEMVNLWSGISMVVLVMVAGLQVYTLRSLFNDQ 219          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Sea Lamprey
Match: tmed5 (transmembrane p24 trafficking protein 5 [Source:ZFIN;Acc:ZDB-GENE-040426-1302])

HSP 1 Score: 80.4925 bits (197), Expect = 8.197e-18
Identity = 59/196 (30.10%), Postives = 94/196 (47.96%), Query Frame = 3
Query:  360 SYVTFTLIVPSQSVECYYYTA--ADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVN-AINTPEYAQL--------NKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            S +TF+L  P    EC+Y         EI+YQV+ GG+ D+   V   +   +  +    DG   V V ++    DY ICFDN  S    K ++  I + ++      PE+            KL+ +  SL S+   L++   +Q   R+ EA DR++ E N   V +W    +  ++ VSA+Q+ L+RSLF+ K
Sbjct:   37 SDLTFSL-APGHR-ECFYQPVKPGTVVEIEYQVIDGGELDVDFTVTAPSGTVLLAEHRQGDGVHSVDVKEE---GDYEICFDNSFSHISEKLIFFEILLDHMQPEEERPEWMDAISADHLIGMKLEDLQESLNSVKARLSRSHQIQTVLRAFEARDRNLQESNLARVNLWSAASVLALMGVSALQVYLVRSLFEDK 227          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Sea Lamprey
Match: tmed3 (transmembrane p24 trafficking protein 3 [Source:ZFIN;Acc:ZDB-GENE-030131-8335])

HSP 1 Score: 62.3882 bits (150), Expect = 1.445e-11
Identity = 52/194 (26.80%), Postives = 87/194 (44.85%), Query Frame = 3
Query:  366 VTFTLIVPSQSVECYYYTAADSFEI--DYQVLKGGDYDI---ALGVYD---YNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLF-DSKGG 920
            VTF L     + +C+Y       ++  D+QV+ GG+YD+     G +D   YN  +  +   +     +           Y ICF N  S+   K VY  + V     +   E  ++  L  M ++  +I+  L  +++ Q + R  E  DR   E     V MW I +  +++VV   Q++L++S F D KGG
Sbjct:   45 VTFEL--KDNAKQCFYEDIDQGVKVTLDFQVITGGNYDVDCRVKGPHDSVLYNENRKQYDSYAWTTEQR---------GTYEICFSNEFSTFTHKTVYFDLQVGEEAPLFRDEGTRVVALTQMESACVTIHEGLKSVDNYQTQHRLQETQDRHQAEVLNSRVNMWSIGETIILVVVGVGQVMLLKSFFSDKKGG 227          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Sea Lamprey
Match: tmed7 (transmembrane p24 trafficking protein 7 [Source:ZFIN;Acc:ZDB-GENE-040426-2570])

HSP 1 Score: 53.9138 bits (128), Expect = 8.583e-9
Identity = 43/187 (22.99%), Postives = 83/187 (44.39%), Query Frame = 3
Query:  366 VTFTLIVPSQSVECYYY--TAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQ--KSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
             T  L +P+Q   C +       +   ++QV+ GG+YD+   V +  + ++ ++  +   D ++     K +    Y+ICF N  S+   K VY    + +   +          L  M ++  +I+ +L  +   Q   R  EA DR   E     VT+W + +  +++ V   Q++L++S F  K
Sbjct:   28 CTAHLGLPAQQCRCLFMPIKVGRTCSKEWQVITGGNYDVDCRV-EGPSGEILYKEMRKQYDSHVWTAEKKGI----YAICFSNEFSTFSHKTVYFDWQIGDEKPVGKASTNGAVSLTQMESACVTIHEALKSVISYQTHHRLEEAQDRYQAEHLNSRVTLWSVGETLMLLSVVVGQVMLLKSFFADK 209          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Sea Lamprey
Match: tmed2 (transmembrane p24 trafficking protein 2 [Source:ZFIN;Acc:ZDB-GENE-030131-269])

HSP 1 Score: 43.8986 bits (102), Expect = 8.566e-6
Identity = 27/112 (24.11%), Postives = 50/112 (44.64%), Query Frame = 3
Query:  582 YSICFDNYQSSRDTKKVYMMIDVANV-NAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            Y  CF N  S+   K V   ID+       +    A  NKL+ M   +  + T++  ++H QE     E I RS+ +     V +W   +  V++ ++  Q+  ++  F+ +
Sbjct:   32 YKFCFGNKMSTMTPKMVMFTIDMGETPKGQDMETEAHQNKLEEM---INELATAMTAVKHEQEYMEVRERIHRSVNDNTNSRVVLWAFFEALVLVAMTLGQIYYLKRFFEVR 140          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Nematostella
Match: EDO35763 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKI6])

HSP 1 Score: 55.8398 bits (133), Expect = 3.490e-9
Identity = 44/185 (23.78%), Postives = 83/185 (44.86%), Query Frame = 3
Query:  372 FTLIVPSQSVECYYYTAAD--SFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINT-----PEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLF 905
            FT  V     +C+Y T     + +++YQV++GGD DI        + K+A +          +V ++    +Y  CFDN  S+  +K ++  + V   + I        E  + +  D    +L ++   L++ EH+Q    S  A D  + +     V  W +IQ   +I V+ +Q+ +++  F
Sbjct:   35 FTFRVDPGKRDCFYETIKRNVTLDVEYQVIEGGDLDIGF-TLQAPSGKIAIEDGHRTDEAHSLVTEE--EGEYEFCFDNTFSTVASKAIFADLGVDFEDDIQKMIGIKDENLEEDLHDRFVRTLENVRVDLDKAEHIQNFISSAAARDFRLAKSKDSRVFWWSLIQSVALIGVAIVQVNVVKHFF 216          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Nematostella
Match: EDO42051 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2I7])

HSP 1 Score: 54.299 bits (129), Expect = 9.808e-9
Identity = 46/204 (22.55%), Postives = 85/204 (41.67%), Query Frame = 3
Query:  357 PSYVTFTLIVPS---------------QSVECYYYTAADSFE--IDYQVLKGGDYDIALGVYDYNNKKV-AFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
             S+VTFT++  S                + +C+Y       +  +++QV+ GG+YD+ + +YD N K++ + QK   D +   +    +    Y  CF N  S+   K VY          +          L  M T+  +I+ +L      Q   R  E+  R + E   E V  W + +  ++++V   Q+ ++R  F  +
Sbjct:    6 QSFVTFTVLALSCILVSCTELTFELEDNARQCFYEELKKDAKATLEFQVITGGNYDVDVILYDINEKELYSVQKKQYDSHTFTVEQPGI----YKFCFSNEFSTISHKTVYFDFQSGEETQLTKTMGNHHTALTQMETACVTIHENLKIAIDYQTHHRLRESQGRDMAEYLNERVQWWSVGESVLIVIVGICQVFILRQFFAER 205          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Medaka
Match: tmed1b (transmembrane emp24 domain-containing protein 1 [Source:NCBI gene;Acc:101156470])

HSP 1 Score: 91.6633 bits (226), Expect = 3.977e-21
Identity = 55/194 (28.35%), Postives = 96/194 (49.48%), Query Frame = 3
Query:  372 FTLIVPSQSVECYYYTAA--DSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMI--DVANVNAINTPEYAQLN---------KLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
             T ++P+ S EC+Y +A    + E++YQV+ G   D+   +      ++  +   +DG + V+ P +    DY ICFDN  S    K V+  I  +    +A    E+  L+         KL+ +  S+ ++Y  L++   +Q   R+ EA DR+++E N   V+ W    + VM+ V+  Q+  +R LFD K
Sbjct:   39 LTFLLPAGSSECFYQSAVQNGTMEVEYQVIAGAGMDVDFTIVSPEGVRLIVESRRSDG-VHVVEPTE--GGDYQICFDNSFSRFSEKMVFFEILTEAPGGDAGGDEEWPMLDEPDGSLLEYKLEDIRDSMDAVYRRLDRSRQMQTVLRAFEARDRNLLEDNLWRVSFWSCASVLVMLCVALTQVYTVRKLFDDK 229          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Medaka
Match: tmed1a (transmembrane emp24 domain-containing protein 1 [Source:NCBI gene;Acc:101161889])

HSP 1 Score: 78.1814 bits (191), Expect = 2.048e-16
Identity = 53/196 (27.04%), Postives = 99/196 (50.51%), Query Frame = 3
Query:  363 YVTFTLIVPSQSVECYYY--TAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVN--AINTPEYAQLN--------KLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            ++ FT I+P+ S EC++   T  DS E++YQV+ G   D+   +   N  ++      N   I ++ P   ++ DY +CFDN  S    K V+  + V + N  A    ++            +L+ + +S+ S++  L +   +Q   R+ E+ DR ++E N   V+ W  I + V++ V+ +Q+  ++ LFD+K
Sbjct:   29 HMEFTFILPAGSTECFFQSTTRNDSMEVEYQVIAGSGLDVGFALISPNGHRL-ISDFRNSHGIHMVDPA--VDGDYRLCFDNSFSKLSEKMVFFEVVVNSQNNAAGGREDWEDFTVTESTVDYRLEDIRSSMESVHRHLEKSRQVQAVLRAFESRDRYLLEDNLWRVSFWSCINLLVLLTVAVVQIYTLQRLFDNK 221          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Medaka
Match: tmed7 (transmembrane emp24 domain-containing protein 7 [Source:NCBI gene;Acc:101168626])

HSP 1 Score: 61.6178 bits (148), Expect = 8.179e-11
Identity = 48/182 (26.37%), Postives = 79/182 (43.41%), Query Frame = 3
Query:  375 TLIVPSQSVECYY--YTAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            T  +P  + +C+Y   T      +++QV+ GG YD+   + D +   +  +      +      K   N  Y  CF N  S+   K VY    V +   +  P   ++  L  M ++  SI+ +L  +   Q   R  EA  RS  E     V  W I +  +++VVS  Q++L+RS F  K
Sbjct:   21 TFELPDNAKQCFYEDITVGTKCTLEFQVITGGHYDVDCRLEDPDGTTLYKEMKKQYDSFTFTAAK---NGTYKFCFSNEFSTFTHKTVYFDFQVGDDPPL-FPNENRVTALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAFWSIGEALILLVVSISQVVLLRSFFSDK 198          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Medaka
Match: tmed3 (transmembrane emp24 domain-containing protein 3 [Source:NCBI gene;Acc:101155019])

HSP 1 Score: 61.2326 bits (147), Expect = 1.068e-10
Identity = 49/190 (25.79%), Postives = 81/190 (42.63%), Query Frame = 3
Query:  375 TLIVPSQSVECYYYTAAD--SFEIDYQVLKGGDYDIALGVYD------YNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSKGG 920
            T  +P    +C+Y        F+ID+QV+ GG+YD+   V D      YN +K  +   S+   +K +         Y +CF N  S+   K VY+     +   +          L  + +S  +I+  L  +   Q   R  EA DR+  E   + VT W   +   + V+   Q++L++S F  K G
Sbjct:   22 TFELPDNEKQCFYEELEKDVKFDIDFQVISGGNYDVDSFVTDPQNNVLYNERKKQYDSFSHTTTMKGV---------YKVCFSNEFSTFTHKTVYLDFRYGDEEPL-LQSMTGSTALTQLESSCVAIHEILKVVADSQTWYRLREAQDRTKAEHLLQRVTYWSFGEAVFLFVIGIGQVMLLKSFFSEKKG 201          
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Medaka
Match: tmed7 (transmembrane emp24 domain-containing protein 7 [Source:NCBI gene;Acc:101168626])

HSP 1 Score: 61.2326 bits (147), Expect = 1.263e-10
Identity = 48/182 (26.37%), Postives = 79/182 (43.41%), Query Frame = 3
Query:  375 TLIVPSQSVECYY--YTAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            T  +P  + +C+Y   T      +++QV+ GG YD+   + D +   +  +      +      K   N  Y  CF N  S+   K VY    V +   +  P   ++  L  M ++  SI+ +L  +   Q   R  EA  RS  E     V  W I +  +++VVS  Q++L+RS F  K
Sbjct:   28 TFELPDNAKQCFYEDITVGTKCTLEFQVVTGGHYDVDCRLEDPDGTTLYKEMKKQYDSFTFTAAK---NGTYKFCFSNEFSTFTHKTVYFDFQVGDDPPL-FPNENRVTALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAFWSIGEALILLVVSISQVVLLRSFFSDK 205          
BLAST of Transmembrane p24 trafficking protein 5 vs. Planmine SMEST
Match: SMESG000078204.1 (SMESG000078204.1)

HSP 1 Score: 586.26 bits (1510), Expect = 0.000e+0
Identity = 283/283 (100.00%), Postives = 283/283 (100.00%), Query Frame = 3
Query:  123 TFVILNLCEEHIPRSIDPDSVNIHKKISKDSVNPPPTTKETDESLPIKPILSEKFIPSVDGKMNPTDTISGGAYYIHNPSYVTFTLIVPSQSVECYYYTAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSKGGLGAKIWQKLHDLTGGRF 971
            TFVILNLCEEHIPRSIDPDSVNIHKKISKDSVNPPPTTKETDESLPIKPILSEKFIPSVDGKMNPTDTISGGAYYIHNPSYVTFTLIVPSQSVECYYYTAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSKGGLGAKIWQKLHDLTGGRF
Sbjct:   10 TFVILNLCEEHIPRSIDPDSVNIHKKISKDSVNPPPTTKETDESLPIKPILSEKFIPSVDGKMNPTDTISGGAYYIHNPSYVTFTLIVPSQSVECYYYTAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSKGGLGAKIWQKLHDLTGGRF 292          
BLAST of Transmembrane p24 trafficking protein 5 vs. Planmine SMEST
Match: SMESG000036322.1 (SMESG000036322.1)

HSP 1 Score: 121.709 bits (304), Expect = 5.114e-31
Identity = 67/201 (33.33%), Postives = 115/201 (57.21%), Query Frame = 3
Query:  285 FIPSVDGKMNPTDTISGGAYYIHNPSYVTFTLIVPSQSVECYYYTAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGN-IKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQL 884
            ++ SV+GK N T  +  G     + SYV F ++V    V+C+YY A + F +++QVL+GG +D+AL V D   K +  Q   N  N  ++ + K+  N+ Y ICFDN  +S++ KK++  ID   + +       +L   D +H +L  ++ S+  +  +  ++RS+E IDR +ME N   VT+W +I + ++I V+A Q+
Sbjct:   20 YLSSVEGKANGTINLFEG----ESSSYVAFIILVAPSKVDCFYYLAQNDFSVEFQVLRGGYHDVALFVED-PFKNLIHQFPPNQNNYFRIQILKEFENRFYRICFDNRPASKNLKKIFFKIDGEFMYS-----NRELKGTDSLHFTLYGVFQSIRIIRDIYHRKRSMENIDRHLMETNLMSVTLWALIHVLIIIAVAAFQI 210          
BLAST of Transmembrane p24 trafficking protein 5 vs. Planmine SMEST
Match: SMESG000036322.1 (SMESG000036322.1)

HSP 1 Score: 121.709 bits (304), Expect = 6.724e-31
Identity = 67/201 (33.33%), Postives = 115/201 (57.21%), Query Frame = 3
Query:  285 FIPSVDGKMNPTDTISGGAYYIHNPSYVTFTLIVPSQSVECYYYTAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGN-IKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQL 884
            ++ SV+GK N T  +  G     + SYV F ++V    V+C+YY A + F +++QVL+GG +D+AL V D   K +  Q   N  N  ++ + K+  N+ Y ICFDN  +S++ KK++  ID   + +       +L   D +H +L  ++ S+  +  +  ++RS+E IDR +ME N   VT+W +I + ++I V+A Q+
Sbjct:   32 YLSSVEGKANGTINLFEG----ESSSYVAFIILVAPSKVDCFYYLAQNDFSVEFQVLRGGYHDVALFVED-PFKNLIHQFPPNQNNYFRIQILKEFENRFYRICFDNRPASKNLKKIFFKIDGEFMYS-----NRELKGTDSLHFTLYGVFQSIRIIRDIYHRKRSMENIDRHLMETNLMSVTLWALIHVLIIIAVAAFQI 222          
BLAST of Transmembrane p24 trafficking protein 5 vs. Planmine SMEST
Match: SMESG000038972.1 (SMESG000038972.1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.273e-12
Identity = 49/183 (26.78%), Postives = 82/183 (44.81%), Query Frame = 3
Query:  372 FTLIVPSQSVECYY--YTAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQLNKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSK 914
            FT  +P +  +C+Y    + D   I+YQV+ GG YD+ + + D +N  + + K          +P   +N  Y +CF N  SS   K +Y              E ++ + L  M TS  +++ ++N +   Q   R  E+I R   E     V  W I Q  +++ V   Q+ ++RS F  K
Sbjct:   19 FTFELPDRQRQCFYEDLKSGDRNVIEYQVISGGHYDVDIVIKDPSN-NIIYNKERKQYESHSFIPS--VNGIYQVCFSNEFSSITHKTIYFEWQSTEKRE-EGFEKSKSSALTFMETSAVNLHEAMNNINEEQTHIRLRESIGRYFAEELNSRVLYWSIGQALLIVAVGIGQVFVLRSFFYDK 197          
BLAST of Transmembrane p24 trafficking protein 5 vs. Planmine SMEST
Match: SMESG000034989.1 (SMESG000034989.1)

HSP 1 Score: 56.225 bits (134), Expect = 4.821e-9
Identity = 50/191 (26.18%), Postives = 90/191 (47.12%), Query Frame = 3
Query:  372 FTLIVPSQSVECYYYTAA--DSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNIKVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQL----NKLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCIIQITVMIVVSAIQLILIRSLFDSKGGLG 926
            FT  +P +   C+Y        +   Y+V+KGG  D+ + +    NKK  ++K+ N  +   +  K      Y+ICF N  SS   K V+  I      ++   E A +    + L LM TSL +I+  L+++E  Q   R+ E   R++ +   + V  W ++    +IV    Q++++++ F  K  +G
Sbjct:   24 FTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIA-PNKKNVYEKNKN--HFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQ--EEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDKPIIG 209          
The following BLAST results are available for this feature:
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TMED51.725e-1731.61transmembrane p24 trafficking protein 5 [Source:HG... [more]
TMED35.644e-1125.13transmembrane p24 trafficking protein 3 [Source:HG... [more]
TMED73.295e-1027.04transmembrane p24 trafficking protein 7 [Source:HG... [more]
TMED18.152e-1024.60transmembrane p24 trafficking protein 1 [Source:HG... [more]
TMED26.448e-721.67transmembrane p24 trafficking protein 2 [Source:HG... [more]
back to top
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
K08E4.61.389e-2130.19pep chromosome:WBcel235:IV:12077107:12078162:-1 ge... [more]
F57B10.55.470e-1024.86pep chromosome:WBcel235:I:6562699:6563660:1 gene:W... [more]
back to top
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
opm1.349e-1628.37gene:FBgn0264389 transcript:FBtr0073968[more]
opm1.349e-1628.37gene:FBgn0264389 transcript:FBtr0340429[more]
CG317871.380e-1225.94gene:FBgn0051787 transcript:FBtr0081055[more]
CHOp247.859e-1123.40gene:FBgn0029709 transcript:FBtr0343566[more]
CHOp247.859e-1123.40gene:FBgn0029709 transcript:FBtr0070675[more]
back to top
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmed1b4.571e-2330.14transmembrane p24 trafficking protein 1b [Source:Z... [more]
tmed1a1.124e-1829.02transmembrane p24 trafficking protein 1a [Source:Z... [more]
tmed52.408e-1829.69transmembrane p24 trafficking protein 5 [Source:ZF... [more]
tmed52.908e-1829.69transmembrane p24 trafficking protein 5 [Source:ZF... [more]
tmed31.578e-1228.95transmembrane p24 trafficking protein 3 [Source:ZF... [more]
back to top
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmed54.026e-2028.50transmembrane p24 trafficking protein 5 [Source:NC... [more]
tmed17.038e-1928.28transmembrane p24 trafficking protein 1 [Source:NC... [more]
serinc28.946e-925.82serine incorporator 2 [Source:Xenbase;Acc:XB-GENE-... [more]
serinc22.295e-825.82serine incorporator 2 [Source:Xenbase;Acc:XB-GENE-... [more]
tmed22.099e-721.67transmembrane p24 trafficking protein 2 [Source:NC... [more]
back to top
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tmed54.765e-1931.44transmembrane p24 trafficking protein 5 [Source:MG... [more]
Tmed12.921e-1024.48transmembrane p24 trafficking protein 1 [Source:MG... [more]
Tmed72.974e-1025.93transmembrane p24 trafficking protein 7 [Source:MG... [more]
Tmed37.706e-1025.53transmembrane p24 trafficking protein 3 [Source:MG... [more]
Tmed55.441e-831.31transmembrane p24 trafficking protein 5 [Source:MG... [more]
back to top
BLAST of Transmembrane p24 trafficking protein 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6AXN3|TMED5_RAT2.660e-1930.84Transmembrane emp24 domain-containing protein 5 OS... [more]
sp|Q9CXE7|TMED5_MOUSE3.333e-1831.44Transmembrane emp24 domain-containing protein 5 OS... [more]
sp|Q28BQ6|TMED1_XENTR3.728e-1828.28Transmembrane emp24 domain-containing protein 1 OS... [more]
sp|Q9Y3A6|TMED5_HUMAN8.285e-1731.61Transmembrane emp24 domain-containing protein 5 OS... [more]
sp|Q5R809|TMED5_PONAB8.533e-1731.61Transmembrane emp24 domain-containing protein 5 OS... [more]
back to top
BLAST of Transmembrane p24 trafficking protein 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DV049.228e-2731.63Transmembrane emp24 domain-containing protein isof... [more]
A0A0V0J4W81.744e-2630.94GOLD domain-containing protein (Fragment) OS=Schis... [more]
A0A0R3VTA62.677e-2631.71NTF2 domain-containing protein OS=Taenia asiatica ... [more]
A0A504YPF83.664e-2630.53GOLD domain-containing protein OS=Fasciola giganti... [more]
A0A5K4F6B72.269e-2530.70Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmed1b1.499e-2028.13transmembrane emp24 domain-containing protein 1-li... [more]
tmed53.102e-1931.22transmembrane emp24 domain-containing protein 5 [S... [more]
tmed53.164e-1931.22transmembrane emp24 domain-containing protein 5 [S... [more]
tmed53.603e-1931.22transmembrane emp24 domain-containing protein 5 [S... [more]
tmed1a1.242e-1326.32transmembrane emp24 domain-containing protein 1-li... [more]
back to top
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmed55.920e-1927.98transmembrane p24 trafficking protein 5 [Source:ZF... [more]
tmed58.197e-1830.10transmembrane p24 trafficking protein 5 [Source:ZF... [more]
tmed31.445e-1126.80transmembrane p24 trafficking protein 3 [Source:ZF... [more]
tmed78.583e-922.99transmembrane p24 trafficking protein 7 [Source:ZF... [more]
tmed28.566e-624.11transmembrane p24 trafficking protein 2 [Source:ZF... [more]
back to top
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO357633.490e-923.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420519.808e-922.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transmembrane p24 trafficking protein 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmed1b3.977e-2128.35transmembrane emp24 domain-containing protein 1 [S... [more]
tmed1a2.048e-1627.04transmembrane emp24 domain-containing protein 1 [S... [more]
tmed78.179e-1126.37transmembrane emp24 domain-containing protein 7 [S... [more]
tmed31.068e-1025.79transmembrane emp24 domain-containing protein 3 [S... [more]
tmed71.263e-1026.37transmembrane emp24 domain-containing protein 7 [S... [more]
back to top
BLAST of Transmembrane p24 trafficking protein 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078204.10.000e+0100.00SMESG000078204.1[more]
SMESG000036322.15.114e-3133.33SMESG000036322.1[more]
SMESG000036322.16.724e-3133.33SMESG000036322.1[more]
SMESG000038972.11.273e-1226.78SMESG000038972.1[more]
SMESG000034989.14.821e-926.18SMESG000034989.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001521 ID=SMED30001521|Name=Transmembrane p24 trafficking protein 5|organism=Schmidtea mediterranea sexual|type=transcript|length=1105bp
TAAAATTTTAGAAATCTTTGTAAATTTTCAAATTTATTCGTTATTCTTAA
CTTCCATACTATTTCTATCTAATAAAATATTAATTTCTATTAAAAATGAT
TTTAAAATTTATATTTTTTCTAACTTTTGTGATTTTAAATTTGTGTGAAG
AGCATATTCCAAGATCTATTGATCCTGATTCAGTAAATATCCATAAAAAA
ATATCAAAAGATTCAGTAAATCCTCCTCCAACTACTAAAGAAACTGATGA
ATCGTTACCAATAAAGCCTATATTATCGGAGAAATTTATCCCAAGTGTAG
ATGGAAAAATGAATCCCACAGATACTATAAGTGGAGGAGCATATTATATC
CATAACCCATCATATGTAACATTTACTTTAATTGTTCCATCTCAAAGTGT
CGAATGCTATTACTACACAGCAGCGGATTCATTTGAAATCGATTATCAAG
TTTTAAAAGGTGGTGATTACGACATAGCACTGGGTGTTTATGATTACAAC
AACAAAAAAGTCGCTTTTCAAAAATCTTCAAATGATGGGAACATAAAAGT
AATTGTGCCCAAAGACATGCTAAACAAAGATTATTCAATCTGTTTTGATA
ATTATCAATCAAGCCGCGACACCAAAAAGGTCTATATGATGATTGATGTA
GCAAACGTTAATGCAATCAATACACCGGAATATGCTCAACTAAACAAATT
GGATCTTATGCATACGTCATTGACATCGATTTATACGTCATTGAATCAAA
TGGAGCACTTACAGGAAAAGCAAAGGTCCATTGAAGCCATTGATAGAAGT
ATTATGGAAAGGAATTATGAGTACGTTACAATGTGGTGCATCATTCAAAT
TACCGTTATGATTGTCGTATCTGCTATCCAATTGATTTTAATCCGAAGTC
TTTTTGATTCTAAAGGCGGTTTGGGAGCAAAAATTTGGCAAAAACTTCAC
GATTTAACTGGCGGAAGATTTTGAAATTTAATAAAGCTTCCAAAACAAAT
ATTAATATTCGATCAAATGTGACTTAATGTTCTCCGGTTATAGTGCATTA
ATGAATGATATTGTAATGTTTTATGATTAATATATTTTGTTGTTTTTAAA
AAAAA
back to top

protein sequence of SMED30001521-orf-1

>SMED30001521-orf-1 ID=SMED30001521-orf-1|Name=SMED30001521-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=293bp
MILKFIFFLTFVILNLCEEHIPRSIDPDSVNIHKKISKDSVNPPPTTKET
DESLPIKPILSEKFIPSVDGKMNPTDTISGGAYYIHNPSYVTFTLIVPSQ
SVECYYYTAADSFEIDYQVLKGGDYDIALGVYDYNNKKVAFQKSSNDGNI
KVIVPKDMLNKDYSICFDNYQSSRDTKKVYMMIDVANVNAINTPEYAQLN
KLDLMHTSLTSIYTSLNQMEHLQEKQRSIEAIDRSIMERNYEYVTMWCII
QITVMIVVSAIQLILIRSLFDSKGGLGAKIWQKLHDLTGGRF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR015720TMP21-related
IPR036598GOLD_dom_sf
IPR009038GOLD_dom
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0015031protein transport
GO:0090161Golgi ribbon formation
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0005793endoplasmic reticulum-Golgi intermediate compartment
GO:0005794Golgi apparatus
GO:0005801cis-Golgi network
GO:0016020membrane
GO:0033116endoplasmic reticulum-Golgi intermediate compartment membrane
GO:0070971endoplasmic reticulum exit site
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009038GOLD domainSMARTSM01190EMP24_GP25L_2coord: 92..271
e-value: 1.4E-32
score: 124.2
IPR009038GOLD domainPFAMPF01105EMP24_GP25Lcoord: 93..270
e-value: 1.1E-26
score: 93.9
IPR009038GOLD domainPROSITEPS50866GOLDcoord: 61..185
score: 9.691
NoneNo IPR availablePANTHERPTHR22811:SF59OPOSSUM, ISOFORM Acoord: 92..273
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.77
NoneNo IPR availableTMHMMTMhelixcoord: 243..265
IPR015720TMP21-relatedPANTHERPTHR22811TRANSMEMBRANE EMP24 DOMAIN-CONTAINING PROTEINcoord: 92..273
IPR036598GOLD domain superfamilySUPERFAMILYSSF101576Supernatant protein factor (SPF), C-terminal domaincoord: 109..193