Autophagy-related protein 16-1

Overview
NameAutophagy-related protein 16-1
Smed IDSMED30001519
Length (bp)1772
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Autophagy-related protein 16-1 (SMED30001519) t-SNE clustered cells

Violin plots show distribution of expression levels for Autophagy-related protein 16-1 (SMED30001519) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Autophagy-related protein 16-1 (SMED30001519) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Autophagy-related protein 16-1 (SMED30001519) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001519

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30001519h1SMcG0011971 dd_Smed_v4_3345_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30001519h1SMcG0011971 dd_Smed_v4_3345_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001519h1SMcG0011971 dd_Smed_v4_3345_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Autophagy-related protein 16-1 vs. Ensembl Human
Match: ATG16L1 (autophagy related 16 like 1 [Source:HGNC Symbol;Acc:HGNC:21498])

HSP 1 Score: 284.648 bits (727), Expect = 3.088e-89
Identity = 136/300 (45.33%), Postives = 201/300 (67.00%), Query Frame = 1
Query:  736 LPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            +P       DAH+GE+  V+FSP    LATGG DR++K+W      C++K +L+G N  + +++FDS+ S++L AS  D + R+W++ DYR+R +LTGHS KV++ +FL DN RIV+GS DRTLKLWD R++ C+KT+ A S+C+D+V C+   +M SGHFDKK+R WD R +    ++ L  +IT LD++ ++  LL+C +DD L+ IDLR N   Q F+ P FK G+D  R  FSPDG YVAAGS +GS++IW+  TGK+EK L K  ++ I  V W P  + + S ++  +  +W +
Sbjct:  147 VPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASN-DFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIV-CTEQCVM-SGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQ 443          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Human
Match: ATG16L1 (autophagy related 16 like 1 [Source:HGNC Symbol;Acc:HGNC:21498])

HSP 1 Score: 284.648 bits (727), Expect = 3.088e-89
Identity = 136/300 (45.33%), Postives = 201/300 (67.00%), Query Frame = 1
Query:  736 LPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            +P       DAH+GE+  V+FSP    LATGG DR++K+W      C++K +L+G N  + +++FDS+ S++L AS  D + R+W++ DYR+R +LTGHS KV++ +FL DN RIV+GS DRTLKLWD R++ C+KT+ A S+C+D+V C+   +M SGHFDKK+R WD R +    ++ L  +IT LD++ ++  LL+C +DD L+ IDLR N   Q F+ P FK G+D  R  FSPDG YVAAGS +GS++IW+  TGK+EK L K  ++ I  V W P  + + S ++  +  +W +
Sbjct:  147 VPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASN-DFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIV-CTEQCVM-SGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQ 443          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Human
Match: ATG16L1 (autophagy related 16 like 1 [Source:HGNC Symbol;Acc:HGNC:21498])

HSP 1 Score: 286.189 bits (731), Expect = 2.996e-88
Identity = 136/300 (45.33%), Postives = 201/300 (67.00%), Query Frame = 1
Query:  736 LPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            +P       DAH+GE+  V+FSP    LATGG DR++K+W      C++K +L+G N  + +++FDS+ S++L AS  D + R+W++ DYR+R +LTGHS KV++ +FL DN RIV+GS DRTLKLWD R++ C+KT+ A S+C+D+V C+   +M SGHFDKK+R WD R +    ++ L  +IT LD++ ++  LL+C +DD L+ IDLR N   Q F+ P FK G+D  R  FSPDG YVAAGS +GS++IW+  TGK+EK L K  ++ I  V W P  + + S ++  +  +W +
Sbjct:  291 VPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASN-DFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIV-CTEQCVM-SGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQ 587          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Human
Match: ATG16L1 (autophagy related 16 like 1 [Source:HGNC Symbol;Acc:HGNC:21498])

HSP 1 Score: 286.189 bits (731), Expect = 2.996e-88
Identity = 136/300 (45.33%), Postives = 201/300 (67.00%), Query Frame = 1
Query:  736 LPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            +P       DAH+GE+  V+FSP    LATGG DR++K+W      C++K +L+G N  + +++FDS+ S++L AS  D + R+W++ DYR+R +LTGHS KV++ +FL DN RIV+GS DRTLKLWD R++ C+KT+ A S+C+D+V C+   +M SGHFDKK+R WD R +    ++ L  +IT LD++ ++  LL+C +DD L+ IDLR N   Q F+ P FK G+D  R  FSPDG YVAAGS +GS++IW+  TGK+EK L K  ++ I  V W P  + + S ++  +  +W +
Sbjct:  291 VPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASN-DFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIV-CTEQCVM-SGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQ 587          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Human
Match: ATG16L1 (autophagy related 16 like 1 [Source:HGNC Symbol;Acc:HGNC:21498])

HSP 1 Score: 286.574 bits (732), Expect = 4.606e-88
Identity = 136/300 (45.33%), Postives = 201/300 (67.00%), Query Frame = 1
Query:  736 LPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            +P       DAH+GE+  V+FSP    LATGG DR++K+W      C++K +L+G N  + +++FDS+ S++L AS  D + R+W++ DYR+R +LTGHS KV++ +FL DN RIV+GS DRTLKLWD R++ C+KT+ A S+C+D+V C+   +M SGHFDKK+R WD R +    ++ L  +IT LD++ ++  LL+C +DD L+ IDLR N   Q F+ P FK G+D  R  FSPDG YVAAGS +GS++IW+  TGK+EK L K  ++ I  V W P  + + S ++  +  +W +
Sbjct:  310 VPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASN-DFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIV-CTEQCVM-SGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQ 606          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Celegans
Match: atg-16.2 (Autophagic-related protein 16.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09406])

HSP 1 Score: 207.994 bits (528), Expect = 9.278e-60
Identity = 168/557 (30.16%), Postives = 274/557 (49.19%), Query Frame = 1
Query:   52 DKNDFKTLIKARLSERNEKESLVNKKIIFDYEIILCRFNTSQKQLDSLKYENEKLRSSVPVSNDQTISRKVYDMQEELTNAVKEKSALNIKILEFKLLCNNKDKDLQDLKQNI---HSLKDQISKQEELIRTSSDTIRK----LEDIKRTLTDEISA------NLMAY-RSLDTKYRELEESSYVLKDTVKKLQQALXXXXXXXXXXXXXXXQDALKQTLIEA----------ANSTVDIDLMKMKNIYITN-LPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIW--SHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGL--MISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLK---DQTAGIICVHWCPGSNVLASCERNKRVAIW 1626
            ++  F+  I  RL +R  ++  V K +  +Y ++  +   S +   S+   +E  + +V   ND     ++  M+EE+ N  + KS                D+DL D  + +    S    +S Q + +R  +D I K    LE+    L +E S       +L+A    L  K  +L+   + L + +++LQ+   +  N E   + +  Q  +++ + +A          A+S        +    +T+ LP ++K  L  H+GE+  V +     F AT GSD K++IW  S N       +TL+GC G V  +D+DS     L AS+ D +CRLW++   R+  + +GH++KV + R    +  +++GS DRT+K WD  +  C+K+ L  S   D+V   G+     IS HFDKK+R WD R    T  + L  +++ LDIS D   +LA  +DD+L  ID+R    I  ++  Q+K   D  R  FS  G+YV AGS + SVFIWN++T KLEK +K     +A I+ + W P    L +C+R K   +W
Sbjct:    4 NRTSFRLEILNRLCKRERQQRCV-KDMFKNYSLLDEQLQQSHRSR-SVSVNDEHFKGNV---ND-----RLAVMKEEMANVYRMKS--------------KNDQDLIDANRKLADSESRYSLVSSQRDKLRIETDAIVKKMTVLENELAELKEENSVINTERVSLVATCNYLTEKKTQLDNERFQLLNRIRELQEKSAEFMNAEIALQEERAQMRIREQIAKATADLNLGDERASSAFGTSPETLDEFMMTDVLPSEVKFKLSTHDGEVHDVEWMSDDTF-ATAGSDSKVQIWRVSPNKTDASKVSTLSGCLGPVNRLDYDSQRHVCL-ASSNDKTCRLWNIDSQRLLSTFSGHTDKVSSARLFQSHN-VISGSADRTIKNWDISSIRCLKSYLVGSTVFDIVAKCGVSQSSFISSHFDKKVRFWDARSSDATYSVELGQKVSSLDISMDGLQVLASSRDDTLSLIDVRNYGIIHLYSAEQYKTSCDSTRAIFSSTGEYVLAGSSNSSVFIWNTKTTKLEKVVKTARSDSAQIMSLAWNPSGRGLLACDRQKTCTLW 533          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Celegans
Match: atg-16.1 (Autophagic-related protein 16.1 [Source:UniProtKB/Swiss-Prot;Acc:Q19124])

HSP 1 Score: 180.644 bits (457), Expect = 2.554e-49
Identity = 103/302 (34.11%), Postives = 161/302 (53.31%), Query Frame = 1
Query:  733 NLPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWS-HNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLG--LMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIW 1626
            ++P + +  L+  EGE+  V +   G   ATGGSDR IKIW    +G      TL G N +   +D++      + AS+ D + R+W++ + R+  +L+GHS++V   +F   ++  V+GS DR +K+WD + + C +++   S   DV    G    L  SGHFDKKLR +D R       + +  RIT LD++     LL   +DD++  IDLR  Q +  ++   ++  +DL R   S   +YVAAGS +GS+F+WN  + KLEK L  +    I  + W P    L S  + K V +W
Sbjct:  279 SVPSRAEFVLECEEGEVNDVHW-LDGETFATGGSDRNIKIWKVDGHGGYTRIGTLAGSNAAFTRIDYERDRKHFI-ASSNDKNVRIWNLDNSRLLSTLSGHSDQVTCVKFYQSHS-AVSGSADRVIKIWDIQNQRCSRSLFPASKVLDVATNMGASPSLFASGHFDKKLRFYDGRSTDPVRTVDMGGRITSLDVTMSGCELLVSTRDDTISLIDLRTFQTVHCYSAENYRTSSDLSRVVLSSGNEYVAAGSSNGSIFVWNRNSTKLEKQLCSNSENAIFSLSWNPTGYGLLSSSKQKFVTLW 577          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 111.694 bits (278), Expect = 1.827e-26
Identity = 81/304 (26.64%), Postives = 153/304 (50.33%), Query Frame = 1
Query:  745 QLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLG-LMISGHFDKKLRMWDHRGDLNTDQLV--LSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPD-----GQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLAS--CERNKRVAIW 1626
            +L  TL+ H   +   +FSP G +L T  +D+ +KIW+ ++  C+   TLTG    V  + + S    ++ AS  D + +++ +   RM  +L GH+N V    F   ++ +V+GS D ++++WD +T  C+KT+ A S     V  +  G L+ SG +D  +R+WD         LV   +  +  +  S +   +LA   D +L+  D    + ++ +T      G++  + C   +     G+++ +GS D  ++IWN +T ++ + L+  T  ++     P  N++AS   E + ++ IW
Sbjct:   78 KLMCTLEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMICER--TLTGHKLGVNDIAWSSDSRCVVSASD-DKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENPPVAFVKFSPNGKYILASNLDSTLKLWDFSKGKTLKQYT------GHENSKYCIFANFSVTGGKWIISGSEDCKIYIWNLQTREIVQCLEGHTQPVLASDCHPVQNIIASGALEPDNKIHIW 372          

HSP 2 Score: 56.225 bits (134), Expect = 3.667e-8
Identity = 48/203 (23.65%), Postives = 97/203 (47.78%), Query Frame = 1
Query: 1000 DYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMS-ACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLV-LSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCP-GSNVLAS 1596
            +Y++  +L GH+  + + +F      + T S D+T+K+W+     C +T+       +D+   S    ++S   DK L++++      T  L   ++ +   + +   + +++   D+S++  D++    I+        V        F+ DG  +A+GS+DG V IW++  G+  KTL  D+   +  V + P G  +LAS
Sbjct:   76 NYKLMCTLEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMICERTLTGHKLGVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVS----AVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENPPVAFVKFSPNGKYILAS 274          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 111.694 bits (278), Expect = 1.827e-26
Identity = 81/304 (26.64%), Postives = 153/304 (50.33%), Query Frame = 1
Query:  745 QLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLG-LMISGHFDKKLRMWDHRGDLNTDQLV--LSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPD-----GQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLAS--CERNKRVAIW 1626
            +L  TL+ H   +   +FSP G +L T  +D+ +KIW+ ++  C+   TLTG    V  + + S    ++ AS  D + +++ +   RM  +L GH+N V    F   ++ +V+GS D ++++WD +T  C+KT+ A S     V  +  G L+ SG +D  +R+WD         LV   +  +  +  S +   +LA   D +L+  D    + ++ +T      G++  + C   +     G+++ +GS D  ++IWN +T ++ + L+  T  ++     P  N++AS   E + ++ IW
Sbjct:   78 KLMCTLEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMICER--TLTGHKLGVNDIAWSSDSRCVVSASD-DKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENPPVAFVKFSPNGKYILASNLDSTLKLWDFSKGKTLKQYT------GHENSKYCIFANFSVTGGKWIISGSEDCKIYIWNLQTREIVQCLEGHTQPVLASDCHPVQNIIASGALEPDNKIHIW 372          

HSP 2 Score: 56.225 bits (134), Expect = 3.667e-8
Identity = 48/203 (23.65%), Postives = 97/203 (47.78%), Query Frame = 1
Query: 1000 DYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMS-ACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLV-LSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCP-GSNVLAS 1596
            +Y++  +L GH+  + + +F      + T S D+T+K+W+     C +T+       +D+   S    ++S   DK L++++      T  L   ++ +   + +   + +++   D+S++  D++    I+        V        F+ DG  +A+GS+DG V IW++  G+  KTL  D+   +  V + P G  +LAS
Sbjct:   76 NYKLMCTLEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMICERTLTGHKLGVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVS----AVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENPPVAFVKFSPNGKYILAS 274          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Celegans
Match: snrp-40.1 (Small Nuclear RibonucleoProtein homolog [Source:UniProtKB/TrEMBL;Acc:Q19211])

HSP 1 Score: 100.908 bits (250), Expect = 3.778e-23
Identity = 87/297 (29.29%), Postives = 139/297 (46.80%), Query Frame = 1
Query:  760 LDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSM--GDYRMRL-SLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHR--ITGLDISRDQNTLLACLKDDSLQTIDLRM----NQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAI 1623
            L  HEGE+    FSP G  LAT G D+KI  W + YG C+  +T+ G +G+V+ + F +  S ++   T D S R+W M  G    R  + T   N V   R     T + + S D T ++ D RT+  VKT         V        +ISG  D  L++WD R D  T  L   HR  ITG+ +S     +++   D +++  D+R      + +  F         +L +  +SP  +++ AGS D  +++W + + K+   L      + C  + P   ++ SC  +KRV +
Sbjct:   34 LLGHEGEIYTGAFSPDGTCLATSGYDQKIFFW-NVYGECENFSTIKGHSGAVMDLKFTTDSSSLVSCGT-DKSVRVWDMETGTCARRFRTHTDFVNAVHPSR--RGVTLVASASDDGTCRVHDMRTKEPVKTYTNRYQQTAVTFNDSSDQVISGGIDNVLKVWDMRRDEITYTLT-GHRDTITGISLSPSGKFIISNSMDCTVRQWDIRPFVPGQRSVGVFAGHNHNFEKNLLKCSWSPCERFITAGSSDRFLYVWETLSKKIVYKLPGHMGSVNCTDFHPKEPIMLSCGSDKRVFL 325          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Fly
Match: Atg16 (gene:FBgn0039705 transcript:FBtr0085530)

HSP 1 Score: 271.166 bits (692), Expect = 2.194e-84
Identity = 132/320 (41.25%), Postives = 200/320 (62.50%), Query Frame = 1
Query:  676 AANSTVDIDLMKMKNIYITNLPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLG-LMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            A NS   ID +K         P ++    +AHE E   VR+SP    +ATGG+DRK+K+W     + + +  L+G +  + +VDFDS+ ++ILG S  D   R+W++ D R+R +LTGHS KV+A +++ +  ++VTGS DRTLK+WD R+ +C++T  A S+C+D+V    LG  +ISGH+DKK+R WD R +   D +++  +IT LD+S+D N L+  ++DD+++ +DLR NQ I  FT   FK+  D  R  F+  G  +A GS DG+++IWN   G LE TLK  +  +  V W P +N+LAS  +NKR  I+ E
Sbjct:  127 AENSRASIDTLKATGYLGQANPTKILMKFEAHENESHAVRWSPVERMVATGGADRKVKLWDIGKNSTEPRAVLSGSSAGINSVDFDSTGAYILGTSN-DYGARVWTVMDNRLRHTLTGHSGKVMAAKYVQEPIKVVTGSHDRTLKIWDLRSIACIETKFAGSSCNDLVTTDSLGSTIISGHYDKKIRFWDIRTEKQADDVLMPAKITSLDLSKDCNYLICSVRDDTIKLLDLRKNQVISTFTNEHFKISCDFARASFNSSGLKIACGSADGAIYIWNV-NGFLEATLKGHSTAVNAVSWSPNNNMLASVGKNKRCTIYSE 444          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Fly
Match: Atg16 (gene:FBgn0039705 transcript:FBtr0085529)

HSP 1 Score: 269.626 bits (688), Expect = 3.419e-84
Identity = 132/320 (41.25%), Postives = 200/320 (62.50%), Query Frame = 1
Query:  676 AANSTVDIDLMKMKNIYITNLPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLG-LMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            A NS   ID +K         P ++    +AHE E   VR+SP    +ATGG+DRK+K+W     + + +  L+G +  + +VDFDS+ ++ILG S  D   R+W++ D R+R +LTGHS KV+A +++ +  ++VTGS DRTLK+WD R+ +C++T  A S+C+D+V    LG  +ISGH+DKK+R WD R +   D +++  +IT LD+S+D N L+  ++DD+++ +DLR NQ I  FT   FK+  D  R  F+  G  +A GS DG+++IWN   G LE TLK  +  +  V W P +N+LAS  +NKR  I+ E
Sbjct:  101 AENSRASIDTLKATGYLGQANPTKILMKFEAHENESHAVRWSPVERMVATGGADRKVKLWDIGKNSTEPRAVLSGSSAGINSVDFDSTGAYILGTSN-DYGARVWTVMDNRLRHTLTGHSGKVMAAKYVQEPIKVVTGSHDRTLKIWDLRSIACIETKFAGSSCNDLVTTDSLGSTIISGHYDKKIRFWDIRTEKQADDVLMPAKITSLDLSKDCNYLICSVRDDTIKLLDLRKNQVISTFTNEHFKISCDFARASFNSSGLKIACGSADGAIYIWNV-NGFLEATLKGHSTAVNAVSWSPNNNMLASVGKNKRCTIYSE 418          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Fly
Match: Atg16 (gene:FBgn0039705 transcript:FBtr0085528)

HSP 1 Score: 274.633 bits (701), Expect = 6.079e-84
Identity = 132/320 (41.25%), Postives = 200/320 (62.50%), Query Frame = 1
Query:  676 AANSTVDIDLMKMKNIYITNLPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLG-LMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            A NS   ID +K         P ++    +AHE E   VR+SP    +ATGG+DRK+K+W     + + +  L+G +  + +VDFDS+ ++ILG S  D   R+W++ D R+R +LTGHS KV+A +++ +  ++VTGS DRTLK+WD R+ +C++T  A S+C+D+V    LG  +ISGH+DKK+R WD R +   D +++  +IT LD+S+D N L+  ++DD+++ +DLR NQ I  FT   FK+  D  R  F+  G  +A GS DG+++IWN   G LE TLK  +  +  V W P +N+LAS  +NKR  I+ E
Sbjct:  286 AENSRASIDTLKATGYLGQANPTKILMKFEAHENESHAVRWSPVERMVATGGADRKVKLWDIGKNSTEPRAVLSGSSAGINSVDFDSTGAYILGTSN-DYGARVWTVMDNRLRHTLTGHSGKVMAAKYVQEPIKVVTGSHDRTLKIWDLRSIACIETKFAGSSCNDLVTTDSLGSTIISGHYDKKIRFWDIRTEKQADDVLMPAKITSLDLSKDCNYLICSVRDDTIKLLDLRKNQVISTFTNEHFKISCDFARASFNSSGLKIACGSADGAIYIWNV-NGFLEATLKGHSTAVNAVSWSPNNNMLASVGKNKRCTIYSE 603          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Fly
Match: Atg16 (gene:FBgn0039705 transcript:FBtr0339144)

HSP 1 Score: 274.633 bits (701), Expect = 6.832e-84
Identity = 132/320 (41.25%), Postives = 200/320 (62.50%), Query Frame = 1
Query:  676 AANSTVDIDLMKMKNIYITNLPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLG-LMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            A NS   ID +K         P ++    +AHE E   VR+SP    +ATGG+DRK+K+W     + + +  L+G +  + +VDFDS+ ++ILG S  D   R+W++ D R+R +LTGHS KV+A +++ +  ++VTGS DRTLK+WD R+ +C++T  A S+C+D+V    LG  +ISGH+DKK+R WD R +   D +++  +IT LD+S+D N L+  ++DD+++ +DLR NQ I  FT   FK+  D  R  F+  G  +A GS DG+++IWN   G LE TLK  +  +  V W P +N+LAS  +NKR  I+ E
Sbjct:  294 AENSRASIDTLKATGYLGQANPTKILMKFEAHENESHAVRWSPVERMVATGGADRKVKLWDIGKNSTEPRAVLSGSSAGINSVDFDSTGAYILGTSN-DYGARVWTVMDNRLRHTLTGHSGKVMAAKYVQEPIKVVTGSHDRTLKIWDLRSIACIETKFAGSSCNDLVTTDSLGSTIISGHYDKKIRFWDIRTEKQADDVLMPAKITSLDLSKDCNYLICSVRDDTIKLLDLRKNQVISTFTNEHFKISCDFARASFNSSGLKIACGSADGAIYIWNV-NGFLEATLKGHSTAVNAVSWSPNNNMLASVGKNKRCTIYSE 611          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0308566)

HSP 1 Score: 114.775 bits (286), Expect = 1.782e-27
Identity = 86/305 (28.20%), Postives = 157/305 (51.48%), Query Frame = 1
Query:  748 LKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACD--YKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLG-LMISGHFDKKLRMWDHRGDLNTDQLV--LSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPD-----GQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASC--ERNKRVAIW 1626
            LK TL  H   +  V+FSP+G +LA+  +D+ IKIW    GA D  ++ T++G    +  V + SS+S +L + + D + ++W +   +   +L GHSN V    F   +  IV+GS D ++++WD RT  C+KT+ A S     V  +  G L++S  +D   R+WD         L+   +  ++ +  S +   +LA   D++L+  D    + ++ +T      G+   + C   +     G+++ +GS D  V+IWN ++ ++ + L+  T  ++C    P  N++AS   E +K + +W
Sbjct:   64 LKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAW-SSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT------GHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLW 357          

HSP 2 Score: 57.3806 bits (137), Expect = 1.880e-8
Identity = 48/216 (22.22%), Postives = 98/216 (45.37%), Query Frame = 1
Query: 1000 DYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMS-ACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLV-----LSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIW 1626
            +Y ++ +L GH+  V A +F  +   + + S D+ +K+W        KT+        DV   S   L++SG  DK L++W    +L+T + +      S+ +   + +   N +++   D+S++  D+R  + ++        V        F+ DG  + + S+DG   IW++ +G+  KTL  D    +  V + P    + +   +  + +W
Sbjct:   61 NYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVW----ELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVH----FNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLW 268          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Zebrafish
Match: atg16l1 (ATG16 autophagy related 16-like 1 (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-050417-401])

HSP 1 Score: 292.352 bits (747), Expect = 1.580e-90
Identity = 142/300 (47.33%), Postives = 196/300 (65.33%), Query Frame = 1
Query:  736 LPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            +P       DAH+GE+  VRFSP    LATGG DR++K+W    G C+ K  LTG N  + +++FDS+ S++L AS  D + R+W++ DYR+R +LTGHS KV++ RFL DN RIV+GS DRTLKLWD R++ C+KT+ A S+C+D+V C+   +M SGHFDKK+R WD R +    +L L  R+T LD++ D+  LL C +DD ++ IDLR N   Q F    FK G+D  R  FSPDG +VAAGS DG +++WN  TGKLEKTL K  ++ I  V W      +AS E+  +  +W +
Sbjct:  309 VPSTALHIFDAHDGEVNAVRFSPGSRLLATGGMDRRVKLWEVVSGRCEPKGALTGSNAGITSIEFDSAGSYLLAASN-DFASRIWTVDDYRLRHTLTGHSGKVLSARFLLDNARIVSGSYDRTLKLWDLRSKVCMKTVFAGSSCNDIV-CTEQCVM-SGHFDKKVRFWDIRAESIVRELELMGRVTSLDLNHDRTELLTCSRDDLVKIIDLRTNAVRQTFNAQGFKCGSDFTRVTFSPDGSFVAAGSADGVLYLWNVLTGKLEKTLDKGHSSAINSVSWSLSGAFVASVEKGSKAVLWSD 605          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Zebrafish
Match: atg16l1 (ATG16 autophagy related 16-like 1 (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-050417-401])

HSP 1 Score: 291.582 bits (745), Expect = 4.364e-90
Identity = 142/300 (47.33%), Postives = 196/300 (65.33%), Query Frame = 1
Query:  736 LPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            +P       DAH+GE+  VRFSP    LATGG DR++K+W    G C+ K  LTG N  + +++FDS+ S++L AS  D + R+W++ DYR+R +LTGHS KV++ RFL DN RIV+GS DRTLKLWD R++ C+KT+ A S+C+D+V C+   +M SGHFDKK+R WD R +    +L L  R+T LD++ D+  LL C +DD ++ IDLR N   Q F    FK G+D  R  FSPDG +VAAGS DG +++WN  TGKLEKTL K  ++ I  V W      +AS E+  +  +W +
Sbjct:  324 VPSTALHIFDAHDGEVNAVRFSPGSRLLATGGMDRRVKLWEVVSGRCEPKGALTGSNAGITSIEFDSAGSYLLAASN-DFASRIWTVDDYRLRHTLTGHSGKVLSARFLLDNARIVSGSYDRTLKLWDLRSKVCMKTVFAGSSCNDIV-CTEQCVM-SGHFDKKVRFWDIRAESIVRELELMGRVTSLDLNHDRTELLTCSRDDLVKIIDLRTNAVRQTFNAQGFKCGSDFTRVTFSPDGSFVAAGSADGVLYLWNVLTGKLEKTLDKGHSSAINSVSWSLSGAFVASVEKGSKAVLWSD 620          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Zebrafish
Match: atg16l2 (ATG16 autophagy related 16-like 2 (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-060503-197])

HSP 1 Score: 133.65 bits (335), Expect = 9.316e-36
Identity = 70/168 (41.67%), Postives = 104/168 (61.90%), Query Frame = 1
Query:  868 GACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLR 1371
            G+   + TL G N  + +++FD + + IL AS  D S   W + D   +++LTGHS KV A RF     ++VTGS DRT+K+WD +  +C++T+  +S C D VVCS   L+IS H+DKK+R WD R    T ++ L  R+T LD+  +   LL+C +D+ LQ +DLR
Sbjct:   14 GSLQNRGTLDGSNEGITSIEFDPTGTRILAAS-YDKSALFWRLEDSVPKVTLTGHSRKVTAARFKYSQRQVVTGSADRTVKIWDLQRAACIQTIEVLSFCSD-VVCSEY-LIISSHYDKKIRFWDSRAATCTQEVPLQGRVTSLDLCPNHRQLLSCSRDNILQLVDLR 178          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Zebrafish
Match: snrnp40 (small nuclear ribonucleoprotein 40 (U5) [Source:ZFIN;Acc:ZDB-GENE-040426-978])

HSP 1 Score: 117.857 bits (294), Expect = 1.385e-28
Identity = 89/298 (29.87%), Postives = 147/298 (49.33%), Query Frame = 1
Query:  760 LDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIV-TGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHR-----ITGLDISRDQNTLLACLKDDSLQTIDLRM----NQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAI 1623
            L  HEGE+ C +F P+G  LA+ G DR I +W + YG C+   TL G +G+V+ + +++  S +  AST  + C +W          L GH++ V +        ++  TGS D T+KLWD R ++ V T         V        +ISG  D  +++W    DL  ++L+ S +     +TGL +S D + LL+   D+S++  D+R      + ++ F         +L R  +S DG  +AAGS D  V+IW++ T ++   L      +  V + P   ++ S   +KR+ I
Sbjct:   52 LSGHEGEVYCCKFHPNGATLASSGYDRLILMW-NVYGDCENYATLKGHSGAVMELHYNTDGSLLFSASTDKTVC-VWDSETGERVKRLKGHTSFVNSCFPARRGPQLACTGSDDGTVKLWDIRKKASVHTFQNTYQVLSVTFNDTSDQIISGGIDNDIKVW----DLRQNKLIYSMQGHGDSVTGLSLSADGSYLLSNSMDNSVRVWDIRPFAPKERCVKIFQGNVHNFEKNLLRCSWSADGSKIAAGSADRFVYIWDTTTRRIVYKLPGHAGSVNEVAFHPEEPIVLSGSSDKRLYI 343          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Zebrafish
Match: wdr5 (WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2082])

HSP 1 Score: 115.931 bits (289), Expect = 5.940e-28
Identity = 86/305 (28.20%), Postives = 154/305 (50.49%), Query Frame = 1
Query:  748 LKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACD--YKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLG-LMISGHFDKKLRMWDHRGDLNTDQLV--LSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPD-----GQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASC--ERNKRVAIW 1626
            LK TL  H   +  V+FSPSG +LA+  +D+ IKIW    GA D  ++ T++G    +  V + S  + ++ AS  D + ++W +   +   +L GHSN V    F   +  IV+GS D ++++WD +T  C+KT+ A S     V  +  G L++S  +D   R+WD         L+   +  ++ +  S +   +LA   D++L+  D    + ++ +T      G+   + C   +     G+++ +GS D  V+IWN +T ++ + L+  T  +I     P  N++AS   E +K + +W
Sbjct:   37 LKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASD-DKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT------GHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW 330          

HSP 2 Score: 55.8398 bits (133), Expect = 5.527e-8
Identity = 45/212 (21.23%), Postives = 92/212 (43.40%), Query Frame = 1
Query: 1000 DYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMS-ACHDVVVCSGLGLMISGHFDKKLRMWD-HRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIW 1626
            +Y ++ +L GH+  V + +F      + + S D+ +K+W        KT+        DV   S   L++S   DK L++WD   G         S+ +   + +   N +++   D+S++  D++  + ++        V        F+ DG  + + S+DG   IW++ +G+  KTL  D    +  V + P    + +   +  + +W
Sbjct:   34 NYTLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVS----AVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLW 241          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Xenopus
Match: atg16 (autophagy related 16 like 1 [Source:NCBI gene;Acc:550097])

HSP 1 Score: 308.916 bits (790), Expect = 1.520e-97
Identity = 187/532 (35.15%), Postives = 295/532 (55.45%), Query Frame = 1
Query:   76 IKARLSERNEKESLVNKKIIFDYEIILCRFNTSQKQLDSL---KYENEKLRSSVP----VSND---QTISRKVYDMQEELTNAVKEKSALNIKILEFKLLCNNKDKDLQDLKQNIHSLKDQISKQEELIRTSSDTIRKLEDIKRTLTDEISANLMAYRSLDTKYRELEESS--YVLKDTVKKLQQALXXXXXXXXXXXXXXXQDALKQTLIEAANSTVDIDLMKMKNIYITNLPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            I   L  R+ ++  V +++I  Y+ +L + +      D L   KYE +    S P    + ND   Q +++     QEELT   K++  L   ++E       KDK++Q  ++ I      I   E   +   + +++LE   +TL DE  A  + + +L+ K R+  E +   V +   +K Q+A             + ++D+ +++L     S    D     N  +  +P     + DAH+GE+  VRFSP    LATGG DR++K+W      C+ K +LTG N  + +++FDS+ S++L AS  D + R+W++ DYR+R +LTGHS KV++ +FL DN RIV+GS DRTLKLWD R++ C+KT+ A S+C+D+V C+   +M SGHFDKK+R WD R +    +L L  RIT LD++ ++  LL+C +DD ++  DLR N   Q F+ P FK G+D  R  FSPDG YV+AGS +G+++ WN  TGK+E+   K  ++ I  V W P    + S ++  R  +W +
Sbjct:   17 ISRELRRRDREQRQVFEELISQYKRLLEKSDLQSVLADKLQAEKYEQQSRHDSSPGPDGMRNDMLLQDMAQMRIKHQEELTELHKKRGELAQTVIELNNQMQQKDKEIQANEEKIAKYLQTIQDLETECQDLRNKLQELERANQTLKDEYDALQITFTALEDKLRKTTEDNQELVSRWMAEKAQEA--------NRLNAENEKDSKRRSLNSFPASPDCADTPGAGNREV-RVPATAVYSFDAHDGEVNAVRFSPGSRLLATGGMDRRVKLWDVIGNKCEAKGSLTGSNAGITSIEFDSAGSYLLAASN-DFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIV-CTEQCVM-SGHFDKKIRFWDIRTECIVRELELQGRITALDLNPERTQLLSCSRDDLIKITDLRANAVQQTFSAPGFKCGSDWTRVIFSPDGSYVSAGSAEGTLYFWNVLTGKVERMFSKQHSSSINAVAWSPSGTHVVSVDKGSRGVLWSD 536          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Xenopus
Match: atg16 (autophagy related 16 like 1 [Source:NCBI gene;Acc:550097])

HSP 1 Score: 303.523 bits (776), Expect = 4.840e-95
Identity = 191/562 (33.99%), Postives = 300/562 (53.38%), Query Frame = 1
Query:   76 IKARLSERNEKESLVNKKIIFDYEIILCRFNTSQKQLDSL---KYENEKLRSSVP----VSND---QTISRKVYDMQEELTNAVKEKSALNIKILEFKLLCNNKDKDLQDLKQNIHSLKDQISKQEELIRTSSDTIRKLEDIKRTLTDEISANLMAYRSLDTKYRELEESS--YVLKDTVKKLQQALXXXXXXXXXXXXXXXQDALKQTLIEAANSTVDIDLMKMKNIYI------------------------------TNLPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            I   L  R+ ++  V +++I  Y+ +L + +      D L   KYE +    S P    + ND   Q +++     QEELT   K++  L   ++E       KDK++Q  ++ I      I   E   +   + +++LE   +TL DE  A  + + +L+ K R+  E +   V +   +K Q+A  ++ N E +   K +Q  L++ L EAA   +  + +                                       +P     + DAH+GE+  VRFSP    LATGG DR++K+W      C+ K +LTG N  + +++FDS+ S++L AS  D + R+W++ DYR+R +LTGHS KV++ +FL DN RIV+GS DRTLKLWD R++ C+KT+ A S+C+D+V C+   +M SGHFDKK+R WD R +    +L L  RIT LD++ ++  LL+C +DD ++  DLR N   Q F+ P FK G+D  R  FSPDG YV+AGS +G+++ WN  TGK+E+   K  ++ I  V W P    + S ++  R  +W +
Sbjct:   17 ISRELRRRDREQRQVFEELISQYKRLLEKSDLQSVLADKLQAEKYEQQSRHDSSPGPDGMRNDMLLQDMAQMRIKHQEELTELHKKRGELAQTVIELNNQMQQKDKEIQANEEKIAKYLQTIQDLETECQDLRNKLQELERANQTLKDEYDALQITFTALEDKLRKTTEDNQELVSRWMAEKAQEA--NRLNAENEKDSKRRQARLQKELAEAAKEPLSFEHLSESPSLSHRSDSSRRRSLNSFPASPDCADTPGAGNREVRVPATAVYSFDAHDGEVNAVRFSPGSRLLATGGMDRRVKLWDVIGNKCEAKGSLTGSNAGITSIEFDSAGSYLLAASN-DFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIV-CTEQCVM-SGHFDKKIRFWDIRTECIVRELELQGRITALDLNPERTQLLSCSRDDLIKITDLRANAVQQTFSAPGFKCGSDWTRVIFSPDGSYVSAGSAEGTLYFWNVLTGKVERMFSKQHSSSINAVAWSPSGTHVVSVDKGSRGVLWSD 573          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Xenopus
Match: atg16 (autophagy related 16 like 1 [Source:NCBI gene;Acc:550097])

HSP 1 Score: 300.827 bits (769), Expect = 5.365e-94
Identity = 194/565 (34.34%), Postives = 305/565 (53.98%), Query Frame = 1
Query:   76 IKARLSERNEKESLVNKKIIFDYEIILCRFNTSQKQLDSL---KYENEKLRSSVP----VSND---QTISRKVYDMQEELTNAVKEKSALNIKILEFKLLCNNKDKDLQDLKQNIHSLKDQISKQEELIRTSSDTIRKLEDIKRTLTDEISANLMAYRSLDTKYRELEESSYVL--KDTVKKLQQALXXXXXXXXXXXXXXXQDALKQTLIEAANSTV------DIDLMKMKNIYITN-----------------LPCQLKQTL----------DAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            I   L  R+ ++  V +++I  Y+ +L + +      D L   KYE +    S P    + ND   Q +++     QEELT   K++  L   ++E       KDK++Q  ++ I      I   E   +   + +++LE   +TL DE  A  + + +L+ K R+  E +  L  +   +K Q+A  ++ N E +   K +Q  L++ L EAA   +      DI+++      + +                 +PC                DAH+GE+  VRFSP    LATGG DR++K+W      C+ K +LTG N  + +++FDS+ S++L AS  D + R+W++ DYR+R +LTGHS KV++ +FL DN RIV+GS DRTLKLWD R++ C+KT+ A S+C+D+V C+   +M SGHFDKK+R WD R +    +L L  RIT LD++ ++  LL+C +DD ++  DLR N   Q F+ P FK G+D  R  FSPDG YV+AGS +G+++ WN  TGK+E+   K  ++ I  V W P    + S ++  R  +W +
Sbjct:   17 ISRELRRRDREQRQVFEELISQYKRLLEKSDLQSVLADKLQAEKYEQQSRHDSSPGPDGMRNDMLLQDMAQMRIKHQEELTELHKKRGELAQTVIELNNQMQQKDKEIQANEEKIAKYLQTIQDLETECQDLRNKLQELERANQTLKDEYDALQITFTALEDKLRKTTEDNQELVSRWMAEKAQEA--NRLNAENEKDSKRRQARLQKELAEAAKEPLSFEHDDDIEVLNDNADPVGDSAGAQATAGTVTLREQIVPCPTSGLCLNVEYFSFLKDAHDGEVNAVRFSPGSRLLATGGMDRRVKLWDVIGNKCEAKGSLTGSNAGITSIEFDSAGSYLLAASN-DFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIV-CTEQCVM-SGHFDKKIRFWDIRTECIVRELELQGRITALDLNPERTQLLSCSRDDLIKITDLRANAVQQTFSAPGFKCGSDWTRVIFSPDGSYVSAGSAEGTLYFWNVLTGKVERMFSKQHSSSINAVAWSPSGTHVVSVDKGSRGVLWSD 576          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Xenopus
Match: atg16 (autophagy related 16 like 1 [Source:NCBI gene;Acc:550097])

HSP 1 Score: 300.056 bits (767), Expect = 9.680e-94
Identity = 189/561 (33.69%), Postives = 294/561 (52.41%), Query Frame = 1
Query:   76 IKARLSERNEKESLVNKKIIFDYEIILCRFNTSQKQLDSL---KYENEKLRSSVP----VSND---QTISRKVYDMQEELTNAVKEKSALNIKILEFKLLCNNKDKDLQDLKQNIHSLKDQISKQEELIRTSSDTIRKLEDIKRTLTDEISANLMAYRSLDTKYRELEESS--YVLKDTVKKLQQALXXXXXXXXXXXXXXXQDALKQTL-----------------------------IEAANSTVDIDLMKMKNIYITNLPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            I   L  R+ ++  V +++I  Y+ +L + +      D L   KYE +    S P    + ND   Q +++     QEELT   K++  L   ++E       KDK++Q  ++ I      I   E   +   + +++LE   +TL DE  A  + + +L+ K R+  E +   V +   +K Q+A       E D   +  Q A+   L                               A+    D      + + +   P     + DAH+GE+  VRFSP    LATGG DR++K+W      C+ K +LTG N  + +++FDS+ S++L AS  D + R+W++ DYR+R +LTGHS KV++ +FL DN RIV+GS DRTLKLWD R++ C+KT+ A S+C+D+V C+   +M SGHFDKK+R WD R +    +L L  RIT LD++ ++  LL+C +DD ++  DLR N   Q F+ P FK G+D  R  FSPDG YV+AGS +G+++ WN  TGK+E+   K  ++ I  V W P    + S ++  R  +W +
Sbjct:   17 ISRELRRRDREQRQVFEELISQYKRLLEKSDLQSVLADKLQAEKYEQQSRHDSSPGPDGMRNDMLLQDMAQMRIKHQEELTELHKKRGELAQTVIELNNQMQQKDKEIQANEEKIAKYLQTIQDLETECQDLRNKLQELERANQTLKDEYDALQITFTALEDKLRKTTEDNQELVSRWMAEKAQEANRLNAENEKDSNKRNSQPAVGGLLDSITNIFGLSESPSLSHRSDSSRRRSLNSFPASPDCADTPGAGNREVRV---PATAVYSFDAHDGEVNAVRFSPGSRLLATGGMDRRVKLWDVIGNKCEAKGSLTGSNAGITSIEFDSAGSYLLAASN-DFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIV-CTEQCVM-SGHFDKKIRFWDIRTECIVRELELQGRITALDLNPERTQLLSCSRDDLIKITDLRANAVQQTFSAPGFKCGSDWTRVIFSPDGSYVSAGSAEGTLYFWNVLTGKVERMFSKQHSSSINAVAWSPSGTHVVSVDKGSRGVLWSD 571          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Xenopus
Match: atg16 (autophagy related 16 like 1 [Source:NCBI gene;Acc:550097])

HSP 1 Score: 298.516 bits (763), Expect = 3.596e-93
Identity = 187/552 (33.88%), Postives = 293/552 (53.08%), Query Frame = 1
Query:   76 IKARLSERNEKESLVNKKIIFDYEIILCRFNTSQKQLDSL---KYENEKLRSSVP----VSND---QTISRKVYDMQEELTNAVKEKSALNIKILEFKLLCNNKDKDLQDLKQNIHSLKDQISKQEELIRTSSDTIRKLEDIKRTLTDEISANLMAYRSLDTKYRELEESSYVL--KDTVKKLQQALXXXXXXX--------------------XXXXXXXXQDALKQTLIEAANSTVDIDLMKMKNIYITNLPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            I   L  R+ ++  V +++I  Y+ +L + +      D L   KYE +    S P    + ND   Q +++     QEELT   K++  L   ++E       KDK++Q  ++ I      I   E   +   + +++LE   +TL DE  A  + + +L+ K R+  E +  L  +   +K Q+A       E                            ++  +++L     S    D     N  +  +P     + DAH+GE+  VRFSP    LATGG DR++K+W      C+ K +LTG N  + +++FDS+ S++L AS  D + R+W++ DYR+R +LTGHS KV++ +FL DN RIV+GS DRTLKLWD R++ C+KT+ A S+C+D+V C+   +M SGHFDKK+R WD R +    +L L  RIT LD++ ++  LL+C +DD ++  DLR N   Q F+ P FK G+D  R  FSPDG YV+AGS +G+++ WN  TGK+E+   K  ++ I  V W P    + S ++  R  +W +
Sbjct:   17 ISRELRRRDREQRQVFEELISQYKRLLEKSDLQSVLADKLQAEKYEQQSRHDSSPGPDGMRNDMLLQDMAQMRIKHQEELTELHKKRGELAQTVIELNNQMQQKDKEIQANEEKIAKYLQTIQDLETECQDLRNKLQELERANQTLKDEYDALQITFTALEDKLRKTTEDNQELVSRWMAEKAQEANRLNAENEKDSNDDDIEVLNDNADPVGDSAGAQATGRNIRRRSLNSFPASPDCADTPGAGNREV-RVPATAVYSFDAHDGEVNAVRFSPGSRLLATGGMDRRVKLWDVIGNKCEAKGSLTGSNAGITSIEFDSAGSYLLAASN-DFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIV-CTEQCVM-SGHFDKKIRFWDIRTECIVRELELQGRITALDLNPERTQLLSCSRDDLIKITDLRANAVQQTFSAPGFKCGSDWTRVIFSPDGSYVSAGSAEGTLYFWNVLTGKVERMFSKQHSSSINAVAWSPSGTHVVSVDKGSRGVLWSD 564          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Mouse
Match: Atg16l1 (autophagy related 16-like 1 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1924290])

HSP 1 Score: 293.508 bits (750), Expect = 4.353e-91
Identity = 176/500 (35.20%), Postives = 274/500 (54.80%), Query Frame = 1
Query:  274 QEELTNAVKEKSALNIKILEFKLLCNNKDKDLQDLKQNIHSLKDQISKQEELIRTSSDTIRKLEDIKRTLTDEISANLMAYRSLDTKYREL--EESSYVLKDTVKKLQQALXXXXXXXXXXXXXXXQDALKQTLIEAANSTV------DIDLM------------------------KMKNIYITN--------------LPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            QEELT   K++  L   +++       KDK++Q  +  I      IS  E         ++ LE   +TL DE  A  + + +L+ K R+   E    V +   +K Q+A  ++ N E +   + +Q  L++ L EAA   +      DI+++                         + +I +                +P       DAH+GE+  V+FSP    LATGG DR++K+W      C++K +L+G N  + +++FDS+ +++L AS  D + R+W++ DYR+R +LTGHS KV++ +FL DN RIV+GS DRTLKLWD R++ C+KT+ A S+C+D+V C+   +M SGHFDKK+R WD R +    ++ L  +IT LD++ ++  LL+C +DD L+ IDLR N   Q F+ P FK G+D  R  FSPDG YVAAGS +GS+++W+  TGK+EK L K  ++ I  V W P    + S ++  R  +W +
Sbjct:   93 QEELTELHKKRGELAQLVIDLNNQMQQKDKEIQMNEAKISEYLQTISDLETNCLDLRTKLQDLEVANQTLKDEYDALQITFTALEEKLRKTTEENQELVTRWMAEKAQEA--NRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAVSRAATRRSVSSIPVPQDIMDTHPASGKDVRVPTTASYVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEAFGDKCEFKGSLSGSNAGITSIEFDSAGAYLLAASN-DFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIV-CTEQCVM-SGHFDKKIRFWDIRSESVVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAVKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYVWSVLTGKVEKVLSKQHSSSINAVAWAPSGLHVVSVDKGSRAVLWAQ 587          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Mouse
Match: Atg16l1 (autophagy related 16-like 1 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1924290])

HSP 1 Score: 290.041 bits (741), Expect = 1.135e-89
Identity = 135/300 (45.00%), Postives = 200/300 (66.67%), Query Frame = 1
Query:  736 LPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            +P       DAH+GE+  V+FSP    LATGG DR++K+W      C++K +L+G N  + +++FDS+ +++L AS  D + R+W++ DYR+R +LTGHS KV++ +FL DN RIV+GS DRTLKLWD R++ C+KT+ A S+C+D+V C+   +M SGHFDKK+R WD R +    ++ L  +IT LD++ ++  LL+C +DD L+ IDLR N   Q F+ P FK G+D  R  FSPDG YVAAGS +GS+++W+  TGK+EK L K  ++ I  V W P    + S ++  R  +W +
Sbjct:  310 VPTTASYVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEAFGDKCEFKGSLSGSNAGITSIEFDSAGAYLLAASN-DFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIV-CTEQCVM-SGHFDKKIRFWDIRSESVVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAVKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYVWSVLTGKVEKVLSKQHSSSINAVAWAPSGLHVVSVDKGSRAVLWAQ 606          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Mouse
Match: Atg16l1 (autophagy related 16-like 1 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1924290])

HSP 1 Score: 290.041 bits (741), Expect = 1.737e-89
Identity = 135/300 (45.00%), Postives = 200/300 (66.67%), Query Frame = 1
Query:  736 LPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            +P       DAH+GE+  V+FSP    LATGG DR++K+W      C++K +L+G N  + +++FDS+ +++L AS  D + R+W++ DYR+R +LTGHS KV++ +FL DN RIV+GS DRTLKLWD R++ C+KT+ A S+C+D+V C+   +M SGHFDKK+R WD R +    ++ L  +IT LD++ ++  LL+C +DD L+ IDLR N   Q F+ P FK G+D  R  FSPDG YVAAGS +GS+++W+  TGK+EK L K  ++ I  V W P    + S ++  R  +W +
Sbjct:  326 VPTTASYVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEAFGDKCEFKGSLSGSNAGITSIEFDSAGAYLLAASN-DFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIV-CTEQCVM-SGHFDKKIRFWDIRSESVVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAVKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYVWSVLTGKVEKVLSKQHSSSINAVAWAPSGLHVVSVDKGSRAVLWAQ 622          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Mouse
Match: Atg16l2 (autophagy related 16-like 2 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1920933])

HSP 1 Score: 223.787 bits (569), Expect = 1.090e-64
Identity = 117/300 (39.00%), Postives = 176/300 (58.67%), Query Frame = 1
Query:  730 TNLPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLK-DQTAGIICVHWCPGSNVLASCERNKRVAIW 1626
              +P Q +  LDAH  E+  V F P+   LATGG+DR I +W+   G  +   TL G  GS+ +VDFD S S +L A+T + + +LW +G+ + + +L+GH +KV A +F     + VTGS DRT+K WD     C +T+  +S C+DVV   G  ++ISGH D+K+R WD RG      + +  R+T L +S DQ  LL+C +D++L+ IDLR++   Q F    FK  +D  +  FSPD  Y  AGS +G ++IW+  TGKLE +L+      +  V WC   N + S ++ ++V +W
Sbjct:  305 AQIPSQAQDVLDAHLSEVNAVCFGPNSSLLATGGADRLIHLWNVVGGRLEANQTLEGAGGSITSVDFDPSGSQVL-AATYNQAAQLWKVGETQSKETLSGHKDKVTAAKFKLTRHQAVTGSRDRTVKEWDLGRAYCSRTINVLSYCNDVVC--GDHIIISGHNDQKIRFWDSRGPHCIQVIPVQGRVTSLHLSYDQLHLLSCSRDNTLKVIDLRISNIRQVFRADGFKCSSDWTKAVFSPDRSYALAGSSNGDLYIWDVNTGKLETSLQGPHCTAVNAVAWCFSGNHVVSVDQGRKVVLW 601          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Mouse
Match: Atg16l2 (autophagy related 16-like 2 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1920933])

HSP 1 Score: 223.787 bits (569), Expect = 1.793e-64
Identity = 117/300 (39.00%), Postives = 176/300 (58.67%), Query Frame = 1
Query:  730 TNLPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLK-DQTAGIICVHWCPGSNVLASCERNKRVAIW 1626
              +P Q +  LDAH  E+  V F P+   LATGG+DR I +W+   G  +   TL G  GS+ +VDFD S S +L A+T + + +LW +G+ + + +L+GH +KV A +F     + VTGS DRT+K WD     C +T+  +S C+DVV   G  ++ISGH D+K+R WD RG      + +  R+T L +S DQ  LL+C +D++L+ IDLR++   Q F    FK  +D  +  FSPD  Y  AGS +G ++IW+  TGKLE +L+      +  V WC   N + S ++ ++V +W
Sbjct:  326 AQIPSQAQDVLDAHLSEVNAVCFGPNSSLLATGGADRLIHLWNVVGGRLEANQTLEGAGGSITSVDFDPSGSQVL-AATYNQAAQLWKVGETQSKETLSGHKDKVTAAKFKLTRHQAVTGSRDRTVKEWDLGRAYCSRTINVLSYCNDVVC--GDHIIISGHNDQKIRFWDSRGPHCIQVIPVQGRVTSLHLSYDQLHLLSCSRDNTLKVIDLRISNIRQVFRADGFKCSSDWTKAVFSPDRSYALAGSSNGDLYIWDVNTGKLETSLQGPHCTAVNAVAWCFSGNHVVSVDQGRKVVLW 622          
BLAST of Autophagy-related protein 16-1 vs. UniProt/SwissProt
Match: sp|Q8C0J2|A16L1_MOUSE (Autophagy-related protein 16-1 OS=Mus musculus OX=10090 GN=Atg16l1 PE=1 SV=1)

HSP 1 Score: 290.041 bits (741), Expect = 7.942e-89
Identity = 135/300 (45.00%), Postives = 200/300 (66.67%), Query Frame = 1
Query:  736 LPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            +P       DAH+GE+  V+FSP    LATGG DR++K+W      C++K +L+G N  + +++FDS+ +++L AS  D + R+W++ DYR+R +LTGHS KV++ +FL DN RIV+GS DRTLKLWD R++ C+KT+ A S+C+D+V C+   +M SGHFDKK+R WD R +    ++ L  +IT LD++ ++  LL+C +DD L+ IDLR N   Q F+ P FK G+D  R  FSPDG YVAAGS +GS+++W+  TGK+EK L K  ++ I  V W P    + S ++  R  +W +
Sbjct:  310 VPTTASYVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEAFGDKCEFKGSLSGSNAGITSIEFDSAGAYLLAASN-DFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIV-CTEQCVM-SGHFDKKIRFWDIRSESVVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAVKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYVWSVLTGKVEKVLSKQHSSSINAVAWAPSGLHVVSVDKGSRAVLWAQ 606          
BLAST of Autophagy-related protein 16-1 vs. UniProt/SwissProt
Match: sp|Q676U5|A16L1_HUMAN (Autophagy-related protein 16-1 OS=Homo sapiens OX=9606 GN=ATG16L1 PE=1 SV=2)

HSP 1 Score: 286.574 bits (732), Expect = 2.212e-87
Identity = 136/300 (45.33%), Postives = 201/300 (67.00%), Query Frame = 1
Query:  736 LPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            +P       DAH+GE+  V+FSP    LATGG DR++K+W      C++K +L+G N  + +++FDS+ S++L AS  D + R+W++ DYR+R +LTGHS KV++ +FL DN RIV+GS DRTLKLWD R++ C+KT+ A S+C+D+V C+   +M SGHFDKK+R WD R +    ++ L  +IT LD++ ++  LL+C +DD L+ IDLR N   Q F+ P FK G+D  R  FSPDG YVAAGS +GS++IW+  TGK+EK L K  ++ I  V W P  + + S ++  +  +W +
Sbjct:  310 VPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASN-DFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIV-CTEQCVM-SGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQ 606          
BLAST of Autophagy-related protein 16-1 vs. UniProt/SwissProt
Match: sp|Q5I0B9|ATG16_XENTR (Autophagy-related protein 16 OS=Xenopus tropicalis OX=8364 GN=atg16 PE=2 SV=2)

HSP 1 Score: 283.878 bits (725), Expect = 2.571e-86
Identity = 135/300 (45.00%), Postives = 197/300 (65.67%), Query Frame = 1
Query:  736 LPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            +P     + DAH+GE+  VRFSP    LATGG DR++K+W      C+ K +LTG N  + +++FDS+ S++L AS  D + R+W++ DYR+R +LTGHS KV++ +FL DN RIV+GS DRTLKLWD R++ C+KT+ A S+C+D+V C+   +M SGHFDKK+R WD R +    +L L  RIT LD++ ++  LL+C +DD ++  DLR N   Q F+ P FK G+D  R  FSPDG YV+AGS +G+++ WN  TGK+E+   K  ++ I  V W P    + S ++  R  +W +
Sbjct:  325 VPATAVYSFDAHDGEVNAVRFSPGSRLLATGGMDRRVKLWDVIGNKCEAKGSLTGSNAGITSIEFDSAGSYLLAASN-DFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIV-CTEQCVM-SGHFDKKIRFWDIRTECIVRELELQGRITALDLNPERTQLLSCSRDDLIKITDLRANAVQQTFSAPGFKCGSDWTRVIFSPDGSYVSAGSAEGTLYFWNVLTGKVERMFSKQHSSSINAVAWSPSGTHVVSVDKGSRGVLWSD 621          
BLAST of Autophagy-related protein 16-1 vs. UniProt/SwissProt
Match: sp|Q5RAC9|A16L1_PONAB (Autophagy-related protein 16-1 OS=Pongo abelii OX=9601 GN=ATG16L1 PE=2 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 2.146e-83
Identity = 132/292 (45.21%), Postives = 195/292 (66.78%), Query Frame = 1
Query:  760 LDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
             DAH+GE+  V+FSP    LATGG DR++K+W      C++K +L+G N  + +++FDS+ S++L AS  D + R+W++ D R+R +LTGHS KV++ +FL DN RIV+GS DRTLK WD R++ C+KT+ A S+C+D+V C+   +M SGHFDKK+R WD R +    ++ L  +IT LD++ ++  LL+C +DD L+ IDLR N   Q F+ P FK G+D  R  FSPDG YVAAGS +GS++ W+  TGK+EK L K  ++ I  V W P    + S ++  +  +W +
Sbjct:  318 FDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASN-DFASRIWTVDDSRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKHWDLRSKVCIKTVFAGSSCNDIV-CTEQCVM-SGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYTWSVLTGKVEKVLSKQHSSSINAVAWSPSGLHVVSVDKGCKAVLWAQ 606          
BLAST of Autophagy-related protein 16-1 vs. UniProt/SwissProt
Match: sp|Q8NAA4|A16L2_HUMAN (Autophagy-related protein 16-2 OS=Homo sapiens OX=9606 GN=ATG16L2 PE=1 SV=2)

HSP 1 Score: 227.254 bits (578), Expect = 5.723e-65
Identity = 119/300 (39.67%), Postives = 178/300 (59.33%), Query Frame = 1
Query:  730 TNLPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLK-DQTAGIICVHWCPGSNVLASCERNKRVAIW 1626
              LP + +  LDAH  E+  VRF P+   LATGG+DR I +W+      +   TL G  GS+ +VDFD S   +L A+T + + +LW +G+ + + +L+GH +KV A +F     + VTGS DRT+K WD     C +T+  +S C+DVV   G  ++ISGH D+K+R WD RG   T  + +  R+T L +S DQ  LL+C +D++L+ IDLR++   Q F    FK G+D  +  FSPD  Y  AGS DG+++IW+  TGKLE  L+    A +  V WC   + + S ++ ++V +W
Sbjct:  322 ARLPTRAQDVLDAHLSEVNAVRFGPNSSLLATGGADRLIHLWNVVGSRLEANQTLEGAGGSITSVDFDPSGYQVL-AATYNQAAQLWKVGEAQSKETLSGHKDKVTAAKFKLTRHQAVTGSRDRTVKEWDLGRAYCSRTINVLSYCNDVVC--GDHIIISGHNDQKIRFWDSRGPHCTQVIPVQGRVTSLSLSHDQLHLLSCSRDNTLKVIDLRVSNIRQVFRADGFKCGSDWTKAVFSPDRSYALAGSCDGALYIWDVDTGKLESRLQGPHCAAVNAVAWCYSGSHMVSVDQGRKVVLW 618          
BLAST of Autophagy-related protein 16-1 vs. TrEMBL
Match: A0A2S1BJF9 (Atg16L OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 909.827 bits (2350), Expect = 0.000e+0
Identity = 446/529 (84.31%), Postives = 490/529 (92.63%), Query Frame = 1
Query:   49 MDKNDFKTLIKARLSERNEKESLVNKKIIFDYEIILCRFNTSQKQLDSLKYENEKLRSSVPVSNDQTISRKVYDMQEELTNAVKEKSALNIKILEFKLLCNNKDKDLQDLKQNIHSLKDQISKQEELIRTSSDTIRKLEDIKRTLTDEISANLMAYRSLDTKYRELEESSYVLKDTVKKLQQALXXXXXXXXXXXXXXXQDALKQTLIEAANSTVDIDLMKMK-NIYITNLPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            M+ NDFKTLIK RL ER EKES VNK II+DYE+IL RFN+SQKQLDSLKYENEK R+S PVSNDQTISRK+Y++QEELTNAVKEKS+LNI+ LE KL+CNNKDK++QDLKQNI SLKDQI KQEELI+TSSDTIRKLEDIKRTLTDEISANLMAYRSLDTK+RELEES++VLKDTVKKLQQALEDKKNEE+D K++A+QDA+K++LIEAAN++VDID M+M   +Y+T LP +LKQTLDAHEGEMGCVRFSPSG FLAT GSDRKIKIWSHN+G+C+YK TLTGCNGSVIAVD+D++ESFILGASTLDSSCRLWS GDYRMRLSLTGHSNKVVAGRFLADNTR+VTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCS LGLMISGHFDKKLRMWDHRGDLNTDQLVLS RITGLDIS+DQNTLLACLKDDSLQTIDLRMNQFI NFT PQFK G DL RPCFSPDGQYV AG H+G++FIWNSRT KLEKTLKDQ+  I+CV+WCP SNVLASCERNKRV IW E
Sbjct:    1 MNNNDFKTLIKNRLLERLEKESYVNKNIIYDYEVILSRFNSSQKQLDSLKYENEKFRTSTPVSNDQTISRKIYEIQEELTNAVKEKSSLNIQNLELKLICNNKDKEIQDLKQNIRSLKDQILKQEELIKTSSDTIRKLEDIKRTLTDEISANLMAYRSLDTKFRELEESNHVLKDTVKKLQQALEDKKNEEFDKKFRAEQDAVKKSLIEAANTSVDIDFMRMSYPVYVTILPHELKQTLDAHEGEMGCVRFSPSGQFLATSGSDRKIKIWSHNHGSCEYKATLTGCNGSVIAVDYDAAESFILGASTLDSSCRLWSTGDYRMRLSLTGHSNKVVAGRFLADNTRVVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSSLGLMISGHFDKKLRMWDHRGDLNTDQLVLSGRITGLDISKDQNTLLACLKDDSLQTIDLRMNQFISNFTAPQFKPGMDLVRPCFSPDGQYVVAGGHEGTIFIWNSRTAKLEKTLKDQSTAIVCVNWCPTSNVLASCERNKRVTIWSE 529          
BLAST of Autophagy-related protein 16-1 vs. TrEMBL
Match: A0A4Z2DTP2 (Autophagy-related protein OS=Schistosoma japonicum OX=6182 GN=EWB00_006012 PE=4 SV=1)

HSP 1 Score: 385.571 bits (989), Expect = 6.716e-124
Identity = 199/499 (39.88%), Postives = 314/499 (62.93%), Query Frame = 1
Query:  142 YEIILCRFNTSQKQLDSLKYENEKLRSSVPVSNDQTISRKVYDMQEELTNAVKEKSALNIKILEFKLLCNNKDKDLQDLKQNIHSLKDQISKQEELIRTSSDTIRKLEDIKRTLTDEISANLMAYRSLDTKYRELEESSYVLKDTVKKLQQALXXXXXXXXXXXXXXXQDALKQTLIEAANSTV---DIDLMKMKNIYITNLPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAIWG 1629
            +E+ LC+ + S+ QL     E EK++S      +Q    KV+ +QEE+T   ++K +L   +++   +   KD  LQ     I  L++ +   +       + +++LE+IK  LTDE +++L+A ++L+T+ R+LE+ +  L   +K LQ  +E  KN EYD +Y+  Q+ +++ L +A NST+   D D +       + LP  +   +DA+EGE+  VRF+PSG    + G DRK+++W++    C+  +TL GCN +V A+DFD +E+ +LGAS+ D SCR+W++ D R+R++LTGHS +V++ +F+    R+VT S+DRT+K+WD     C +T++A S   DVVVC  +  +++GHFD+ LR+WD R   NT +++LS RITG+DIS D  T+LAC ++++L+ ++LRMNQ  Q      F+ G D+ RPCFSPD  YVAAG HDG V+IWN+ +G LE  L+D T  ++C HW P  N L SCER K+  +W 
Sbjct:   53 HELTLCQQDKSKIQL-----EFEKIKSVKSYDYEQ----KVFHLQEEVTELHRQKGSLAQSVIDLNKVLQEKDILLQSKNVKISELEECLKANQRQNHNLMEKVKELEEIKELLTDEQASHLLATKALETRNRQLEDDNVQLIKRIKTLQSTVERLKNIEYDVQYRKSQETIRKNLQDAVNSTIFVNDSDSLDKPLPCKSALPHSVAVKIDANEGEVNSVRFTPSGHIFGSAGFDRKVRLWTYLNRKCEIHSTLLGCNAAVTAIDFDPNETAVLGASS-DFSCRVWTLNDSRLRVNLTGHSERVISAKFMGSANRVVTASSDRTIKIWDVDKCCCKRTIMAASTFQDVVVCPSISALVTGHFDQHLRIWDERTGENTGKILLSGRITGMDISSDMTTVLACTRNNTLEIVNLRMNQVTQCLKADGFQTGLDIVRPCFSPDSDYVAAGGHDGGVYIWNTISGSLETCLRDHTNIVVCCHWNPNGNSLISCERIKKAIVWS 541          
BLAST of Autophagy-related protein 16-1 vs. TrEMBL
Match: A0A183MU82 (WD_REPEATS_REGION domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS19607 PE=4 SV=1)

HSP 1 Score: 379.022 bits (972), Expect = 2.007e-121
Identity = 198/497 (39.84%), Postives = 308/497 (61.97%), Query Frame = 1
Query:  145 EIILCRFNTSQKQLDSLKYENEKLRSSVPVSNDQTISRKVYDMQEELTNAVKEKSALNIKILEFKLLCNNKDKDLQDLKQNIHSLKDQISKQEELIRTSSDTIRKLEDIKRTLTDEISANLMAYRSLDTKYRELEESSYVLKDTVKKLQQALXXXXXXXXXXXXXXXQDALKQTLIEAANSTV---DIDLMKMKNIYITNLPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAIW 1626
            E+ LC     Q++  S++ E EK++S      +Q    KV+ +QEE+T   ++K  L   +++   +   KD  LQ     I  L+D +   +       + ++ LE+ K  LTDE +++LM  ++L+TK R+LE+ +  L   +K LQ  +E  KN EYD +Y+  Q+ +++ L +A NST+   D D         + LP  +   +DA+E E+  VRF+PSG    + G DRK+++W++  G C+  +TL GCN +V A+DFD +E+ +LGAS+ D SCR+W++ D R+R++LTGHS +V++ +F+    R+VT S+DRT+K+WD     C +T++A S   DVVVC  +  +++GHFD+ LR+WD R   NT +++LS RITG+DIS D  T+L+C ++++L+ +DLRMNQ  Q      F+ G D+ RPCFSPD  YVAAG HDG V+IW++ +G LE  L+D T  ++C HW P  N L SCER K+  +W
Sbjct:   54 ELTLC-----QQEKSSIQLELEKIKSVKSYDYEQ----KVFHLQEEVTELHRQKGNLAQNVIDLNRVLQEKDTLLQSKSLKISELEDCLKANQVQNHHLMEKVKGLEETKELLTDEQASHLMTAKALETKNRQLEDDNLQLMKRIKALQSTVERLKNIEYDVQYRKTQETIRKNLQDAVNSTIFVTDSDCPDKPLPCKSALPRNVAVKIDANENEVNSVRFTPSGHIFGSAGFDRKLRLWTYLNGKCEIHSTLVGCNAAVTAIDFDPNETAVLGASS-DFSCRVWTLNDSRLRVNLTGHSERVISAKFMRSANRVVTASSDRTIKIWDVDKCCCRRTIMAASTFQDVVVCPSMSALVTGHFDQHLRIWDERSGENTGKILLSGRITGMDISSDFTTVLSCTRNNTLEIVDLRMNQVTQCLKADGFQTGLDIVRPCFSPDSDYVAAGGHDGGVYIWSTVSGNLEICLRDHTNIVVCCHWNPNGNSLVSCERIKKAIVW 540          
BLAST of Autophagy-related protein 16-1 vs. TrEMBL
Match: A0A0X3NIN5 (WD_REPEATS_REGION domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR112799 PE=4 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 3.270e-121
Identity = 195/486 (40.12%), Postives = 305/486 (62.76%), Query Frame = 1
Query:  193 LKYENEKLRSSVPVSN---DQTISRKVYDMQEELTNAVKEKSALNIKILEFKLLCNNKDKDLQDLKQNIHSLKDQISKQEELIRTSSDTIRKLEDIKRTLTDEISANLMAYRSLDTKYRELEESSYVLKDTVKKLQQALXXXXXXXXXXXXXXXQDALKQTLIEAANSTVDIDLMKMK---NIYITNLPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            L+ EN+ L     + N    Q    K++ +QEE+T   +EK  L   ++        KD+ +Q   ++I  L++ +   +E  R     + ++++  + L DE +A ++  +S+++K R LEE +  L   ++ LQ+ +ED KN E D K + +++A+++ L++AA + V+ID    +   +  +  +P + +  +D  E ++ CVRFSPSG+   +GG DRK+ +W      C+ +  L GCN  V AVDF+  E+ +LGAS+ D +CR+W++ D R++++LTGHS +V+A RF+ D+ R+VT S DRT+KLWD   R C +T+L +SACHDVV C  L  +ISGHFDKKLR+WD R    T+++ LS RITGLD+S D + +LAC ++DSL TI+LR N+ +++F    F + +DL RPCFSPDGQYVA GS DG V+IWN+ +G LE  L+     +IC +W P  + L SCER +RV +W +
Sbjct:   57 LQKENQTLAVKAELGNPVDSQDTRDKLFRLQEEVTELHREKGRLATDVITLTKTVQTKDQVVQKQAKSIVRLEEIVRDLQERNRICLSELSEVKNANQVLLDEQAATMLTVQSVESKNRLLEEDNAKLIRQIRILQREVEDLKNFESDVKLRLRREAVQRGLLDAAAAQVNIDGQTAEASSSFAVATVPSKAQAKVDLPE-DVNCVRFSPSGLLFCSGGLDRKVSVWKVVNDRCELQAALVGCNAGVSAVDFNPHETMVLGASS-DFACRVWTLSDNRLKINLTGHSERVLAARFMGDSNRVVTTSVDRTIKLWDLEKRQCTRTLLPVSACHDVVACCSLQSVISGHFDKKLRIWDQRSGSMTNEVSLSGRITGLDLSSDGSYILACTRNDSLHTIELRQNEVVRSFQADGFHINSDLVRPCFSPDGQYVACGSQDGGVYIWNAMSGALEAVLRGHENMVICANWSPLGHSLVSCERGRRVIVWSQ 540          
BLAST of Autophagy-related protein 16-1 vs. TrEMBL
Match: G4V8R7 (Family S9 non-peptidase homologue (S09 family) OS=Schistosoma mansoni OX=6183 GN=Smp_210840 PE=4 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 3.294e-121
Identity = 193/488 (39.55%), Postives = 306/488 (62.70%), Query Frame = 1
Query:  175 QKQLDSLKYENEKLRSSVPVSNDQTISRKVYDMQEELTNAVKEKSALNIKILEFKLLCNNKDKDLQDLKQNIHSLKDQISKQEELIRTSSDTIRKLEDIKRTLTDEISANLMAYRSLDTKYRELEESSYVLKDTVKKLQQALXXXXXXXXXXXXXXXQDALKQTLIEAANSTV---DIDLMKMKNIYITNLPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAIWG 1629
            Q++  +++ E EK++S      +Q    KV+ +QEE+T   ++K +L   +++   +   KD  LQ     I  L+D +   +       + +++LE+ K  LTDE +++L+  ++L+TK R+LE+ +  L   +K LQ  +E  KN EYD +Y+  Q+ +++ L +A NST+   D D         + LP  +   +DA+E E+  VRF+PSG    + G DRK+++W++  G C+  +TL GCN +V A+DFD +E+ +LGAS+ D SCR+W++ D R+R++LTGHS +V++ +F+    R+VT S+DRT+K+WD     C +T++A S   DVVVC  +  +++GHFD+ LR+WD R   NT++++LS RITG+DIS D  T+LAC ++++L+ +DLR NQ  Q      F+ G D+ RPCFSPD  YVAAG HDG V+IW++ +G LE  L+D T  ++C HW P  N L SCER K+  +W 
Sbjct:   59 QQEKSAIQLELEKIKSVKSYDYEQ----KVFHLQEEVTELHRQKGSLAQNVIDLNRVLQEKDTLLQSKSLKISELEDCLKANQAQNHHLMERVKELEETKELLTDEQASHLLTTKALETKNRQLEDDNLQLMKRIKALQSTVERLKNIEYDVQYRKAQETIRKNLQDAVNSTIFVTDSDCSDKPLPCKSALPRNVAVKIDANENEVNSVRFTPSGHIFGSAGFDRKLRLWTYLNGKCEIHSTLVGCNAAVTAIDFDPNETAVLGASS-DFSCRVWTLNDSRLRVNLTGHSERVISAKFMGSANRVVTASSDRTIKIWDVDKCCCRRTIMAASTFQDVVVCPSMSALVTGHFDQHLRIWDERSGENTNKILLSGRITGMDISSDFTTVLACTRNNTLEIVDLRTNQVTQCLKADGFQTGLDIVRPCFSPDSDYVAAGGHDGGVYIWSTVSGNLEICLRDHTNIVVCCHWNPNGNSLVSCERIKKAIVWS 541          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Cavefish
Match: atg16l1 (autophagy related 16 like 1 [Source:NCBI gene;Acc:103023450])

HSP 1 Score: 296.204 bits (757), Expect = 3.631e-92
Identity = 143/300 (47.67%), Postives = 199/300 (66.33%), Query Frame = 1
Query:  736 LPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            +P     T DAH+GE+  VRFSP    LATGG DR++K+W    G C+ K  LTG N  + +++FDS+ S++L AS  D + R+W++ DYR+R +LTGHS KV++ RFL DN RIV+GS DRTLKLWD R++ C+KT+ A S+C+D+V C+   +M SGHFDKK+R WD R +    +L L  R+T LD++ D+  LL C +DD ++ IDLR N   Q F+   FK G+D  R  FSPDG YVAAGS DG +++WN  TGKL+KTL K+ ++ I  V W P    + S E+  +  +W +
Sbjct:  304 VPSTALHTFDAHDGEVNAVRFSPGSRLLATGGMDRRVKLWEVVAGRCEPKGALTGSNAGITSIEFDSAGSYLLAASN-DFASRIWTVDDYRLRHTLTGHSGKVLSARFLLDNARIVSGSYDRTLKLWDLRSKVCMKTVFAGSSCNDIV-CTEQCVM-SGHFDKKVRFWDIRAESIVCELELLGRVTSLDLNHDRTELLTCSRDDLVKIIDLRNNSVRQTFSAQGFKCGSDFTRVTFSPDGGYVAAGSADGVLYVWNVLTGKLDKTLDKNHSSAINSVSWSPSGTYVVSVEKGSKAVLWSD 600          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Cavefish
Match: atg16l2 (autophagy-related protein 16-2-like [Source:NCBI gene;Acc:103034420])

HSP 1 Score: 245.743 bits (626), Expect = 4.419e-73
Identity = 125/302 (41.39%), Postives = 181/302 (59.93%), Query Frame = 1
Query:  730 TNLPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQ-TAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
              +P +   +LDAHE  +  VRFSP    LATGG+DR IK+W    G    + TL G N  + +++FDS+ + IL AS  D S   W + D   + +LTGHS KV A RF  +  ++VTGS DRT+K+WD +  +C++T+  +S C DVV CS    +ISGH+D+K+R WD R    T ++ L  ++T LDIS +   LL+C +D+SLQ +DLRM+     F    FK G+D  +  FSPDG Y+ AGS DG+V++WN  TGKLE  L D+    +  V W      + S ++++R  +W +
Sbjct:  289 ARVPAKAIYSLDAHEQGINAVRFSPRSNLLATGGTDRVIKLWDIKAGMLHNRGTLDGSNEGITSIEFDSTGTRILAAS-YDKSALFWRLDDCVPKFTLTGHSRKVTAARFKCNLRQVVTGSADRTVKIWDLQRTACIQTIEVLSYCSDVV-CSEY-YIISGHYDRKIRFWDSRAASCTQEVPLQGKVTSLDISPNHRELLSCSRDESLQLVDLRMSNTRMAFRAEGFKCGSDSTKAIFSPDGSYLVAGSADGAVYVWNVSTGKLETRLSDKHRCSVNAVAWSMSGEYVVSVDKSRRAILWSD 587          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Cavefish
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:103033424])

HSP 1 Score: 115.931 bits (289), Expect = 4.317e-28
Identity = 86/305 (28.20%), Postives = 154/305 (50.49%), Query Frame = 1
Query:  748 LKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACD--YKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLG-LMISGHFDKKLRMWDHRGDLNTDQLV--LSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPD-----GQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASC--ERNKRVAIW 1626
            LK TL  H   +  V+FSPSG +LA+  +D+ IKIW    GA D  ++ T++G    +  V + S  + ++ AS  D + ++W +   +   +L GHSN V    F   +  IV+GS D ++++WD +T  C+KT+ A S     V  +  G L++S  +D   R+WD         L+   +  ++ +  S +   +LA   D++L+  D    + ++ +T      G+   + C   +     G+++ +GS D  V+IWN +T ++ + L+  T  +I     P  N++AS   E +K + +W
Sbjct:   37 LKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASD-DKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT------GHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW 330          

HSP 2 Score: 55.8398 bits (133), Expect = 4.684e-8
Identity = 45/212 (21.23%), Postives = 92/212 (43.40%), Query Frame = 1
Query: 1000 DYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMS-ACHDVVVCSGLGLMISGHFDKKLRMWD-HRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIW 1626
            +Y ++ +L GH+  V + +F      + + S D+ +K+W        KT+        DV   S   L++S   DK L++WD   G         S+ +   + +   N +++   D+S++  D++  + ++        V        F+ DG  + + S+DG   IW++ +G+  KTL  D    +  V + P    + +   +  + +W
Sbjct:   34 NYTLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVS----AVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLW 241          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Cavefish
Match: ENSAMXT00000007963.2 (WD repeat-containing protein 5-like [Source:NCBI gene;Acc:103023146])

HSP 1 Score: 115.161 bits (287), Expect = 7.851e-28
Identity = 85/303 (28.05%), Postives = 152/303 (50.17%), Query Frame = 1
Query:  748 LKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLG-LMISGHFDKKLRMWDHRGDLNTDQLV--LSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPC----FS-PDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASC--ERNKRVAIW 1626
            LK TL  H   +  V+FSP+G +LA+  +D+ IKIW    G   ++ +L+G    +  V +    + ++ AS  D + ++W MG  +   +L GHSN V    F   +  +V+GS D ++++WD +T  C+KT+ A S     V  +  G L++S  +D   RMWD         L+   +  ++ +  S +   +LA   D++L+  D    + ++ +T      G+   + C    FS   G+++ +GS D  V+IWN +T ++ + L+     +I     P  N++AS   E +K + +W
Sbjct:   34 LKFTLAGHTKAISSVKFSPNGEWLASSSADKLIKIWGSFDG--KFEKSLSGHKLGISDVAWSPDSNLLVSASD-DKTLKIWDMGSGKCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT------GHKNEKYCVFANFSVTGGKWIVSGSEDHMVYIWNLQTKEIVQKLQGHADVVIATACHPSENIIASAALENDKTIKLW 327          

HSP 2 Score: 52.373 bits (124), Expect = 7.640e-7
Identity = 42/213 (19.72%), Postives = 94/213 (44.13%), Query Frame = 1
Query: 1000 DYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMS-ACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHR--ITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIW 1626
            +Y ++ +L GH+  + + +F  +   + + S D+ +K+W +      K++        DV       L++S   DK L++WD  G     + +  H   +   + +   N +++   D+S++  D++  + ++        V        F+ DG  + + S+DG   +W+S +G+  KTL  D    +  V + P    + +   +  + +W
Sbjct:   31 NYTLKFTLAGHTKAISSVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSLSGHKLGISDVAWSPDSNLLVSASDDKTLKIWD-MGSGKCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVS----AVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLW 238          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Cavefish
Match: snrnp40 (small nuclear ribonucleoprotein U5 subunit 40 [Source:NCBI gene;Acc:103032740])

HSP 1 Score: 114.775 bits (286), Expect = 1.238e-27
Identity = 86/296 (29.05%), Postives = 146/296 (49.32%), Query Frame = 1
Query:  760 LDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIV-TGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHR-----ITGLDISRDQNTLLACLKDDSLQTIDLRM----NQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRV 1617
            L  HEGE+ C +F P+G  LA+ G DR I +WS  YG C+   TL G +G+V+ + +++  S +  AST  + C +W          L GH++ V +        ++  TGS D T+KLWD R ++ V T         V        +ISG  D  +++W    DL  ++L+ S +     +TGL +S + + LL+   D+S++  D+R      + ++ F         +L R  +S DG  +AAGS D  V++W++ + ++   L      +  V + P   ++ S   +KR+
Sbjct:   52 LSGHEGEVYCCKFHPNGAMLASAGYDRLILLWS-VYGDCENFATLKGHSGAVMELHYNTDGSLLYSASTDKTVC-VWDSETGERVKRLKGHTSFVNSCFPARRGPQLACTGSDDGTVKLWDIRKKASVHTFQNTYQVLSVTFNDTSDQIISGGIDNDIKVW----DLRQNKLIYSMQGHGDSVTGLSLSSEGSYLLSNSMDNSVRVWDIRPFAPKERCVKIFQGNVHNFEKNLLRCSWSSDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSVNEVAFHPEEPIVLSGSSDKRL 341          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Sea Lamprey
Match: snrnp40 (small nuclear ribonucleoprotein 40 (U5) [Source:ZFIN;Acc:ZDB-GENE-040426-978])

HSP 1 Score: 119.013 bits (297), Expect = 1.102e-29
Identity = 88/298 (29.53%), Postives = 147/298 (49.33%), Query Frame = 1
Query:  760 LDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIV-TGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHR-----ITGLDISRDQNTLLACLKDDSLQTIDLR----MNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAI 1623
            L  HEGE+ C +F P+G  LA+ G DR I +W+  YG CD    L G  G+++ + + +  S I  +ST D +  LW          L GH++ V A        ++V T S D T+KLWDTR +  V +      C  V        ++SG  D  +++W    DL  ++L+ + +     +TGL +S D + LL+   D+S++  D+R    M + ++ F         +L +  +S DG  V+AGS D  V+IW++ + ++   L      +  V + P   ++ SC  +KR+ +
Sbjct:   53 LTGHEGEVYCCKFHPNGNTLASAGFDRTILMWN-VYGDCDNYAHLKGHTGAILDIHYSTDGSTIFTSST-DKTVGLWDSETGERIKRLKGHTSFVNACFPARRGPQMVCTASDDGTVKLWDTRKKGSVHSFQNTYQCLSVTFNDTSDQILSGGIDNVIKVW----DLRQNKLIYTMKGHNDSVTGLSLSPDGSYLLSNAMDNSVRIWDIRPFAPMERCVKIFQGNVHNFEKNLLKCSWSHDGSKVSAGSADRFVYIWDTTSRRILYKLPGHAGSVNDVAFHPEEPIVLSCANDKRLYL 344          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004902.1 (pep scaffold:Pmarinus_7.0:GL478254:5937:33805:1 gene:ENSPMAG00000004437.1 transcript:ENSPMAT00000004902.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.138 bits (248), Expect = 2.336e-22
Identity = 73/259 (28.19%), Postives = 121/259 (46.72%), Query Frame = 1
Query:  757 TLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLA-MSACHD---------VVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVL-SHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIW 1500
            T   H   +G   F+P+G  LATGG D  +K+W  + GAC    TL G   +V    + S   FI  +S++D+S ++W +   R R +L GH++ V +  FL  ++ ++T S D+TL LWD RT  C +     + +C+          VV C   G+         +++WD R    T  L L  H    L      + +     D  ++ +DL +   ++  +  +  V   +    FSPDG  + +G  DG++ +W
Sbjct:  372 TGQGHTDWIGDCDFNPTGTNLATGGGDSTVKVWDFSQGAC--VLTLEGHGHAVWGCSWHSCGDFI-ASSSMDNSSKVWDVNSERCRQTLRGHTDSVNSVEFLPYSSTLLTSSADKTLSLWDARTGRCAQIFYGHLHSCNHGTFNLKGDTVVSCDSYGV---------IKVWDVRKGTATMTLNLGPHPANRLSFHPSGHVMAVASDDACVRIVDL-LTGHVETLSGHEDAVQAVV----FSPDGDTLFSGGSDGTIRMW 613          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Sea Lamprey
Match: POC1A (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 91.6633 bits (226), Expect = 6.668e-20
Identity = 69/292 (23.63%), Postives = 125/292 (42.81%), Query Frame = 1
Query:  766 AHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAIWGE*YD 1641
             H+  +  V+FSPSG  + +   D+ +++W  +       T       +V +V F +    ++ AS  D S ++W++   +   SL  HSN V + +F  D   IV+GS DRT+++WD+ +R CV T                              ++H G +N            +D       + A   D++++  D+RMN+ +Q++      V N L    F P G Y+   S+D ++ + +   G+L  TL         V +    +  AS   +++V +W   +D
Sbjct:   58 GHKDAVMSVQFSPSGHLVVSASRDKTVRLWVPSVKG--ESTVFKAHTATVRSVSFSADGQSLVTASD-DKSIKVWTVHRQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHT-----------------------------FYEHGGFVNQ-----------VDFHPSGTCIAAAGTDNTVKVWDIRMNKLLQHYQVHGAAV-NSL---SFHPTGNYLITASNDSTLKVLDLVEGRLFYTLHGHQGPATAVAFSRAGDFFASGGSDEQVMVWKTNFD 302          

HSP 2 Score: 56.9954 bits (136), Expect = 7.263e-9
Identity = 45/179 (25.14%), Postives = 78/179 (43.58%), Query Frame = 1
Query:  757 TLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLG-LMISGHFDKKLRMWDHRGD-LNTDQLVLSHR 1287
            +L+ H   +   +FSP G  + +G  DR +++W  N   C +  T     G V  VDF  S + I  A T D++ ++W +   ++      H   V +  F      ++T S D TLK+ D        T+         V  S  G    SG  D+++ +W    D ++  +++ SH+
Sbjct:  139 SLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVH--TFYEHGGFVNQVDFHPSGTCIAAAGT-DNTVKVWDIRMNKLLQHYQVHGAAVNSLSFHPTGNYLITASNDSTLKVLDLVEGRLFYTLHGHQGPATAVAFSRAGDFFASGGSDEQVMVWKTNFDSVDYSEVLRSHK 314          

HSP 3 Score: 51.9878 bits (123), Expect = 2.700e-7
Identity = 44/213 (20.66%), Postives = 91/213 (42.72%), Query Frame = 1
Query: 1000 DYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMS-ACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVL-SHRIT--GLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAIW 1626
            D  +     GH + + +  F  +  ++ +GS D  L +W+ + ++     +    A   V       L++S   DK +R+W     +  +  V  +H  T   +  S D  +L+    D S++   +   +F+ +      +  N +    FSPDG+ + +GS D +V +W+S + +   T  +    +  V + P    +A+   +  V +W
Sbjct:    7 DPSLERHFKGHRDTITSVDFNPNMKQLASGSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLW--VPSVKGESTVFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKFLYSLN----QHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVW 213          

HSP 4 Score: 47.7506 bits (112), Expect = 4.962e-6
Identity = 28/78 (35.90%), Postives = 42/78 (53.85%), Query Frame = 1
Query:  667 LIEAAN-STVDI-DLMKMKNIYITNLPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTL 894
            LI A+N ST+ + DL++ +  Y          TL  H+G    V FS +G F A+GGSD ++ +W  N+ + DY   L
Sbjct:  243 LITASNDSTLKVLDLVEGRLFY----------TLHGHQGPATAVAFSRAGDFFASGGSDEQVMVWKTNFDSVDYSEVL 310          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Sea Lamprey
Match: pafah1b1b (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b [Source:NCBI gene;Acc:394247])

HSP 1 Score: 79.7221 bits (195), Expect = 2.203e-16
Identity = 72/295 (24.41%), Postives = 129/295 (43.73%), Query Frame = 1
Query:  751 KQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLG-LMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLK--DDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAIW 1626
            K  L  H   +  V F P    + +   D  IK+W +  G  D++ TL G   SV  + FD S   +L + + D + +LW    +    ++ GH + V +  F+ +   +V+ S D+T+K+W+ +T  CVKT         +V  +  G L+ S   D+ +R+W           V + +    ++ R+   ++ C+    D+   + L         T  + K G    +P     G Y+ +GS D ++ +W+  TG    TL      +  V + PG   + SC  +K + +W
Sbjct:   40 KYALSGHRSPVTRVIFHPVFSVIVSASEDATIKVWDYETG--DFERTLKGHTDSVQDISFDLSGK-MLASCSADMTVKLWDFQSFECLRTMHGHDHNVSSVAFMPNGDHLVSASRDKTMKMWEVQTGYCVKTFTGHREWVRMVRPNQDGSLIASCSNDQTVRVW-----------VTATKECKAEL-REHEHVVECVSWAPDAASPVILEA-------TGAEAKKGG---KP-----GPYLLSGSRDKTIKMWDISTGICVITLVGHDNWVRGVLFHPGGKFILSCADDKTLRVW 304          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Sea Lamprey
Match: wdr82 (WD repeat domain 82 [Source:NCBI gene;Acc:321614])

HSP 1 Score: 78.1814 bits (191), Expect = 4.646e-16
Identity = 73/293 (24.91%), Postives = 128/293 (43.69%), Query Frame = 1
Query:  778 EMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDF-DSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTM--LAMSAC----HDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRI--TGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAG-IICVHWCPGSNVLASCERNKRVAIW 1626
            ++ C  F+P+G  + +   D  I ++    G    K TL      V  + +  ++ + +  ++ +D + R  S+ D +      GH+ KVVA      +   ++ S D+T++LWD R+ +C   M       C      ++  +GL   +   +D  LR +D +G   T +L        TGL IS D   +L       L+ +D      +  FT      G  L    FSPD Q++  GS DG + +W++ +G     L  +  G + C+ + P   ++AS   N  +A W
Sbjct:   23 KINCFDFAPNGETMISSSDDDSIVLYDCQEGKP--KRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHTKKVVALCMSPVDDTFISASLDKTIRLWDLRSPNCQGLMHLQGRPVCSFDPEGLIFAAGLNSEMVKLYD--LRSFD-KGPFATFRLQQDRTCDWTGLKISNDGKFILIATNGGVLRLVDAFQGSALHMFTGHTNSKGITL-EASFSPDSQFIMTGSEDGKIHVWHTESGTKVAILDGKHTGPVTCLQFNPKYMMVASACAN--MAFW 307          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Yeast
Match: RSA4 (WD-repeat protein involved in ribosome biogenesis; may interact with ribosomes; required for maturation and efficient intra-nuclear transport or pre-60S ribosomal subunits, localizes to the nucleolus [Source:SGD;Acc:S000000668])

HSP 1 Score: 97.8265 bits (242), Expect = 4.796e-22
Identity = 95/384 (24.74%), Postives = 154/384 (40.10%), Query Frame = 1
Query:  649 DALKQTLIEAA-NSTVD-IDLMKMKNIYITNLPC-QLKQTLDAHEGEMGCVRFSP-SGMFLATGGSDRKIKIWSHNYGACDYKT---TLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWS------MGDYRMRLSLTGHSNKVVAGRF-------LADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHR--ITGLDISRDQNTLLACLKDDSLQ--TIDLRMNQFIQNFTTPQFKVGND--------------LWRP--------------------CFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAIW 1626
            D L  +LI+   NST D I L+          P  +    +  H   + C  F+P +   + TG  D   +IW      CD +T   TL G    V+ V + S +  ++   ++D++ RLW       +GD     +L GHS  + +  +            R+ + S D T+K+WDT +R C  TM   +     V   G GL+ SG  D+ +R+WD         ++ SH   +  L +S D    +        +  T +    + ++N+     K GN               LW P                     FSPDG+Y+ + S D S+ +W+ R GK   T +   A +  V W     +L SC ++  + +W
Sbjct:   99 DNLYSSLIKPGYNSTEDQITLLYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWD-----CDTQTPMHTLKGHYNWVLCVSW-SPDGEVIATGSMDNTIRLWDPKSGQCLGD-----ALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW 471          

HSP 2 Score: 62.3882 bits (150), Expect = 1.031e-10
Identity = 69/340 (20.29%), Postives = 135/340 (39.71%), Query Frame = 1
Query:  754 QTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDS------SESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRS-CVKTM---------LAMSACHDV---------------------------VVCSGLG----LMISGHFDKKLRMWDHRGDLNTDQLVLSHR--ITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAIW 1626
             TL  H   + CV +SP G  +ATG  D  I++W    G C     L G +  + ++ ++            L +S+ D + ++W       + +++GH+N V   ++      + +GS DRT+++WD  ++  C+  +         L++S  + +                            +C   G    +M++   D  + +W+          +  H+  +  +  S D   +++   D+S++  D R  +FI  F      V    W    S D + + + S D ++ +W+ RT KL   L      +  V W      + S  ++K V +W
Sbjct:  180 HTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQC-LGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKW-GGQGLLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAW----SSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513          

HSP 3 Score: 46.9802 bits (110), Expect = 6.709e-6
Identity = 38/122 (31.15%), Postives = 56/122 (45.90%), Query Frame = 1
Query:  892 LTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGL----MISGHFDKKLRMWDH 1245
            +TG    V  V F     +I+ AS  D+S +LW   D +   +  GH   V    + +D   +V+ S D TLK+WD RTR   K  + +    D V      +    + SG  DK +R+W H
Sbjct:  398 MTGHQKLVNHVAFSPDGRYIVSAS-FDNSIKLWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTR---KLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLWTH 515          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Yeast
Match: TAF5 (Subunit (90 kDa) of TFIID and SAGA complexes; involved in RNA polymerase II transcription initiation and in chromatin modification [Source:SGD;Acc:S000000402])

HSP 1 Score: 77.0258 bits (188), Expect = 3.761e-15
Identity = 61/217 (28.11%), Postives = 97/217 (44.70%), Query Frame = 1
Query:  754 QTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLT---GCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGD-YRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSA-CHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHR------ITGLDISRDQNTLLACLKDDSLQTIDLR 1371
            +TL  H G +    FSP   +L +G  D+ +++WS      D  T L    G N  V  V F     +   AS  D + RLWS    Y +R+   GH N V    F  +   + TGS+D+T ++WD  T   V+  L  +A    + VC     + +G  D  + +W    D+ T + +   R      I  L  S++ N L++   D +++  DL+
Sbjct:  519 KTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWS-----MDTHTALVSYKGHNHPVWDVSFSPLGHYFATASH-DQTARLWSCDHIYPLRI-FAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVW----DIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724          

HSP 2 Score: 73.559 bits (179), Expect = 4.364e-14
Identity = 84/332 (25.30%), Postives = 125/332 (37.65%), Query Frame = 1
Query:  700 DLMKMKNIYITNLPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKT---------------TLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTM-LAMSACH----DVVVCSGLG-LMISGHFDKKLRMWD-HRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTA-GIICVHWCPGSNVLASCERNKRVAIW 1626
            D +K+ N+ +  LP     T      +M C+ FS      A G  D  IKIWS +  + +                  TL G +G+V +  F     ++L  S  D + RLWSM  +   +S  GH++ V    F        T S D+T +LW     SC     L + A H    D V     G  + +G  DK  RMWD   GD  + +L L H    + I+        C                                     PDG++++ GS DG + +W+  TGK  K ++      I  + +    NVL S   +  V +W
Sbjct:  443 DAIKLDNLQLA-LPSVCMYTFQNTNKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSE-DKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLW-----SCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGD--SVRLFLGHTAPVISIA-------VC-------------------------------------PDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVW 721          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Yeast
Match: COP1 (Alpha subunit of COPI vesicle coatomer complex; complex surrounds transport vesicles in the early secretory pathway [Source:SGD;Acc:S000002304])

HSP 1 Score: 72.4034 bits (176), Expect = 1.089e-13
Identity = 73/294 (24.83%), Postives = 119/294 (40.48%), Query Frame = 1
Query:  748 LKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTR----------TRSCVKTMLA--------MSACHDVVVCSG-------------LGLMISGHFDKKLRMWDH-----------RGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGND-LWRPCFSPDGQYVAAGSHDGSVFIW 1500
            L    + HEG +  + F P+     + G D  IK+WS +   C Y  TLTG    V  V F     +I+ AS  D + R+W+  + +    LTGH++ V+  +F   +  IV+ S D T+++WD            T S  + M A        +  C    +  G             L L++SG  D+++++W             RG  N    V+ H          QN +++  +D +L+  DL     ++     QFK  ND  W     P      A +HD  + ++
Sbjct:   45 LLHRFEDHEGPVRGLDFHPTQPIFVSAGDDYTIKVWSLDTNKCLY--TLTGHLDYVRTVFFHRELPWIISASD-DQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFH--------PHQNLIISVGEDKTLRVWDLDKRTPVK-----QFKRENDRFWLIAAHPHINLFGA-AHDSGIMVF 321          

HSP 2 Score: 65.0846 bits (157), Expect = 1.992e-11
Identity = 64/285 (22.46%), Postives = 119/285 (41.75%), Query Frame = 1
Query:  790 VRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGL----GLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEK--TLKDQTAGIICVHWCPGSNVLASCERNKRVAIW 1626
            + F PS  ++        I++W +  G   ++       G V  +DF  ++   + A   D + ++WS+   +   +LTGH + V    F  +   I++ S D+T+++W+ + R   K +  ++  +  V+C+       L++S   D+ +R+WD  G      L   H   G     +Q +    L D SL    ++   FI    T         W   F P    + +GS D  V +W     K  +  T +  T  +  V + P  N++ S   +K + +W
Sbjct:   17 IAFHPSRPWVLVALFSSTIQLWDYRMGTLLHR--FEDHEGPVRGLDFHPTQPIFVSAGD-DYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNR---KEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIRIWDISG------LRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVK---FILEGHTRGVN-----WA-SFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKTLRVW 280          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Yeast
Match: TUP1 (General repressor of transcription; forms complex with Cyc8p, involved in the establishment of repressive chromatin structure through interactions with histones H3 and H4, appears to enhance expression of some genes [Source:SGD;Acc:S000000680])

HSP 1 Score: 72.0182 bits (175), Expect = 1.267e-13
Identity = 66/300 (22.00%), Postives = 117/300 (39.00%), Query Frame = 1
Query:  796 FSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMI-SGHFDKKLRMWDHRGDLNTDQL------VLSHR--ITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFK------VGND--LWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGS------NVLASCERNKRVAIW 1626
            FSP G FLATG  DR I                                             R+W + + ++ + L GH   + +  +     ++V+GS DRT+++WD RT  C  T+        V V  G G  I +G  D+ +R+WD       ++L         H+  +  +  +RD  ++++   D S++  +L+      +  TP         +G+   +     + + +Y+ +GS D  V  W+ ++G     L+     +I V    GS      NV A+   + +  IW
Sbjct:  451 FSPDGKFLATGAEDRLI---------------------------------------------RIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705          

HSP 2 Score: 64.3142 bits (155), Expect = 2.757e-11
Identity = 51/183 (27.87%), Postives = 81/183 (44.26%), Query Frame = 1
Query:  760 LDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLW--SMGDYRMRL-----SLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLW---------DTRTRSCVKTMLAMSACHDVVVCSGLG----LMISGHFDKKLRMWDHR 1248
            L  HE ++  + + PSG  L +G  DR ++IW    G C    TL+  +G V  V     +   + A +LD + R+W    G    RL     S TGH + V +  F  D   +V+GS DR++KLW         D++T +     +      D V+          ++SG  D+ +  WD +
Sbjct:  481 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSL--TLSIEDG-VTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKK 660          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Yeast
Match: SEC27 (Essential beta'-coat protein of the COPI coatomer; involved in ER-to-Golgi and Golgi-to-ER transport; contains WD40 domains that mediate cargo selective interactions; 45% sequence identity to mammalian beta'-COP [Source:SGD;Acc:S000003105])

HSP 1 Score: 71.633 bits (174), Expect = 1.838e-13
Identity = 48/166 (28.92%), Postives = 80/166 (48.19%), Query Frame = 1
Query:  760 LDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWS-HNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLT-GHSNKV--VAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLA-MSACHDVVVCSGLGLMISGHFDKKLRMWD 1242
             +AH   +  +   P+  ++ +G  D  +K+W+  N  A +   T  G    V+ V F+  +     +  LD + ++WS+G      +LT G    V  V    L D   ++T S D T+K+WD +T+SCV T+   MS     V    L ++ISG  D  L++W+
Sbjct:   93 FEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALE--QTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWN 256          

HSP 2 Score: 58.5362 bits (140), Expect = 1.784e-9
Identity = 44/140 (31.43%), Postives = 71/140 (50.71%), Query Frame = 1
Query:  748 LKQTLDAHEGEMGCVRFSPS-GMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDS--SESFILGASTLDSSCRLWSMGDYRMR---LSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTM 1149
            L+QT + HE  + CV F+P      A+G  DR +K+WS      ++  T TG    V  VD+     + +++ AS  D + ++W   DY+ +    +L GH + V    F      I++GS D TLK+W++ T    KT+
Sbjct:  132 LEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLT-TGQERGVNYVDYYPLPDKPYMITASD-DLTIKIW---DYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTL 266          

HSP 3 Score: 49.2914 bits (116), Expect = 1.311e-6
Identity = 59/258 (22.87%), Postives = 110/258 (42.64%), Query Frame = 1
Query:  877 DYKTTLTGCNGSVIAVDFDSSESFILGASTLDSS-CRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMS-ACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDIS---RDQNTLLACLKDDSLQTIDLRMNQFIQNF--TTPQFKVGNDL-WRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAIW 1626
            D K T +  +  V  +DF  +E ++L  +TL S    LW+        S+      V AG+F+A    I+ GS D  +++++  T   V    A       + V      ++SG  D  +++W+   +   +Q    H    + ++   +D +T  +   D +++   L   Q   NF  TT Q +  N + + P   PD  Y+   S D ++ IW+ +T     TL+   + +    + P   ++ S   +  + IW
Sbjct:    4 DIKKTFSNRSDRVKGIDFHPTEPWVL--TTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSL--GQSTPNFTLTTGQERGVNYVDYYPL--PDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIW 255          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Nematostella
Match: EDO46075 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQZ0])

HSP 1 Score: 294.664 bits (753), Expect = 2.344e-93
Identity = 167/488 (34.22%), Postives = 271/488 (55.53%), Query Frame = 1
Query:  247 TISRKVYDMQEELTNAVKEKSALNIKILEFKLLCNNKDKDLQDLKQNIHSLKDQISKQEELIRTSSDTIRKLEDIKRTLTDEISANLMAYRSLDTKYRELEESSYVLKDTVKKLQQALXXXXXXXXXXXXXXXQDALKQTLIEAANSTVDI-------DLMKMKNIYITNLPCQLKQT-----------------LDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAIWGE*Y 1638
            ++ +K++  QEELT   + KS    KI+E       KD+++      +H  ++     +      +  I +LE     L DE+    + + SL+ K+R+ +E +  L +     +    DK N + +++ + +Q  L++ LIEAA   V++       D  K +   +       +Q                   DAH+GE+   RFS SG   ATGG D+K+K+W      C  K  + GC+ +V +V+FD  E  +L AS  D +CR+W++GD R+R +LTGH+NKV+  +F+ D T++V+GS DRTLK+WD R+++C +T+ A S+C+D+V+  G+G ++SGHFDK++R+WD R +    +++L  ++T LD+S D N +LA  +DD+L+ IDLR        +T Q  V      P  SPDGQY   GS DG V+IWN+ T KLEK L++ ++ +I   W P   ++ +C+RNK   +W + Y
Sbjct:    4 SLEQKLFKAQEELTELHRRKSESAQKIVELNNNIKQKDEEILAKGAQLHDAQNNQDALKTECNNLAQVIVELEKTNEILKDELQVLQLEHTSLEEKHRKTQEENRELVERWMMQKARDADKVNLDNEHQQRIRQAKLQKDLIEAAKEPVNVPRTDGRTDRQKDRQTDVLTFRWTDRQMGKQTDDNKSIIVLYYCRQDAHDGEVLSARFSISGRLFATGGGDKKVKVWEMLNDVCLPKGIMHGCSFAVTSVEFDPQEKLLLAASN-DQACRVWTVGDERLRHTLTGHTNKVMTAKFMGDATKLVSGSHDRTLKVWDLRSKACTRTIFAGSSCNDLVINEGIGQIVSGHFDKRIRLWDTRSESIVSEILLQGKVTSLDLSPDMNQVLASTRDDTLKVIDLR--------STSQV-VATCSGFPLSSPDGQYCICGSQDGGVYIWNNSTAKLEKVLREHSSAVIVSAWHPSGGIIITCDRNKHAIVWTDKY 481          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Nematostella
Match: EDO46331 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQB4])

HSP 1 Score: 127.872 bits (320), Expect = 1.426e-32
Identity = 93/298 (31.21%), Postives = 149/298 (50.00%), Query Frame = 1
Query:  760 LDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDY----RMRLSLTGHS---NKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHR-GDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLR----MNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRV 1617
            L  HEGE+   RF PSG  LA+ G DR I +W + YG C+    L G  G+++ V F +  + +  AST D +  LW   DY    RM+  L GH+   N     R       +V+GS D T+KLWDTR R C +T   +     V        + SG  D ++++WD R  D+       +  +TG+ +S D + LL+   D++++  D+R    M + ++ F   Q     +L +  +SPDG  +AAGS D  V++W++ + ++   L      +   H+ P   +L SC  +K++
Sbjct:   54 LTGHEGEIYSSRFHPSGETLASVGFDRLIYLW-NVYGECENFAVLKGHTGAIMDVHFSTDGNTMFTAST-DKTVALW---DYETGARMK-RLKGHTSFVNSCCPSR--RGMQYVVSGSDDSTIKLWDTRKRGCAQTFQNVFQVTAVAFSDASDQIFSGGIDNEIKVWDLRKNDVLYKMSGHTDTVTGVQLSPDGSFLLSNSMDNTVRMWDVRAFAPMERCLKVFLGAQHNFEKNLIKCSWSPDGLMIAAGSADRFVYVWDTNSRRILYKLPGHAGSVNDAHFHPTEPILLSCGSDKKL 343          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Nematostella
Match: EDO33297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL6])

HSP 1 Score: 109.383 bits (272), Expect = 3.996e-26
Identity = 86/306 (28.10%), Postives = 153/306 (50.00%), Query Frame = 1
Query:  745 QLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACD--YKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLG-LMISGHFDKKLRMWDHRGDLNTDQLV--LSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPC----FS-PDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLAS--CERNKRVAIW 1626
            QLK TL  H   +  V+FS +G +LA+  +D+ IKIW    GA D  ++ T+TG    +  V + +    ++ AS  D + ++W     +   +L GHSN V    F   +  IV+GS D ++++WD +T  C+KT+ A S     V  +  G L++S  +D   R+WD         L+   +  ++ +  S +   +LA   D++L+  D    + ++ +T      G+   + C    FS   G+++ +GS D  V+IWN ++ ++ + L   +  ++C    P  N++AS   E +K + IW
Sbjct:   56 QLKYTLTGHNKAVSSVKFSHNGEWLASSSADKVIKIW----GAYDGKFEKTITGHKLGISDVAWSTDSRHLVSASD-DKTLKIWDFATGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVTAVHFNRDGALIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT------GHKNEKYCVFANFSVTGGKWIVSGSEDHKVYIWNLQSKEVVQKLDGHSDVVLCCACHPTENIIASGALENDKTIKIW 350          

HSP 2 Score: 62.3882 bits (150), Expect = 1.650e-10
Identity = 63/263 (23.95%), Postives = 104/263 (39.54%), Query Frame = 1
Query: 1000 DYRMRLSLTGHSNKVVA-------GRFLA------------------------------------DNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGL----GLMISGHFDKKLRMWDHR-GDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFT---TPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHW---CPGSNVLASCERNKRVAIW 1626
            +Y+++ +LTGH NK V+       G +LA                                    D+  +V+ S D+TLK+WD  T  C+KT+   S   + V C        L++SG FD+ +R+WD + G         S  +T +  +RD   +++   D   +  D    Q ++       P            FSP+G+Y+ A + D ++ +W+   GK  KT         CV       G   + S   + +V IW
Sbjct:   54 NYQLKYTLTGH-NKAVSSVKFSHNGEWLASSSADKVIKIWGAYDGKFEKTITGHKLGISDVAWSTDSRHLVSASDDKTLKIWDFATGKCLKTLKGHS---NYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVTAVHFNRDGALIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVK------FSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCVFANFSVTGGKWIVSGSEDHKVYIW 306          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Nematostella
Match: EDO45346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTA6])

HSP 1 Score: 95.1301 bits (235), Expect = 5.758e-21
Identity = 70/258 (27.13%), Postives = 116/258 (44.96%), Query Frame = 1
Query:  766 AHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMI-SGHFDKKLRMWDHR-GDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDL---RMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLE 1524
             H+  +  V+FSPSG  +A+   D+ +++W  +       T       +V +VDF      +L AS  D S ++W++   +   SL  H N V   +F  D   IV+GS D+T+KLWD  ++ CV T        + V     G  I +G  D  +++WD R   L       +  +  +      N L++   D +L+ +DL   R+   +     P   V        FS +G+Y A+GS D  V +W +   K++
Sbjct:   58 GHKDAILSVKFSPSGHLIASASRDKTVRLWVPSVKG--ESTVFKAHTATVRSVDFSGDGQSLLTASD-DKSLKVWTVHRQKFLYSLNAHMNWVRCAKFSPDGRLIVSGSDDKTIKLWDRTSKDCVHTFYDPGGFVNSVEFHPSGTCIAAGGTDSTVKVWDIRMNKLLQHYQAHTGAVNSVSFHPSGNYLVSASSDTTLKILDLMEGRLFYTLHGHQGPATSV-------VFSRNGEYFASGSSDEQVMVWKTNFDKVD 305          

HSP 2 Score: 69.707 bits (169), Expect = 1.084e-12
Identity = 69/296 (23.31%), Postives = 113/296 (38.18%), Query Frame = 1
Query:  748 LKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLG----LMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAI 1623
            L++    H   +  V F+P+   L TG  D  + IW        Y+    G   ++++V F  S   I  AS  D + RLW             H+  V +  F  D   ++T S D++LK+W    +   K + +++A  + V C+       L++SG  DK +++WD                     S+D      C                +  F  P    G  +    F P G  +AAG  D +V +W+ R  KL +  +  T  +  V + P  N L S   +  + I
Sbjct:   10 LERHFKGHRDTVTSVDFNPNMKQLVTGSMDSSLMIWHFKPHMRAYR--FVGHKDAILSVKFSPSGHLIASASR-DKTVRLWVPSVKGESTVFKAHTATVRSVDFSGDGQSLLTASDDKSLKVWTVHRQ---KFLYSLNAHMNWVRCAKFSPDGRLIVSGSDDKTIKLWDR-------------------TSKD------C----------------VHTFYDP----GGFVNSVEFHPSGTCIAAGGTDSTVKVWDIRMNKLLQHYQAHTGAVNSVSFHPSGNYLVSASSDTTLKI 254          

HSP 3 Score: 64.3142 bits (155), Expect = 5.241e-11
Identity = 48/186 (25.81%), Postives = 84/186 (45.16%), Query Frame = 1
Query:  757 TLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLG-LMISGHFDKKLRMWDHRGD-LNTDQLVLSHRITGLDIS 1308
            +L+AH   + C +FSP G  + +G  D+ IK+W      C +  T     G V +V+F  S + I    T DS+ ++W +   ++      H+  V +  F      +V+ S+D TLK+ D        T+         VV S  G    SG  D+++ +W    D ++  +++ +HR     +S
Sbjct:  139 SLNAHMNWVRCAKFSPDGRLIVSGSDDKTIKLWDRTSKDCVH--TFYDPGGFVNSVEFHPSGTCIAAGGT-DSTVKVWDIRMNKLLQHYQAHTGAVNSVSFHPSGNYLVSASSDTTLKILDLMEGRLFYTLHGHQGPATSVVFSRNGEYFASGSSDEQVMVWKTNFDKVDYQEVLRTHRKRAAPVS 321          

HSP 4 Score: 57.7658 bits (138), Expect = 5.929e-9
Identity = 51/218 (23.39%), Postives = 90/218 (41.28%), Query Frame = 1
Query:  991 SMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMS-ACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVL-SHRIT--GLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPC--FSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAIW 1626
            S+ D  +     GH + V +  F  +  ++VTGS D +L +W  +        +    A   V       L+ S   DK +R+W     +  +  V  +H  T   +D S D  +LL    D SL+   +   +F+ +         +  W  C  FSPDG+ + +GS D ++ +W+  +     T  D    +  V + P    +A+   +  V +W
Sbjct:    4 SLEDPTLERHFKGHRDTVTSVDFNPNMKQLVTGSMDSSLMIWHFKPHMRAYRFVGHKDAILSVKFSPSGHLIASASRDKTVRLW--VPSVKGESTVFKAHTATVRSVDFSGDGQSLLTASDDKSLKVWTVHRQKFLYSLN------AHMNWVRCAKFSPDGRLIVSGSDDKTIKLWDRTSKDCVHTFYDPGGFVNSVEFHPSGTCIAAGGTDSTVKVW 213          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Nematostella
Match: EDO41896 (Lissencephaly-1 homolog [Source:UniProtKB/Swiss-Prot;Acc:A7S338])

HSP 1 Score: 87.4261 bits (215), Expect = 1.884e-18
Identity = 76/295 (25.76%), Postives = 125/295 (42.37%), Query Frame = 1
Query:  751 KQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLG-LMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFK--VGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAIW 1626
            + TL  H   +  V F P    + T   D  +K+W +  G  D++ TL G   +V  + FD +  F L +S+ D + +LW    +    +L GH + V +  FL     +V+ S D+T+K+W+  T  CVKT          V  +  G L+ S   D+ +R+W           V++ R    D+ RD + ++  L              +     TP      G +  +   SP G ++ + S D S+ IW+   G    TL      +  V + PG   + SC  +K + IW
Sbjct:   99 RYTLTGHRSPITKVLFHPVYSVMVTSSEDATVKVWDYETG--DFERTLKGHTDAVQDLAFDHTGKF-LASSSADMTIKLWDFQGFECIRTLHGHDHNVSSISFLPSGDHLVSASRDKTIKMWEIATGYCVKTFQGHGEWVRRVRPNADGSLIASCSNDQTIRVW-----------VVASRECKCDL-RDHDHVIEDL-------------NWAPESATPVINEAAGVEGGKKAMSP-GPFLVSASRDKSIKIWDVSAGVCLVTLVGHDNWVRAVMFHPGGKFIVSCSDDKTLRIW 364          

HSP 2 Score: 59.6918 bits (143), Expect = 1.324e-9
Identity = 41/116 (35.34%), Postives = 54/116 (46.55%), Query Frame = 1
Query:  778 EMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTR 1125
            E G    SP G FL +   D+ IKIW  + G C    TL G +  V AV F     FI+  S  D + R+W   + R   +L  H + V    F      + TGS D TLK+W+ R
Sbjct:  298 EGGKKAMSP-GPFLVSASRDKSIKIWDVSAGVC--LVTLVGHDNWVRAVMFHPGGKFIVSCSD-DKTLRIWDYKNKRCAKTLVAHEHFVTTLDFHKSAPFVATGSVDLTLKVWECR 409          

HSP 3 Score: 51.6026 bits (122), Expect = 5.905e-7
Identity = 47/192 (24.48%), Postives = 81/192 (42.19%), Query Frame = 1
Query:  754 QTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIW------------SHNY----------GACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCS-----GLGLMISGHFDKKLRMWDHR 1248
            +T   H   +  VR +  G  +A+  +D+ I++W             H++           A        G  G   A+   S   F++ AS  D S ++W +      ++L GH N V A  F      IV+ S D+TL++WD + + C KT++A    H+  V +         + +G  D  L++W+ R
Sbjct:  226 KTFQGHGEWVRRVRPNADGSLIASCSNDQTIRVWVVASRECKCDLRDHDHVIEDLNWAPESATPVINEAAGVEGGKKAM---SPGPFLVSASR-DKSIKIWDVSAGVCLVTLVGHDNWVRAVMFHPGGKFIVSCSDDKTLRIWDYKNKRCAKTLVA----HEHFVTTLDFHKSAPFVATGSVDLTLKVWECR 409          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Medaka
Match: ENSORLT00000025739.2 (autophagy related 16 like 2 [Source:NCBI gene;Acc:101163065])

HSP 1 Score: 228.024 bits (580), Expect = 3.053e-66
Identity = 122/305 (40.00%), Postives = 178/305 (58.36%), Query Frame = 1
Query:  730 TNLPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLR---MNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLE-KTLKDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
              +P +  Q L+AHE  +  VRFS S   LATGG+DR +K+W    G   ++ TL G    V  V+FD +   +L AS  D S  LW +GD   +++LTGHS KV A RF +   ++VTGS DRT++LWD +  +CV+ +   S+C D +VCSG   +ISGHFD K+R+WD R      +L    R+T LD+S D   +L+C +DDSLQ +DLR    ++ +  F    FK G+D  +   SPD  YVAAGS DGSV++W   T  LE + L++  + +  V W      + S ++++R  +W +
Sbjct:  316 ARVPARALQVLEAHEQGINAVRFSCSSDLLATGGTDRVVKLWELRAGTLTHRATLDGSTEGVTCVEFDHTGRRVLAAS-FDRSALLWRLGDSNPKVTLTGHSRKVTAARFTSAPHQVVTGSADRTIRLWDLQRAACVQQVETPSSCSD-LVCSG-NCIISGHFDSKIRVWDGRLGGCVQELPSQGRVTSLDLSYDHRQVLSCCRDDSLQLVDLRRWSRDRVV--FRAEGFKCGSDSTKAVISPDSSYVAAGSADGSVYVWRVSTANLETRLLEEHRSPVNAVSWSLSGEYVVSVDKSRRAVLWSD 615          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Medaka
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:101166483])

HSP 1 Score: 115.546 bits (288), Expect = 6.801e-28
Identity = 86/306 (28.10%), Postives = 154/306 (50.33%), Query Frame = 1
Query:  745 QLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACD--YKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLG-LMISGHFDKKLRMWDHRGDLNTDQLV--LSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPD-----GQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASC--ERNKRVAIW 1626
             LK TL  H   +  V+FSPSG +LA+  +D+ IKIW    GA D  ++ T++G    +  V + S  + ++ AS  D + ++W +   +   +L GHSN V    F   +  IV+GS D ++++WD +T  C+KT+ A S     V  +  G L++S  +D   R+WD         L+   +  ++ +  S +   +LA   D++L+  D    + ++ +T      G+   + C   +     G+++ +GS D  V+IWN +T ++ + L+  T  +I     P  N++AS   E +K + +W
Sbjct:   36 SLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASD-DKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT------GHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW 330          

HSP 2 Score: 56.6102 bits (135), Expect = 3.228e-8
Identity = 45/212 (21.23%), Postives = 93/212 (43.87%), Query Frame = 1
Query: 1000 DYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMS-ACHDVVVCSGLGLMISGHFDKKLRMWD-HRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCPGSNVLASCERNKRVAIW 1626
            +Y ++ +L GH+  V + +F      + + S D+ +K+W        KT+        DV   S   L++S   DK L++WD + G         S+ +   + +   N +++   D+S++  D++  + ++        V        F+ DG  + + S+DG   IW++ +G+  KTL  D    +  V + P    + +   +  + +W
Sbjct:   34 NYSLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVS----AVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLW 241          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Medaka
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:101166483])

HSP 1 Score: 111.309 bits (277), Expect = 1.858e-26
Identity = 88/308 (28.57%), Postives = 155/308 (50.32%), Query Frame = 1
Query:  745 QLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACD--YKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLG-LMISGHFDKKLRMWDHRGDLNTDQLV--LSHRITGLDISRDQNTLLAC-LKDDSLQTIDLRMN-QFIQNFTTPQFKVGNDLWRPCFSPD-----GQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASC--ERNKRVAIW 1626
             LK TL  H   +  V+FSPSG +LA+  +D+ IKIW    GA D  ++ T++G    +  V + S  + ++ AS  D + ++W +   +   +L GHSN V    F   +  IV+GS D ++++WD +T  C+KT+ A S     V  +  G L++S  +D   R+WD         L+   +  ++ +  S +   +LA  L + SL  +   +N Q ++ +T      G+   + C   +     G+++ +GS D  V+IWN +T ++ + L+  T  +I     P  N++AS   E +K + +W
Sbjct:   35 SLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASD-DKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNSSLTFVFFYVNSQCLKTYT------GHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW 331          

HSP 2 Score: 55.4546 bits (132), Expect = 6.168e-8
Identity = 48/212 (22.64%), Postives = 94/212 (44.34%), Query Frame = 1
Query: 1000 DYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMS-ACHDVVVCSGLGLMISGHFDKKLRMWD-HRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTL-KDQTAGIICVHWCP-GSNVLASCERNKRVAI 1623
            +Y ++ +L GH+  V + +F      + + S D+ +K+W        KT+        DV   S   L++S   DK L++WD + G         S+ +   + +   N +++   D+S++  D++  + ++        V        F+ DG  + + S+DG   IW++ +G+  KTL  D    +  V + P G  +LA+   N  +  
Sbjct:   33 NYSLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVS----AVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNSSLTF 240          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Medaka
Match: snrnp40 (small nuclear ribonucleoprotein U5 subunit 40 [Source:NCBI gene;Acc:101156339])

HSP 1 Score: 110.538 bits (275), Expect = 3.875e-26
Identity = 83/292 (28.42%), Postives = 144/292 (49.32%), Query Frame = 1
Query:  760 LDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIV-TGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGD-LNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRM----NQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRV 1617
            +  HEGE+ C +F P+G  LA+ G DR I +W+  +G C+   TL G +G+V+ + +++  S +  AST D +  +W          L GH++ V          ++V TGS D T+KLWD R ++ + T         V        ++SG  D  +++WD R + L  +    S  +TGL +S + + LL+   D++++  D+R      + ++ F         +L R  +S DG  +AAGS D  V+IW++ + ++   L      +  V + P   V+ S   +KR+
Sbjct:   52 MSGHEGEVYCCKFHPNGATLASSGFDRLIFLWN-VFGECENYATLKGHSGAVMELHYNTDGSLLFSAST-DKTVGIWDSETGERIKRLKGHTSFVNTCYPARRGPQLVCTGSDDGTIKLWDIRKKAAIHTFQNTYQVLAVTFNDTSDQILSGGIDNDIKVWDLRQNKLIYNMHGHSDSVTGLSLSSEGSYLLSNSMDNTVRIWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSTDGSKIAAGSADRFVYIWDTTSRRILYKLPGHAGSVNEVVFHPEEPVVLSGSSDKRL 341          
BLAST of Autophagy-related protein 16-1 vs. Ensembl Medaka
Match: snrnp40 (small nuclear ribonucleoprotein U5 subunit 40 [Source:NCBI gene;Acc:101156339])

HSP 1 Score: 96.2857 bits (238), Expect = 3.570e-21
Identity = 83/318 (26.10%), Postives = 144/318 (45.28%), Query Frame = 1
Query:  760 LDAHEGEMGCVRFSPSGMFLATGGSDRKI--------------------------KIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIV-TGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGD-LNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRM----NQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRV 1617
            +  HEGE+ C +F P+G  LA+ G DR I                           +W + +G C+   TL G +G+V+ + +++  S +  AST D +  +W          L GH++ V          ++V TGS D T+KLWD R ++ + T         V        ++SG  D  +++WD R + L  +    S  +TGL +S + + LL+   D++++  D+R      + ++ F         +L R  +S DG  +AAGS D  V+IW++ + ++   L      +  V + P   V+ S   +KR+
Sbjct:   52 MSGHEGEVYCCKFHPNGATLASSGFDRLICKQKEASCRSPGLLLLLCSSLTSFTSVLW-NVFGECENYATLKGHSGAVMELHYNTDGSLLFSAST-DKTVGIWDSETGERIKRLKGHTSFVNTCYPARRGPQLVCTGSDDGTIKLWDIRKKAAIHTFQNTYQVLAVTFNDTSDQILSGGIDNDIKVWDLRQNKLIYNMHGHSDSVTGLSLSSEGSYLLSNSMDNTVRIWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSTDGSKIAAGSADRFVYIWDTTSRRILYKLPGHAGSVNEVVFHPEEPVVLSGSSDKRL 367          
BLAST of Autophagy-related protein 16-1 vs. Planmine SMEST
Match: SMESG000075662.1 (SMESG000075662.1)

HSP 1 Score: 895.575 bits (2313), Expect = 0.000e+0
Identity = 449/454 (98.90%), Postives = 450/454 (99.12%), Query Frame = 1
Query:  271 MQEELTNAVKEKSALNIKILEFKLLCNNKDKDLQDLKQNIHSLKDQISKQEELIRTSSDTIRKLEDIKRTLTDEISANLMAYRSLDTKYRELEESSYVLKDTVKKLQQALXXXXXXXXXXXXXXXQDALKQTLIEAANSTVDIDLMKMKNIYITNLPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 1632
            MQEELTNAVKEKSALNIKILEFKLLCNNKDKDLQDLKQNIHSLKDQISKQEELIRTSSDTIRKLEDIKRTLTDEISANLMAYRSLDTKYRELEESSYVLKDTVKKLQQALEDKKNEEYDYKYKAKQDALKQTLIEAANSTVDIDLMKMKNIYITN PCQLKQTLDAHE EMGCVRFSPSG+FLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFT PQFKVGNDLWRPCFSPDGQYVAAGS DGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAIWGE
Sbjct:    1 MQEELTNAVKEKSALNIKILEFKLLCNNKDKDLQDLKQNIHSLKDQISKQEELIRTSSDTIRKLEDIKRTLTDEISANLMAYRSLDTKYRELEESSYVLKDTVKKLQQALEDKKNEEYDYKYKAKQDALKQTLIEAANSTVDIDLMKMKNIYITNFPCQLKQTLDAHESEMGCVRFSPSGIFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTAPQFKVGNDLWRPCFSPDGQYVAAGSQDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAIWGE 454          
BLAST of Autophagy-related protein 16-1 vs. Planmine SMEST
Match: SMESG000045329.1 (SMESG000045329.1)

HSP 1 Score: 112.849 bits (281), Expect = 5.871e-27
Identity = 84/296 (28.38%), Postives = 141/296 (47.64%), Query Frame = 1
Query:  760 LDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTR--IVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSH--RITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGN------DLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRV 1617
            L  H+GE+ C +F+P G FLA+ G DR+I +W+  YG       L+G NG+++ + F S   +I  AST D +  +W            GH++ +V       +TR    +GS D  ++LWD R ++   T+ A  +  DV        + SG  +  +  WD R ++   Q    H   IT + +S D N LL+   D++L+  D R   F++     +  VG+      +L R  +S DG+ V  GS D +V++W+  TG++   L      +    + P   +L S   + ++
Sbjct:   56 LSGHKGEVFCGKFAPEGSFLASAGHDREIILWN-TYGDIKDLAVLSGHNGAILDLQFSSDSDWIYTAST-DKTVMIWDTRVGERVKKFKGHTS-IVNSVSAVSHTRELFCSGSDDCKIRLWDKRVKNTTHTIDAKHSVLDVAYSPFGDYIFSGGIENVINQWDVR-EMKIIQTFAGHTDSITSVAVSNDGNFLLSNSVDNTLRVWDTR--PFVRGERCTKLMVGHLHNFEKNLLRCAWSVDGKRVTCGSADKNVYVWDMYTGQIMYKLPGHVGSVNETAFHPHEPILLSVSSDTKI 345          
BLAST of Autophagy-related protein 16-1 vs. Planmine SMEST
Match: SMESG000010494.1 (SMESG000010494.1)

HSP 1 Score: 83.9593 bits (206), Expect = 5.305e-17
Identity = 63/262 (24.05%), Postives = 115/262 (43.89%), Query Frame = 1
Query:  739 PCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVC-SGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHR--ITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTG 1515
            P +L + +  H G + C+ FSP   +  TG  DR +KIW+ + G    + +LTG    V  V       ++      D + + W +   ++     GH++ V       D   ++TG  D  +++WD RT+  V  +         V C S L  +ISG  D  +R+WD R    T  ++ +H+  +  + I    +  ++    D ++   L   QF+QN      K  N +       +     +G +DG+++ W+ ++G
Sbjct:  126 PWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKL--RLSLTGHVSGVRGVKISHRHPYVFSCGE-DKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRA-AKTQSVLTNHKKAVRSVFIHPITDHFMSG-SADGIKQFSLPEGQFMQN-----MKGHNTIINAVTVNENNVAVSGGNDGTLYFWDWKSG 377          
BLAST of Autophagy-related protein 16-1 vs. Planmine SMEST
Match: SMESG000024482.1 (SMESG000024482.1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.153e-16
Identity = 72/300 (24.00%), Postives = 132/300 (44.00%), Query Frame = 1
Query:  745 QLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVC----SGLGLMISGHFDKKLRMWDHRGDLNTDQLVLSHR--ITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAIW 1626
            +L+     H+ ++ CV F+P+   LA+GG D  + IW  N+          G   ++++V F  +   +  AS  D + RLW        L    H+  V +     DN  +VTGS D+T+K+W    +   K   +++   + V C    S   L+ S   DK +++WD R +         H   +  L    + + + +   D  +   D+RMN+ +Q++T+    V        F P G ++ + S D S+ I++   G+L  T++     I+   +     + AS   + +V +W
Sbjct:    5 KLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIW--NFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASR-DKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQ---KFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWD-RHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVN----AVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLW 293          

HSP 2 Score: 77.0258 bits (188), Expect = 1.083e-14
Identity = 66/260 (25.38%), Postives = 110/260 (42.31%), Query Frame = 1
Query:  766 AHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMI-SGHFDKKLRMWDHRGDLNTDQLVLSH--RITGLDISRDQNTLLACLKDDSLQTIDL---RMNQFIQNFTTPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEK 1527
             HE  +  V+FSP+G  +A+   D+ +++W  +               +V +VD  S ++  +   + D + ++W M   +   SL  H N V   RF +D   I + S D+T+KLWD   + C+ T          +     G  I SG  D  + +WD R +    Q   SH   +  +      N L++   D S++  DL   R+   +Q    P            FS  G+  A+G  D  VF+W  + G+L +
Sbjct:   54 GHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKG--ESLVFRAHTATVRSVDI-SCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMN-KLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGT-------AFSHCGEMFASGGADHQVFLW--QAGQLSE 300          

HSP 3 Score: 55.8398 bits (133), Expect = 5.238e-8
Identity = 49/217 (22.58%), Postives = 99/217 (45.62%), Query Frame = 1
Query:  994 MGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLG-LMISGHFDKKLRMWDHRGDLNTDQLVL-SHRIT--GLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPC--FSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHWCPGSNVLASCERNKRVAIW 1626
            M D ++++   GH +KV    F  +++++ +G  D  L +W+ + ++     +        V  S  G L+ S   DK +R+W     +  + LV  +H  T   +DIS D   ++    D +++   +   +F  +++  + K     W  C  FS DGQ +A+ S D ++ +W+    +   T ++    +  + + P  + +AS   +  V IW
Sbjct:    1 MEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLW--VPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKF--SYSLNEHKN----WVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIW 209          
BLAST of Autophagy-related protein 16-1 vs. Planmine SMEST
Match: SMESG000054739.1 (SMESG000054739.1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.979e-16
Identity = 52/173 (30.06%), Postives = 83/173 (47.98%), Query Frame = 1
Query:  724 YITNLPCQLKQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLG-LMISGHFDKKLRMW 1239
            ++  +P   +  L  H   + CVRF P      +G  D  IKIW  +Y + DY+ TL G    V  + FD S   +L + + D   +LW   ++    +L+GH + V    F+     +++ S D+T+KLW+  T  CV+T    S    VV  +  G L+ S   D  +R+W
Sbjct:   61 WLPRIPA--RHVLKGHRASITCVRFHPLYNVFVSGSEDATIKIW--DYESGDYERTLRGHTNHVQDLAFDPSGK-LLASCSADMQIKLWDFVEFTCVKTLSGHDHNVSGVSFMPSGDHLLSASRDKTIKLWEVSTGYCVQTFEGHSDWVRVVKPNFDGSLIASCSNDNSVRVW 228          

HSP 2 Score: 54.6842 bits (130), Expect = 1.002e-7
Identity = 37/129 (28.68%), Postives = 62/129 (48.06%), Query Frame = 1
Query:  751 KQTLDAHEGEMGCVRFSPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESFILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSC 1137
            ++TL  H   +  + F PSG  LA+  +D +IK+W      C    TL+G + +V  V F  S   +L AS  D + +LW +       +  GHS+ V   +   D + I + S D ++++W    + C
Sbjct:  110 ERTLRGHTNHVQDLAFDPSGKLLASCSADMQIKLWDFVEFTC--VKTLSGHDHNVSGVSFMPSGDHLLSASR-DKTIKLWEVSTGYCVQTFEGHSDWVRVVKPNFDGSLIASCSNDNSVRVWSMANKEC 235          

HSP 3 Score: 51.6026 bits (122), Expect = 9.612e-7
Identity = 42/190 (22.11%), Postives = 80/190 (42.11%), Query Frame = 1
Query: 1012 RLSLTGHSNKVVAGRFLADNTRIVTGSTDRTLKLWDTRTRSCVKTMLAMS-ACHDVVVCSGLGLMISGHFDKKLRMWDHRGDLNTDQLV-LSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFTTPQFKVGNDLWRPCFSP--DGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTAGIICVHW 1569
            R  L GH   +   RF       V+GS D T+K+WD  +    +T+   +    D+       L+ S   D ++++WD         L    H ++G+      + LL+  +D +++  ++     +Q F       G+  W     P  DG  +A+ S+D SV +W+    + +   ++    + C+ W
Sbjct:   68 RHVLKGHRASITCVRFHPLYNVFVSGSEDATIKIWDYESGDYERTLRGHTNHVQDLAFDPSGKLLASCSADMQIKLWDFVEFTCVKTLSGHDHNVSGVSFMPSGDHLLSASRDKTIKLWEVSTGYCVQTFE------GHSDWVRVVKPNFDGSLIASCSNDNSVRVWSMANKECKFDFREHEHVVQCIVW 251          
The following BLAST results are available for this feature:
BLAST of Autophagy-related protein 16-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATG16L13.088e-8945.33autophagy related 16 like 1 [Source:HGNC Symbol;Ac... [more]
ATG16L13.088e-8945.33autophagy related 16 like 1 [Source:HGNC Symbol;Ac... [more]
ATG16L12.996e-8845.33autophagy related 16 like 1 [Source:HGNC Symbol;Ac... [more]
ATG16L12.996e-8845.33autophagy related 16 like 1 [Source:HGNC Symbol;Ac... [more]
ATG16L14.606e-8845.33autophagy related 16 like 1 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Autophagy-related protein 16-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atg-16.29.278e-6030.16Autophagic-related protein 16.2 [Source:UniProtKB... [more]
atg-16.12.554e-4934.11Autophagic-related protein 16.1 [Source:UniProtKB... [more]
wdr-5.11.827e-2626.64WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
wdr-5.11.827e-2626.64WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
snrp-40.13.778e-2329.29Small Nuclear RibonucleoProtein homolog [Source:U... [more]
back to top
BLAST of Autophagy-related protein 16-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atg162.194e-8441.25gene:FBgn0039705 transcript:FBtr0085530[more]
Atg163.419e-8441.25gene:FBgn0039705 transcript:FBtr0085529[more]
Atg166.079e-8441.25gene:FBgn0039705 transcript:FBtr0085528[more]
Atg166.832e-8441.25gene:FBgn0039705 transcript:FBtr0339144[more]
wds1.782e-2728.20gene:FBgn0040066 transcript:FBtr0308566[more]
back to top
BLAST of Autophagy-related protein 16-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atg16l11.580e-9047.33ATG16 autophagy related 16-like 1 (S. cerevisiae) ... [more]
atg16l14.364e-9047.33ATG16 autophagy related 16-like 1 (S. cerevisiae) ... [more]
atg16l29.316e-3641.67ATG16 autophagy related 16-like 2 (S. cerevisiae) ... [more]
snrnp401.385e-2829.87small nuclear ribonucleoprotein 40 (U5) [Source:ZF... [more]
wdr55.940e-2828.20WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
back to top
BLAST of Autophagy-related protein 16-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atg161.520e-9735.15autophagy related 16 like 1 [Source:NCBI gene;Acc:... [more]
atg164.840e-9533.99autophagy related 16 like 1 [Source:NCBI gene;Acc:... [more]
atg165.365e-9434.34autophagy related 16 like 1 [Source:NCBI gene;Acc:... [more]
atg169.680e-9433.69autophagy related 16 like 1 [Source:NCBI gene;Acc:... [more]
atg163.596e-9333.88autophagy related 16 like 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Autophagy-related protein 16-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atg16l14.353e-9135.20autophagy related 16-like 1 (S. cerevisiae) [Sourc... [more]
Atg16l11.135e-8945.00autophagy related 16-like 1 (S. cerevisiae) [Sourc... [more]
Atg16l11.737e-8945.00autophagy related 16-like 1 (S. cerevisiae) [Sourc... [more]
Atg16l21.090e-6439.00autophagy related 16-like 2 (S. cerevisiae) [Sourc... [more]
Atg16l21.793e-6439.00autophagy related 16-like 2 (S. cerevisiae) [Sourc... [more]
back to top
BLAST of Autophagy-related protein 16-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8C0J2|A16L1_MOUSE7.942e-8945.00Autophagy-related protein 16-1 OS=Mus musculus OX=... [more]
sp|Q676U5|A16L1_HUMAN2.212e-8745.33Autophagy-related protein 16-1 OS=Homo sapiens OX=... [more]
sp|Q5I0B9|ATG16_XENTR2.571e-8645.00Autophagy-related protein 16 OS=Xenopus tropicalis... [more]
sp|Q5RAC9|A16L1_PONAB2.146e-8345.21Autophagy-related protein 16-1 OS=Pongo abelii OX=... [more]
sp|Q8NAA4|A16L2_HUMAN5.723e-6539.67Autophagy-related protein 16-2 OS=Homo sapiens OX=... [more]
back to top
BLAST of Autophagy-related protein 16-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2S1BJF90.000e+084.31Atg16L OS=Dugesia japonica OX=6161 PE=2 SV=1[more]
A0A4Z2DTP26.716e-12439.88Autophagy-related protein OS=Schistosoma japonicum... [more]
A0A183MU822.007e-12139.84WD_REPEATS_REGION domain-containing protein OS=Sch... [more]
A0A0X3NIN53.270e-12140.12WD_REPEATS_REGION domain-containing protein OS=Sch... [more]
G4V8R73.294e-12139.55Family S9 non-peptidase homologue (S09 family) OS=... [more]
back to top
BLAST of Autophagy-related protein 16-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atg16l13.631e-9247.67autophagy related 16 like 1 [Source:NCBI gene;Acc:... [more]
atg16l24.419e-7341.39autophagy-related protein 16-2-like [Source:NCBI g... [more]
wdr54.317e-2828.20WD repeat domain 5 [Source:NCBI gene;Acc:103033424... [more]
ENSAMXT00000007963.27.851e-2828.05WD repeat-containing protein 5-like [Source:NCBI g... [more]
snrnp401.238e-2729.05small nuclear ribonucleoprotein U5 subunit 40 [Sou... [more]
back to top
BLAST of Autophagy-related protein 16-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snrnp401.102e-2929.53small nuclear ribonucleoprotein 40 (U5) [Source:ZF... [more]
ENSPMAT00000004902.12.336e-2228.19pep scaffold:Pmarinus_7.0:GL478254:5937:33805:1 ge... [more]
POC1A6.668e-2023.63POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
pafah1b1b2.203e-1624.41platelet-activating factor acetylhydrolase 1b, reg... [more]
wdr824.646e-1624.91WD repeat domain 82 [Source:NCBI gene;Acc:321614][more]
back to top
BLAST of Autophagy-related protein 16-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RSA44.796e-2224.74WD-repeat protein involved in ribosome biogenesis;... [more]
TAF53.761e-1528.11Subunit (90 kDa) of TFIID and SAGA complexes; invo... [more]
COP11.089e-1324.83Alpha subunit of COPI vesicle coatomer complex; co... [more]
TUP11.267e-1322.00General repressor of transcription; forms complex ... [more]
SEC271.838e-1328.92Essential beta'-coat protein of the COPI coatomer;... [more]
back to top
BLAST of Autophagy-related protein 16-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO460752.344e-9334.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463311.426e-3231.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332973.996e-2628.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453465.758e-2127.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418961.884e-1825.76Lissencephaly-1 homolog [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Autophagy-related protein 16-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000025739.23.053e-6640.00autophagy related 16 like 2 [Source:NCBI gene;Acc:... [more]
wdr56.801e-2828.10WD repeat domain 5 [Source:NCBI gene;Acc:101166483... [more]
wdr51.858e-2628.57WD repeat domain 5 [Source:NCBI gene;Acc:101166483... [more]
snrnp403.875e-2628.42small nuclear ribonucleoprotein U5 subunit 40 [Sou... [more]
snrnp403.570e-2126.10small nuclear ribonucleoprotein U5 subunit 40 [Sou... [more]
back to top
BLAST of Autophagy-related protein 16-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075662.10.000e+098.90SMESG000075662.1[more]
SMESG000045329.15.871e-2728.38SMESG000045329.1[more]
SMESG000010494.15.305e-1724.05SMESG000010494.1[more]
SMESG000024482.11.153e-1624.00SMESG000024482.1[more]
SMESG000054739.11.979e-1630.06SMESG000054739.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001519 ID=SMED30001519|Name=Autophagy-related protein 16-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1772bp
TATCCTATACAATTTTTTGTATTATTTCATTGTATATTAGGCTTTTAAAT
GGATAAAAATGACTTTAAAACTTTAATTAAAGCTCGATTATCAGAAAGAA
ATGAAAAGGAATCTTTGGTTAATAAAAAAATAATTTTTGATTATGAAATA
ATATTATGTCGATTTAATACCTCACAAAAGCAATTAGACTCACTTAAGTA
TGAAAATGAAAAATTAAGATCATCAGTTCCTGTTTCAAATGATCAAACGA
TTTCCCGAAAAGTGTACGATATGCAAGAGGAGTTAACAAACGCCGTGAAG
GAGAAAAGTGCGTTAAACATTAAGATTCTCGAATTCAAATTGTTGTGCAA
CAACAAAGATAAAGACCTTCAAGATTTAAAACAGAACATTCACAGTTTAA
AAGACCAAATATCAAAGCAAGAAGAACTTATCAGAACTAGTAGTGACACT
ATTAGAAAATTGGAAGATATTAAACGAACTTTGACGGATGAAATTTCTGC
TAATCTCATGGCGTATCGATCATTGGATACTAAATATCGTGAACTGGAAG
AGAGCAGTTATGTGCTTAAAGACACAGTGAAAAAATTGCAACAAGCTTTG
GAAGACAAGAAAAACGAAGAATATGACTATAAATACAAGGCTAAACAAGA
CGCACTTAAACAGACATTAATCGAAGCTGCTAATTCCACAGTAGATATCG
ATTTAATGAAAATGAAGAATATTTATATCACCAATCTTCCCTGTCAACTG
AAACAGACATTGGATGCTCATGAAGGTGAAATGGGTTGTGTAAGATTCTC
GCCATCTGGAATGTTCCTTGCTACCGGTGGATCAGACAGAAAAATCAAAA
TTTGGTCTCATAACTATGGAGCGTGTGATTACAAAACCACTCTAACTGGT
TGTAATGGTAGTGTAATTGCTGTGGATTTTGATTCGTCGGAGTCTTTTAT
TCTTGGAGCTTCCACGCTTGATTCATCGTGTAGGTTGTGGTCTATGGGAG
ATTATCGAATGCGTTTATCTTTAACCGGTCATTCAAATAAAGTGGTGGCC
GGTCGATTTCTAGCTGATAATACTCGTATTGTAACAGGATCTACAGATCG
CACATTAAAATTGTGGGATACTAGAACACGATCGTGTGTCAAAACGATGT
TGGCCATGTCAGCTTGTCATGATGTCGTAGTGTGTTCGGGCTTAGGTTTG
ATGATTAGTGGACATTTCGACAAGAAATTACGAATGTGGGATCATCGTGG
TGACTTGAATACTGATCAGCTCGTTTTGTCTCATCGAATTACGGGATTAG
ATATAAGCCGCGATCAGAATACACTTTTAGCCTGCTTAAAGGATGATTCT
CTGCAAACTATCGATTTGAGAATGAATCAATTTATTCAGAATTTTACTAC
ACCTCAATTTAAAGTTGGCAATGACTTATGGAGACCATGTTTCTCACCAG
ATGGTCAATATGTTGCTGCTGGTAGCCACGATGGATCAGTATTCATTTGG
AATTCTAGAACTGGGAAATTAGAAAAAACTCTCAAAGATCAAACGGCAGG
TATTATTTGCGTGCACTGGTGTCCCGGGAGCAATGTGTTGGCTTCGTGTG
AACGCAACAAGCGAGTTGCTATTTGGGGTGAATGATATGATGTTTCAAGA
GACGGCAAATTATAAGCGATGTCATTTGCTTATTGCCAAGTGTGATAAAA
TTGTACTTATGTATTTCGATAAAAAATAATTGATAAATAATCAATAAATT
TTTCGAATTTTCTAGAAACAAA
back to top

protein sequence of SMED30001519-orf-1

>SMED30001519-orf-1 ID=SMED30001519-orf-1|Name=SMED30001519-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=529bp
MDKNDFKTLIKARLSERNEKESLVNKKIIFDYEIILCRFNTSQKQLDSLK
YENEKLRSSVPVSNDQTISRKVYDMQEELTNAVKEKSALNIKILEFKLLC
NNKDKDLQDLKQNIHSLKDQISKQEELIRTSSDTIRKLEDIKRTLTDEIS
ANLMAYRSLDTKYRELEESSYVLKDTVKKLQQALEDKKNEEYDYKYKAKQ
DALKQTLIEAANSTVDIDLMKMKNIYITNLPCQLKQTLDAHEGEMGCVRF
SPSGMFLATGGSDRKIKIWSHNYGACDYKTTLTGCNGSVIAVDFDSSESF
ILGASTLDSSCRLWSMGDYRMRLSLTGHSNKVVAGRFLADNTRIVTGSTD
RTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHR
GDLNTDQLVLSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNFT
TPQFKVGNDLWRPCFSPDGQYVAAGSHDGSVFIWNSRTGKLEKTLKDQTA
GIICVHWCPGSNVLASCERNKRVAIWGE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000398mRNA splicing, via spliceosome
GO:0000956nuclear-transcribed mRNA catabolic process
GO:0000045autophagosome assembly
GO:0006810transport
GO:0006914autophagy
GO:0015031protein transport
GO:0016236macroautophagy
GO:0039689negative stranded viral RNA replication
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR013923Autophagy-rel_prot_16
IPR036322WD40_repeat_dom_sf
IPR020472G-protein_beta_WD-40_rep
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0042802identical protein binding
Vocabulary: cellular component
TermDefinition
GO:0000421autophagosome membrane
GO:0005737cytoplasm
GO:0005776autophagosome
GO:0005829cytosol
GO:0005930axoneme
GO:0016020membrane
GO:0034045pre-autophagosomal structure membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 100..127
NoneNo IPR availablePANTHERPTHR19878:SF7AUTOPHAGY-RELATED PROTEIN 16-2coord: 227..527
NoneNo IPR availablePANTHERPTHR19878AUTOPHAGY PROTEIN 16-LIKEcoord: 227..527
NoneNo IPR availableCDDcd00200WD40coord: 234..526
e-value: 2.82095E-51
score: 174.831
IPR020472G-protein beta WD-40 repeatPRINTSPR00320GPROTEINBRPTcoord: 257..271
score: 32.38
coord: 344..358
score: 42.16
coord: 472..486
score: 30.1
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 488..527
e-value: 0.0011
score: 28.3
coord: 405..439
e-value: 200.0
score: 2.5
coord: 275..315
e-value: 1.0
score: 17.0
coord: 360..398
e-value: 0.75
score: 17.8
coord: 442..485
e-value: 0.0047
score: 26.2
coord: 231..270
e-value: 2.4E-8
score: 43.8
coord: 318..357
e-value: 5.6E-6
score: 35.9
IPR001680WD40 repeatPFAMPF00400WD40coord: 324..357
e-value: 0.0013
score: 19.6
coord: 233..270
e-value: 4.4E-7
score: 30.5
coord: 464..485
e-value: 3.6E-5
score: 24.5
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 325..366
score: 15.421
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 465..494
score: 12.113
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 238..270
score: 14.285
IPR013923Autophagy-related protein 16PFAMPF08614ATG16coord: 11..168
e-value: 7.1E-8
score: 32.9
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 147..403
e-value: 3.2E-40
score: 140.1
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 404..527
e-value: 8.4E-23
score: 82.8
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 344..358
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 472..486
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 238..528
score: 38.23
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 229..526