Annexin

Overview
NameAnnexin
Smed IDSMED30001515
Length (bp)1229
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Annexin (SMED30001515) t-SNE clustered cells

Violin plots show distribution of expression levels for Annexin (SMED30001515) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Annexin (SMED30001515) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Annexin (SMED30001515) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001515

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 22

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30001515SMESG000042839.1 Contig8936newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001515SMESG000042839.1 Contig8936uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30001515SMESG000042839.1 dd_Smed_v4_1104_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30001515SMESG000042839.1 dd_Smed_v4_1104_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30001515SMESG000042839.1 dd_Smed_v4_1104_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001515SMESG000042839.1 dd_Smed_v4_1104_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001515SMESG000042839.1 dd_Smed_v4_1104_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30001515SMESG000042839.1 dd_Smed_v4_1104_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30001515SMESG000042839.1 dd_Smed_v4_1104_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001515SMESG000042839.1 dd_Smed_v4_1104_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001515SMESG000042839.1 dd_Smed_v4_1104_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30001515SMESG000042839.1 dd_Smed_v4_1104_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30001515SMESG000042839.1 dd_Smed_v4_1104_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001515SMESG000042839.1 Contig49441newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001515SMESG000042839.1 Contig49441uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30001515SMESG000042839.1 dd_Smed_v6_1104_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30001515SMESG000042839.1 dd_Smed_v4_1104_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001515SMESG000042839.1 dd_Smed_v6_1104_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30001515SMESG000042839.1 dd_Smed_v6_1104_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30001515SMESG000042839.1 Contig8936newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30001515SMESG000042839.1 Contig8936uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30001515SMESG000042839.1 dd_Smed_v4_1104_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Annexin vs. Ensembl Human
Match: ANXA7 (annexin A7 [Source:HGNC Symbol;Acc:HGNC:545])

HSP 1 Score: 296.204 bits (757), Expect = 7.578e-96
Identity = 156/325 (48.00%), Postives = 213/325 (65.54%), Query Frame = 3
Query:  108 KGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFV 1082
            +GTI+P  NF A +D E+L+KAMKG GTDE+AIV+ +  RS  QR +IK  +KT +GKDLI DLKSELSGN  + +      P YYDA SL  AM+GAGT+E VL EIL +RTN++I  I   Y+  +  +LE++I S+TSG F+R+LVS  Q N+     D+ Q ++            A+++AQ LY AGE +LGTDE+ F  I   R+  QLRAT + Y +++ +D+  S+  E SG   S +K I   A+N P +FA RLY AMKGAGT D+TL RI+++RSEIDL  IK  F++ Y++TL + +  DTSGDY+  LL  V
Sbjct:  154 QGTIRPAANFDAIRDAEILRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTSYGKDLIKDLKSELSGNMEELILALFMPPTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGNR-----DENQSINHQ---------MAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYAMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTLGTMIAGDTSGDYRRLLLAIV 464          

HSP 2 Score: 67.3958 bits (163), Expect = 1.651e-11
Identity = 41/142 (28.87%), Postives = 70/142 (49.30%), Query Frame = 3
Query:  666 ELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            E+     K  GTDE   + +   R+  Q +     ++   GKD+ + + +E+SG+    I A+        +Y A  L  AM+GAGT +  L  IL +R+  ++  I   +  E+ + LE  ++ DTSG ++  L+   QGN
Sbjct:  170 EILRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTSYGKDLIKDLKSELSGNMEELILALFMPPT---YYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGN 308          
BLAST of Annexin vs. Ensembl Human
Match: ANXA7 (annexin A7 [Source:HGNC Symbol;Acc:HGNC:545])

HSP 1 Score: 296.204 bits (757), Expect = 1.606e-95
Identity = 156/325 (48.00%), Postives = 213/325 (65.54%), Query Frame = 3
Query:  108 KGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFV 1082
            +GTI+P  NF A +D E+L+KAMKG GTDE+AIV+ +  RS  QR +IK  +KT +GKDLI DLKSELSGN  + +      P YYDA SL  AM+GAGT+E VL EIL +RTN++I  I   Y+  +  +LE++I S+TSG F+R+LVS  Q N+     D+ Q ++            A+++AQ LY AGE +LGTDE+ F  I   R+  QLRAT + Y +++ +D+  S+  E SG   S +K I   A+N P +FA RLY AMKGAGT D+TL RI+++RSEIDL  IK  F++ Y++TL + +  DTSGDY+  LL  V
Sbjct:  176 QGTIRPAANFDAIRDAEILRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTSYGKDLIKDLKSELSGNMEELILALFMPPTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGNR-----DENQSINHQ---------MAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYAMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTLGTMIAGDTSGDYRRLLLAIV 486          

HSP 2 Score: 67.0106 bits (162), Expect = 2.029e-11
Identity = 41/142 (28.87%), Postives = 70/142 (49.30%), Query Frame = 3
Query:  666 ELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            E+     K  GTDE   + +   R+  Q +     ++   GKD+ + + +E+SG+    I A+        +Y A  L  AM+GAGT +  L  IL +R+  ++  I   +  E+ + LE  ++ DTSG ++  L+   QGN
Sbjct:  192 EILRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTSYGKDLIKDLKSELSGNMEELILALFMPPT---YYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGN 330          
BLAST of Annexin vs. Ensembl Human
Match: ANXA5 (annexin A5 [Source:HGNC Symbol;Acc:HGNC:543])

HSP 1 Score: 282.722 bits (722), Expect = 1.485e-92
Identity = 150/322 (46.58%), Postives = 204/322 (63.35%), Query Frame = 3
Query:  108 KGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLL 1073
            +GT+  FP F    D E L+KAMKG+GTDE++I+  L  RS +QR EI   +KT+FG+DL+ DLKSEL+G F + +   +     YDA+ L HA+KGAGT E VLTEI+ SRT +++  IK +Y++ Y   LE+++V +TSG+++R+LV  LQAN+               P A +   Q +Q+AQ L+ AGE K GTDE  FI IF  R+   LR  FD+Y  ISG  I E+ID E SG+    + A+     + P Y A  LY AMKGAGT D TL R+++SRSEIDL NI+ EF + +  +L S +K DTSGDY+  LL
Sbjct:    6 RGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRD--------------PDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALL 313          

HSP 2 Score: 72.7886 bits (177), Expect = 1.254e-13
Identity = 45/135 (33.33%), Postives = 71/135 (52.59%), Query Frame = 3
Query:  687 KKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            K LGTDE   + +   R+  Q +     ++ + G+D+ + + +E++G F   I A+      +  Y A  L +A+KGAGT +  L  I+ SR+  +L  IK  +  EY  +LE  V  DTSG YQ  L+  +Q N
Sbjct:   29 KGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALM---KPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQAN 160          
BLAST of Annexin vs. Ensembl Human
Match: ANXA4 (annexin A4 [Source:HGNC Symbol;Acc:HGNC:542])

HSP 1 Score: 282.337 bits (721), Expect = 2.315e-92
Identity = 153/327 (46.79%), Postives = 205/327 (62.69%), Query Frame = 3
Query:  111 GTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            GT+K    F+A +D + L+KAMKG+GTDE AI+  L  R+ +QR EI+  YK+  G+DLI DLKSELSGNF Q +   +     YD   L  AMKGAGT E  L EIL SRT ++I  I   Y++ Y   LE++I S+TS  F+RVLVS     + E ++ D          A+V     +Q+AQ+LY AGEKK GTDE  F+ + C RN+  L   FDEY++IS KDI +SI +E SG F  ++ AI     N   YFA +LY +MKG GT D TL R+++SR+EID+ +I+A F R Y ++L SF+K DTSGDY+  LL    G+
Sbjct:    8 GTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLD---------DALV-----RQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGD 320          
BLAST of Annexin vs. Ensembl Human
Match: ANXA11 (annexin A11 [Source:HGNC Symbol;Acc:HGNC:535])

HSP 1 Score: 286.189 bits (731), Expect = 6.806e-92
Identity = 151/328 (46.04%), Postives = 211/328 (64.33%), Query Frame = 3
Query:  108 KGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            +GTI   P F   +D EVL+KAMKG GTDE+AI++CLG RS  QR +I  ++KT +GKDLI DLKSELSGNF + +   +  P  +D + +  A+KG GT E  L EIL SR+N+ I  +   YK  +   LEE I S+TSG F+R+L+S  Q N+ E ++              V ++ A+++AQELY AGE +LGTDE+ F  + C R++  L A F+EY++++G+DI +SI  EMSGD    + A+     NTP +FA RL  AM+GAGT D TL RI++SRSE DL +I++E+ R Y ++L   +  DTSGDY+  LL+   GN
Sbjct:  158 RGTITDAPGFDPLRDAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYEIKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTN--------------VDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEEGMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTSGDYRKILLKICGGN 471          
BLAST of Annexin vs. Ensembl Celegans
Match: nex-2 (Annexin [Source:UniProtKB/TrEMBL;Acc:Q7JMT5])

HSP 1 Score: 252.292 bits (643), Expect = 2.498e-79
Identity = 138/329 (41.95%), Postives = 196/329 (59.57%), Query Frame = 3
Query:  111 GTIKPFP--NFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            GT   FP   F++  D EVL+KAMKG+G +   ++  L +R+  QR EI K +K M+GKDLI +LK EL G+F   +   +  P  YDA  L  AM+G GT+E+VL EI+TSRTN QI+ ++  YK L+  +LE +++ ETSG FKR+LVS     + E S  D  +              A Q+A+ L  AGEK+LGTDE+ F  I   +N  QLR  F+EY+K S   I ++I+ E SGD R  + A+     N P YFA  L+++MKG GT D  L R+ ++R+E D+ +I+  F   Y+ +LE+ +K D SG Y+  L+  V GN
Sbjct:  139 GTPSVFPVQGFNSNADAEVLRKAMKGLGCNNSKVISILCQRTNWQRQEISKAFKVMYGKDLIKELKGELHGDFEDLILALMDAPAIYDAKQLHRAMEGLGTKESVLIEIMTSRTNAQIQQVRDAYKMLFKKDLERDLIGETSGHFKRLLVSLCAGGRDESSQTDGLR--------------ANQDARRLLQAGEKRLGTDESTFNAILASQNFSQLRLVFEEYQKASNHSIEKAIEFEFSGDIRDGLLAVIAVIRNRPAYFAKLLHDSMKGLGTRDNDLIRLCVTRAEYDMGDIRNMFQSLYRTSLENMIKGDCSGAYKEGLIALVNGN 453          

HSP 2 Score: 55.4546 bits (132), Expect = 3.390e-8
Identity = 41/151 (27.15%), Postives = 70/151 (46.36%), Query Frame = 3
Query:  135 FHAEQDCE-VLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNF---FQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANK 575
              A QD   +L+   K +GTDE      L  ++ SQ   + + Y+      +   ++ E SG+      AV   +     Y A  L  +MKG GTR+N L  +  +R    + +I+ +++ LY   LE  I  + SG +K  L++ +  N+
Sbjct:  304 LRANQDARRLLQAGEKRLGTDESTFNAILASQNFSQLRLVFEEYQKASNHSIEKAIEFEFSGDIRDGLLAVIAVIRNRPAYFAKLLHDSMKGLGTRDNDLIRLCVTRAEYDMGDIRNMFQSLYRTSLENMIKGDCSGAYKEGLIALVNGNR 454          
BLAST of Annexin vs. Ensembl Celegans
Match: nex-2 (Annexin [Source:UniProtKB/TrEMBL;Acc:Q7JMT5])

HSP 1 Score: 252.292 bits (643), Expect = 2.498e-79
Identity = 138/329 (41.95%), Postives = 196/329 (59.57%), Query Frame = 3
Query:  111 GTIKPFP--NFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            GT   FP   F++  D EVL+KAMKG+G +   ++  L +R+  QR EI K +K M+GKDLI +LK EL G+F   +   +  P  YDA  L  AM+G GT+E+VL EI+TSRTN QI+ ++  YK L+  +LE +++ ETSG FKR+LVS     + E S  D  +              A Q+A+ L  AGEK+LGTDE+ F  I   +N  QLR  F+EY+K S   I ++I+ E SGD R  + A+     N P YFA  L+++MKG GT D  L R+ ++R+E D+ +I+  F   Y+ +LE+ +K D SG Y+  L+  V GN
Sbjct:  139 GTPSVFPVQGFNSNADAEVLRKAMKGLGCNNSKVISILCQRTNWQRQEISKAFKVMYGKDLIKELKGELHGDFEDLILALMDAPAIYDAKQLHRAMEGLGTKESVLIEIMTSRTNAQIQQVRDAYKMLFKKDLERDLIGETSGHFKRLLVSLCAGGRDESSQTDGLR--------------ANQDARRLLQAGEKRLGTDESTFNAILASQNFSQLRLVFEEYQKASNHSIEKAIEFEFSGDIRDGLLAVIAVIRNRPAYFAKLLHDSMKGLGTRDNDLIRLCVTRAEYDMGDIRNMFQSLYRTSLENMIKGDCSGAYKEGLIALVNGN 453          

HSP 2 Score: 55.4546 bits (132), Expect = 3.390e-8
Identity = 41/151 (27.15%), Postives = 70/151 (46.36%), Query Frame = 3
Query:  135 FHAEQDCE-VLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNF---FQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANK 575
              A QD   +L+   K +GTDE      L  ++ SQ   + + Y+      +   ++ E SG+      AV   +     Y A  L  +MKG GTR+N L  +  +R    + +I+ +++ LY   LE  I  + SG +K  L++ +  N+
Sbjct:  304 LRANQDARRLLQAGEKRLGTDESTFNAILASQNFSQLRLVFEEYQKASNHSIEKAIEFEFSGDIRDGLLAVIAVIRNRPAYFAKLLHDSMKGLGTRDNDLIRLCVTRAEYDMGDIRNMFQSLYRTSLENMIKGDCSGAYKEGLIALVNGNR 454          
BLAST of Annexin vs. Ensembl Celegans
Match: nex-2 (Annexin [Source:UniProtKB/TrEMBL;Acc:Q7JMT5])

HSP 1 Score: 252.292 bits (643), Expect = 6.237e-79
Identity = 138/329 (41.95%), Postives = 196/329 (59.57%), Query Frame = 3
Query:  111 GTIKPFP--NFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            GT   FP   F++  D EVL+KAMKG+G +   ++  L +R+  QR EI K +K M+GKDLI +LK EL G+F   +   +  P  YDA  L  AM+G GT+E+VL EI+TSRTN QI+ ++  YK L+  +LE +++ ETSG FKR+LVS     + E S  D  +              A Q+A+ L  AGEK+LGTDE+ F  I   +N  QLR  F+EY+K S   I ++I+ E SGD R  + A+     N P YFA  L+++MKG GT D  L R+ ++R+E D+ +I+  F   Y+ +LE+ +K D SG Y+  L+  V GN
Sbjct:  181 GTPSVFPVQGFNSNADAEVLRKAMKGLGCNNSKVISILCQRTNWQRQEISKAFKVMYGKDLIKELKGELHGDFEDLILALMDAPAIYDAKQLHRAMEGLGTKESVLIEIMTSRTNAQIQQVRDAYKMLFKKDLERDLIGETSGHFKRLLVSLCAGGRDESSQTDGLR--------------ANQDARRLLQAGEKRLGTDESTFNAILASQNFSQLRLVFEEYQKASNHSIEKAIEFEFSGDIRDGLLAVIAVIRNRPAYFAKLLHDSMKGLGTRDNDLIRLCVTRAEYDMGDIRNMFQSLYRTSLENMIKGDCSGAYKEGLIALVNGN 495          

HSP 2 Score: 55.4546 bits (132), Expect = 3.842e-8
Identity = 41/151 (27.15%), Postives = 70/151 (46.36%), Query Frame = 3
Query:  135 FHAEQDCE-VLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNF---FQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANK 575
              A QD   +L+   K +GTDE      L  ++ SQ   + + Y+      +   ++ E SG+      AV   +     Y A  L  +MKG GTR+N L  +  +R    + +I+ +++ LY   LE  I  + SG +K  L++ +  N+
Sbjct:  346 LRANQDARRLLQAGEKRLGTDESTFNAILASQNFSQLRLVFEEYQKASNHSIEKAIEFEFSGDIRDGLLAVIAVIRNRPAYFAKLLHDSMKGLGTRDNDLIRLCVTRAEYDMGDIRNMFQSLYRTSLENMIKGDCSGAYKEGLIALVNGNR 496          
BLAST of Annexin vs. Ensembl Celegans
Match: nex-1 (Annexin [Source:UniProtKB/TrEMBL;Acc:G5EEA8])

HSP 1 Score: 192.971 bits (489), Expect = 3.875e-58
Identity = 122/328 (37.20%), Postives = 183/328 (55.79%), Query Frame = 3
Query:  111 GTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAV-FIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
             TI     F+A    E + +A++    ++ A+V  +   S +QR ++++ YK  +GKD+I  L  + SG+  +A+   +  P  YD   L  AMKG GT E VL EIL SRT  Q+  I+V Y+K Y   LE +I  +TSG F+ +LVS +  +K + SHD              +  QAK +A  L+  G+ KL   +   F+ I   +N+YQLR  F  +++++G  I +SI+ E SGD + S   I   A +   +FA +L+ +MKG GT D  L R++++RSE+DLE IKAEF   Y ++L   VK DTSG Y+  LL  + GN
Sbjct:    6 ATIVDAREFNAPMFAEKIDRALRA--GEKDAVVNVITSISNAQRQQLREPYKLKYGKDIIQALDKKFSGDLEKAIFALMETPLDYDVKQLKAAMKGLGTDEAVLIEILCSRTVDQLRAIRVTYEKEYGKALEADIAGDTSGEFRDLLVSLVTGSK-DGSHD-------------TNDAQAKDDAVRLFADGKAKLAKKDGTHFLHILATQNQYQLRKVFAYFQELAGGSIEKSIEKEFSGDLQKSYLTIVRAASDKQKFFAQQLHASMKGLGTRDNDLIRVIVTRSEVDLELIKAEFQELYSKSLADTVKGDTSGAYRDALLSIINGN 317          
BLAST of Annexin vs. Ensembl Celegans
Match: nex-1 (Annexin [Source:UniProtKB/TrEMBL;Acc:G5EEA8])

HSP 1 Score: 192.971 bits (489), Expect = 3.875e-58
Identity = 122/328 (37.20%), Postives = 183/328 (55.79%), Query Frame = 3
Query:  111 GTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAV-FIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
             TI     F+A    E + +A++    ++ A+V  +   S +QR ++++ YK  +GKD+I  L  + SG+  +A+   +  P  YD   L  AMKG GT E VL EIL SRT  Q+  I+V Y+K Y   LE +I  +TSG F+ +LVS +  +K + SHD              +  QAK +A  L+  G+ KL   +   F+ I   +N+YQLR  F  +++++G  I +SI+ E SGD + S   I   A +   +FA +L+ +MKG GT D  L R++++RSE+DLE IKAEF   Y ++L   VK DTSG Y+  LL  + GN
Sbjct:    6 ATIVDAREFNAPMFAEKIDRALRA--GEKDAVVNVITSISNAQRQQLREPYKLKYGKDIIQALDKKFSGDLEKAIFALMETPLDYDVKQLKAAMKGLGTDEAVLIEILCSRTVDQLRAIRVTYEKEYGKALEADIAGDTSGEFRDLLVSLVTGSK-DGSHD-------------TNDAQAKDDAVRLFADGKAKLAKKDGTHFLHILATQNQYQLRKVFAYFQELAGGSIEKSIEKEFSGDLQKSYLTIVRAASDKQKFFAQQLHASMKGLGTRDNDLIRVIVTRSEVDLELIKAEFQELYSKSLADTVKGDTSGAYRDALLSIINGN 317          
BLAST of Annexin vs. Ensembl Fly
Match: AnxB11 (gene:FBgn0030749 transcript:FBtr0334038)

HSP 1 Score: 252.292 bits (643), Expect = 6.315e-81
Identity = 149/325 (45.85%), Postives = 194/325 (59.69%), Query Frame = 3
Query:  114 TIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEP--DYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFV 1082
            T+ P  NF A +D   L+KAMKG GTDE A++  + RRS  QR EI++ +KT FGKDLI D+KSE SGNF + +   L  P  DYY A  L  AM G GT E VL EIL + +N +I  IK  Y +LY   LE  + SETSG FKR+L S   A + E    D        P A      AK +A+EL  AGE ++GTDE++F  I C RN  QL+  F EYE ++G  + ++I  E SGD    + AI     N   YFA+RL+ AM G GT DT L R++I+RSEID+ +IK  F R Y ++L+S++K DTSG Y+  L   V
Sbjct:    8 TVVPAANFDAVKDAHDLRKAMKGFGTDEDALINIICRRSNEQRQEIQRQFKTHFGKDLIEDIKSETSGNF-EKLLVGLLRPIVDYYCAE-LNDAMAGLGTDEEVLIEILCTLSNMEINTIKNQYLRLYGAHLESELKSETSGNFKRLLTSLCTAARDESGRVD--------PVA------AKNDARELLKAGELRVGTDESMFNMILCQRNYQQLKLIFQEYEGMTGHSLEKAIKKEFSGDVMEGLIAIYRCVTNKAEYFASRLHKAMAGIGTNDTQLIRVIITRSEIDMTDIKVAFERLYGKSLKSWIKGDTSGHYKHALYALV 316          
BLAST of Annexin vs. Ensembl Fly
Match: AnxB11 (gene:FBgn0030749 transcript:FBtr0074302)

HSP 1 Score: 252.292 bits (643), Expect = 6.315e-81
Identity = 149/325 (45.85%), Postives = 194/325 (59.69%), Query Frame = 3
Query:  114 TIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEP--DYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFV 1082
            T+ P  NF A +D   L+KAMKG GTDE A++  + RRS  QR EI++ +KT FGKDLI D+KSE SGNF + +   L  P  DYY A  L  AM G GT E VL EIL + +N +I  IK  Y +LY   LE  + SETSG FKR+L S   A + E    D        P A      AK +A+EL  AGE ++GTDE++F  I C RN  QL+  F EYE ++G  + ++I  E SGD    + AI     N   YFA+RL+ AM G GT DT L R++I+RSEID+ +IK  F R Y ++L+S++K DTSG Y+  L   V
Sbjct:    8 TVVPAANFDAVKDAHDLRKAMKGFGTDEDALINIICRRSNEQRQEIQRQFKTHFGKDLIEDIKSETSGNF-EKLLVGLLRPIVDYYCAE-LNDAMAGLGTDEEVLIEILCTLSNMEINTIKNQYLRLYGAHLESELKSETSGNFKRLLTSLCTAARDESGRVD--------PVA------AKNDARELLKAGELRVGTDESMFNMILCQRNYQQLKLIFQEYEGMTGHSLEKAIKKEFSGDVMEGLIAIYRCVTNKAEYFASRLHKAMAGIGTNDTQLIRVIITRSEIDMTDIKVAFERLYGKSLKSWIKGDTSGHYKHALYALV 316          
BLAST of Annexin vs. Ensembl Fly
Match: AnxB11 (gene:FBgn0030749 transcript:FBtr0334041)

HSP 1 Score: 252.292 bits (643), Expect = 6.315e-81
Identity = 149/325 (45.85%), Postives = 194/325 (59.69%), Query Frame = 3
Query:  114 TIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEP--DYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFV 1082
            T+ P  NF A +D   L+KAMKG GTDE A++  + RRS  QR EI++ +KT FGKDLI D+KSE SGNF + +   L  P  DYY A  L  AM G GT E VL EIL + +N +I  IK  Y +LY   LE  + SETSG FKR+L S   A + E    D        P A      AK +A+EL  AGE ++GTDE++F  I C RN  QL+  F EYE ++G  + ++I  E SGD    + AI     N   YFA+RL+ AM G GT DT L R++I+RSEID+ +IK  F R Y ++L+S++K DTSG Y+  L   V
Sbjct:    8 TVVPAANFDAVKDAHDLRKAMKGFGTDEDALINIICRRSNEQRQEIQRQFKTHFGKDLIEDIKSETSGNF-EKLLVGLLRPIVDYYCAE-LNDAMAGLGTDEEVLIEILCTLSNMEINTIKNQYLRLYGAHLESELKSETSGNFKRLLTSLCTAARDESGRVD--------PVA------AKNDARELLKAGELRVGTDESMFNMILCQRNYQQLKLIFQEYEGMTGHSLEKAIKKEFSGDVMEGLIAIYRCVTNKAEYFASRLHKAMAGIGTNDTQLIRVIITRSEIDMTDIKVAFERLYGKSLKSWIKGDTSGHYKHALYALV 316          
BLAST of Annexin vs. Ensembl Fly
Match: AnxB10 (gene:FBgn0000084 transcript:FBtr0070025)

HSP 1 Score: 246.899 bits (629), Expect = 8.490e-79
Identity = 141/320 (44.06%), Postives = 190/320 (59.38%), Query Frame = 3
Query:  114 TIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTP-FYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFL 1070
            T+K    F A QD +VL+ AMKG GTDE+ I++ L  RS  QR  IK  Y+  F +DL+ DLK EL G F   +   +  P  Y    L  AM G GT E  L EIL ++TN+++  I  +Y++ Y   L E + SETSGFF+R+L   +   +              G    V + QAK++A +LY+AGE KLGTDE VF +I    +  QLR  F+EY+ +SG+ I ++I +EMS +   ++ AI  + V +P  +FA RLY AM GAGT D TL RI++SRSEIDLE IK EF R Y +TL S V  +TSGDY+  L
Sbjct:    8 TVKDAAPFDASQDAQVLRAAMKGFGTDEQEIIDVLVGRSNQQRQTIKAVYEAEFERDLVDDLKDELGGKFEDVIVGLMMPPVEYLCKQLHAAMAGIGTEEATLVEILCTKTNEEMAQIVAVYEERYQRPLAEQMCSETSGFFRRLLTLIVTGVR-------------DGLDTPVDVGQAKEQAAQLYSAGEAKLGTDEEVFNRIMSHASFPQLRLVFEEYKVLSGQTIEQAIKHEMSDELHEAMMAI-VECVQSPAAFFANRLYKAMNGAGTDDATLIRIIVSRSEIDLETIKQEFERIYNRTLHSAVVAETSGDYKRAL 313          

HSP 2 Score: 69.707 bits (169), Expect = 6.825e-13
Identity = 43/143 (30.07%), Postives = 74/143 (51.75%), Query Frame = 3
Query:  144 EQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQA---VEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCL 563
            EQ  ++       +GTDE+     +   S  Q   + + YK + G+ +   +K E+S    +A   + E +  P  + A+ L+ AM GAGT +  L  I+ SR+   +E IK  ++++Y+  L   +V+ETSG +KR L + L
Sbjct:  175 EQAAQLYSAGEAKLGTDEEVFNRIMSHASFPQLRLVFEEYKVLSGQTIEQAIKHEMSDELHEAMMAIVECVQSPAAFFANRLYKAMNGAGTDDATLIRIIVSRSEIDLETIKQEFERIYNRTLHSAVVAETSGDYKRALTALL 317          

HSP 3 Score: 61.6178 bits (148), Expect = 3.001e-10
Identity = 68/269 (25.28%), Postives = 109/269 (40.52%), Query Frame = 3
Query:   96 GEKYKGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNF-------FQAVEESLFEP-----DYYDAHSLFHAMKGA-GTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVL---VSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAI 854
            G K++  I        E  C+ L  AM GIGT+E  +VE L  ++  +  +I   Y+  + + L   + SE SG F          V + L  P         A  L+ A +   GT E V   I++  +  Q+  +   YK L    +E+ I  E S      +   V C+Q+                 P A          A  LY A     GTD+A  I+I   R++  L     E+E+I  + +  ++  E SGD++ ++ A+
Sbjct:   74 GGKFEDVIVGLMMPPVEYLCKQLHAAMAGIGTEEATLVEILCTKTNEEMAQIVAVYEERYQRPLAEQMCSETSGFFRRLLTLIVTGVRDGLDTPVDVGQAKEQAAQLYSAGEAKLGTDEEVFNRIMSHASFPQLRLVFEEYKVLSGQTIEQAIKHEMSDELHEAMMAIVECVQS-----------------PAAFF--------ANRLYKAMNGA-GTDDATLIRIIVSRSEIDLETIKQEFERIYNRTLHSAVVAETSGDYKRALTAL 316          
BLAST of Annexin vs. Ensembl Fly
Match: AnxB10 (gene:FBgn0000084 transcript:FBtr0301931)

HSP 1 Score: 245.358 bits (625), Expect = 3.481e-78
Identity = 142/321 (44.24%), Postives = 191/321 (59.50%), Query Frame = 3
Query:  114 TIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTP-FYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKD-DTSGDYQAFL 1070
            T+K    F A QD +VL+ AMKG GTDE+ I++ L  RS  QR  IK  Y+  F +DL+ DLK EL G F   +   +  P  Y    L  AM G GT E  L EIL ++TN+++  I  +Y++ Y   L E + SETSGFF+R+L   +   +              G    V + QAK++A +LY+AGE KLGTDE VF +I    +  QLR  F+EY+ +SG+ I ++I +EMS +   ++ AI  + V +P  +FA RLY AM GAGT D TL RI++SRSEIDLE IK EF R Y +TL S V D +TSGDY+  L
Sbjct:    8 TVKDAAPFDASQDAQVLRAAMKGFGTDEQEIIDVLVGRSNQQRQTIKAVYEAEFERDLVDDLKDELGGKFEDVIVGLMMPPVEYLCKQLHAAMAGIGTEEATLVEILCTKTNEEMAQIVAVYEERYQRPLAEQMCSETSGFFRRLLTLIVTGVR-------------DGLDTPVDVGQAKEQAAQLYSAGEAKLGTDEEVFNRIMSHASFPQLRLVFEEYKVLSGQTIEQAIKHEMSDELHEAMMAI-VECVQSPAAFFANRLYKAMNGAGTDDATLIRIIVSRSEIDLETIKQEFERIYNRTLHSAVVDAETSGDYKRAL 314          

HSP 2 Score: 60.8474 bits (146), Expect = 6.360e-10
Identity = 69/270 (25.56%), Postives = 110/270 (40.74%), Query Frame = 3
Query:   96 GEKYKGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNF-------FQAVEESLFEP-----DYYDAHSLFHAMKGA-GTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVL---VSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFES-IDNEMSGDFRSSIKAI 854
            G K++  I        E  C+ L  AM GIGT+E  +VE L  ++  +  +I   Y+  + + L   + SE SG F          V + L  P         A  L+ A +   GT E V   I++  +  Q+  +   YK L    +E+ I  E S      +   V C+Q+                 P A          A  LY A     GTD+A  I+I   R++  L     E+E+I  + +  + +D E SGD++ ++ A+
Sbjct:   74 GGKFEDVIVGLMMPPVEYLCKQLHAAMAGIGTEEATLVEILCTKTNEEMAQIVAVYEERYQRPLAEQMCSETSGFFRRLLTLIVTGVRDGLDTPVDVGQAKEQAAQLYSAGEAKLGTDEEVFNRIMSHASFPQLRLVFEEYKVLSGQTIEQAIKHEMSDELHEAMMAIVECVQS-----------------PAAFF--------ANRLYKAMNGA-GTDDATLIRIIVSRSEIDLETIKQEFERIYNRTLHSAVVDAETSGDYKRALTAL 317          
BLAST of Annexin vs. Ensembl Zebrafish
Match: anxa11a (annexin A11a [Source:ZFIN;Acc:ZDB-GENE-030707-4])

HSP 1 Score: 300.442 bits (768), Expect = 1.912e-97
Identity = 158/329 (48.02%), Postives = 213/329 (64.74%), Query Frame = 3
Query:  105 YKGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            ++G+I+ FP     +D EVL+KAMKG GTDE+AI+  LG RS  QR+ +  +YKT +GKDLI DLKSELSGNF + V   L  P  YDA+ L  A+KGAGT E  L EIL SR+N +I  I  ++K      LE+ I  +TSG F+R+LVS  Q N+ E  +              V I+ AK +AQ LY AGE KLGTDE+ F  I C R+K  LRA F+EY+ + G+DI +SI+ EMSGD  S + A+     NTP YFA RL+ AMKGAGT D TL RI+++RSE+D+ +I+ E+++ Y ++L + +  DTSGDY+  LL+   G+
Sbjct:  168 FRGSIQDFPGADPLRDAEVLRKAMKGFGTDEQAIINLLGSRSNKQRVPLLVSYKTAYGKDLIKDLKSELSGNFEKLVLAMLKTPSQYDAYELKEAIKGAGTDEACLIEILASRSNAEIREINQVFKAENKKSLEDAISGDTSGHFRRLLVSLAQGNRDESEN--------------VDISIAKTDAQALYQAGENKLGTDESKFNAILCARSKAHLRAVFNEYQHMCGRDIEKSIEREMSGDLESGMLAVVKCIKNTPAYFAERLHKAMKGAGTKDRTLIRIMVTRSEVDMLDIRQEYAKNYGKSLYTAISGDTSGDYKKLLLKLCGGS 482          
BLAST of Annexin vs. Ensembl Zebrafish
Match: anxa11a (annexin A11a [Source:ZFIN;Acc:ZDB-GENE-030707-4])

HSP 1 Score: 300.056 bits (767), Expect = 8.694e-97
Identity = 158/329 (48.02%), Postives = 213/329 (64.74%), Query Frame = 3
Query:  105 YKGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            ++G+I+ FP     +D EVL+KAMKG GTDE+AI+  LG RS  QR+ +  +YKT +GKDLI DLKSELSGNF + V   L  P  YDA+ L  A+KGAGT E  L EIL SR+N +I  I  ++K      LE+ I  +TSG F+R+LVS  Q N+ E  +              V I+ AK +AQ LY AGE KLGTDE+ F  I C R+K  LRA F+EY+ + G+DI +SI+ EMSGD  S + A+     NTP YFA RL+ AMKGAGT D TL RI+++RSE+D+ +I+ E+++ Y ++L + +  DTSGDY+  LL+   G+
Sbjct:  211 FRGSIQDFPGADPLRDAEVLRKAMKGFGTDEQAIINLLGSRSNKQRVPLLVSYKTAYGKDLIKDLKSELSGNFEKLVLAMLKTPSQYDAYELKEAIKGAGTDEACLIEILASRSNAEIREINQVFKAENKKSLEDAISGDTSGHFRRLLVSLAQGNRDESEN--------------VDISIAKTDAQALYQAGENKLGTDESKFNAILCARSKAHLRAVFNEYQHMCGRDIEKSIEREMSGDLESGMLAVVKCIKNTPAYFAERLHKAMKGAGTKDRTLIRIMVTRSEVDMLDIRQEYAKNYGKSLYTAISGDTSGDYKKLLLKLCGGS 525          
BLAST of Annexin vs. Ensembl Zebrafish
Match: anxa11b (annexin A11b [Source:ZFIN;Acc:ZDB-GENE-030707-5])

HSP 1 Score: 297.36 bits (760), Expect = 3.027e-96
Identity = 156/329 (47.42%), Postives = 213/329 (64.74%), Query Frame = 3
Query:  105 YKGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            ++GTIK FP     +D EVL+KAMKG GTDE AI+E LG RS  QR+ +   YKT +GKDL+ DLKSEL+G+F + V   L  P  +DA     A+ GAGT E  L EIL+SR+N +I+ I  +YK  Y   LE+ I ++TSG F+R+LVS  Q N+ E              +  V I+ AKQ+AQ+LY+AGE K+GTDE+ F  I C R+K  LR  F EY+++ G+DI +SI  EMSGD  S + A+     NTP YFA RL+ AM+GAGT D TL RI++SRSE+D+ +I+ E+ R + ++L + +  DTSGDY+  LL+   G+
Sbjct:  170 FRGTIKDFPGADPLRDVEVLRKAMKGFGTDENAIIELLGSRSNKQRVPLLAAYKTTYGKDLVRDLKSELTGHFEELVLAMLKSPAQFDASECKEAISGAGTDEACLIEILSSRSNAEIQEINRIYKAEYGKSLEDAISNDTSGHFRRLLVSLCQGNRDE--------------RETVDISLAKQDAQKLYSAGENKVGTDESQFNAILCARSKPHLRQVFQEYQQMCGRDIEKSICREMSGDLESGMVAVVKCIKNTPAYFAERLHKAMQGAGTKDRTLIRIMVSRSELDMLDIRQEYLRLFGKSLYTHISGDTSGDYKKLLLKLCGGS 484          
BLAST of Annexin vs. Ensembl Zebrafish
Match: anxa4 (annexin A4 [Source:ZFIN;Acc:ZDB-GENE-030707-1])

HSP 1 Score: 275.789 bits (704), Expect = 5.448e-90
Identity = 147/327 (44.95%), Postives = 201/327 (61.47%), Query Frame = 3
Query:  108 KGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQG 1088
            +GT+     F  E D + +  AMKG GT+E  I+E L  R+I+QR +IK+ +K   GK+L+  LKSEL+GNF + V   +     YDAH L +A+KGAGT E  L +IL SR+N +I+ I   YKK +   LE++I  +TSG F+RVLVS L A + E +               V   QA Q+A+++Y AGE + GTDE  F+ + C+RN+  L   F EY+K SG+DI +SI  EMSG       AI     N P +FA RLY +MKG GTTD+ L RI+++R+EID+ +IKAEF + Y +TL SF+K DTSGDY+  LL    G
Sbjct:    7 RGTVTEASGFKPEDDAQKIYNAMKGAGTNEATIIEILAHRTIAQRQKIKEAFKLSVGKELMDCLKSELTGNFEKVVVGLMMPAAVYDAHELRNAIKGAGTEEACLIDILASRSNAEIKEIVAAYKKEHDKSLEDDICGDTSGMFQRVLVSLLTAGRDESTK--------------VDEAQAVQDAKDIYEAGEARWGTDEVKFLTVLCVRNRNHLLRVFQEYQKKSGRDIEDSIKREMSGSLEDVFLAIVKCIKNKPAFFAERLYKSMKGLGTTDSVLIRIMVARAEIDMLDIKAEFLKMYGKTLHSFIKGDTSGDYRKILLELCGG 319          
BLAST of Annexin vs. Ensembl Zebrafish
Match: anxa4 (annexin A4 [Source:ZFIN;Acc:ZDB-GENE-030707-1])

HSP 1 Score: 275.789 bits (704), Expect = 5.448e-90
Identity = 147/327 (44.95%), Postives = 201/327 (61.47%), Query Frame = 3
Query:  108 KGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQG 1088
            +GT+     F  E D + +  AMKG GT+E  I+E L  R+I+QR +IK+ +K   GK+L+  LKSEL+GNF + V   +     YDAH L +A+KGAGT E  L +IL SR+N +I+ I   YKK +   LE++I  +TSG F+RVLVS L A + E +               V   QA Q+A+++Y AGE + GTDE  F+ + C+RN+  L   F EY+K SG+DI +SI  EMSG       AI     N P +FA RLY +MKG GTTD+ L RI+++R+EID+ +IKAEF + Y +TL SF+K DTSGDY+  LL    G
Sbjct:    7 RGTVTEASGFKPEDDAQKIYNAMKGAGTNEATIIEILAHRTIAQRQKIKEAFKLSVGKELMDCLKSELTGNFEKVVVGLMMPAAVYDAHELRNAIKGAGTEEACLIDILASRSNAEIKEIVAAYKKEHDKSLEDDICGDTSGMFQRVLVSLLTAGRDESTK--------------VDEAQAVQDAKDIYEAGEARWGTDEVKFLTVLCVRNRNHLLRVFQEYQKKSGRDIEDSIKREMSGSLEDVFLAIVKCIKNKPAFFAERLYKSMKGLGTTDSVLIRIMVARAEIDMLDIKAEFLKMYGKTLHSFIKGDTSGDYRKILLELCGG 319          
BLAST of Annexin vs. Ensembl Xenopus
Match: trpv3 (transient receptor potential cation channel, subfamily V, member 3 [Source:Xenbase;Acc:XB-GENE-1013149])

HSP 1 Score: 294.278 bits (752), Expect = 3.852e-97
Identity = 160/326 (49.08%), Postives = 215/326 (65.95%), Query Frame = 3
Query:  108 KGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEE---SLFEP-DYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLL 1073
            +GTIK  PNF A  D E L+KAMKG GTDE+AIV+ +  RS  QR +IK  +KT +GKDLI DLKSELSGN    VEE   +LF P  YYDA SL+HAMKGAGT+E VL EIL +RTN +I+NI   YK  +  ++E++I S+TSG F+R+L+S  Q N+ E  +              V++ QA+Q+AQ LY AGE KLGTDE+ F  +   R+  QLRA  + Y +IS +D+   I  E SG     +KA+   A+N P +FA RLY +MKGAGT D+TL RI+++RSEIDL  IK  + + ++++L + +  DTSGDY+  L+
Sbjct:    7 QGTIKAAPNFDALSDAEKLRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTAYGKDLIKDLKSELSGN----VEELIIALFMPATYYDAWSLYHAMKGAGTQERVLIEILCTRTNSEIKNIVSCYKHEFGRDIEKDIRSDTSGHFERLLISMCQGNRDENQN--------------VNLQQAEQDAQRLYQAGEGKLGTDESSFNLVLASRSFPQLRAVAEAYARISKRDLISVIGREFSGYIEDGLKAVLQCAINRPAFFAERLYRSMKGAGTDDSTLIRIIVTRSEIDLVQIKQAYVQMHQKSLSAAISSDTSGDYRRLLI 314          

HSP 2 Score: 77.0258 bits (188), Expect = 4.250e-15
Identity = 43/135 (31.85%), Postives = 74/135 (54.81%), Query Frame = 3
Query:  687 KKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            K  GTDE   + +   R+  Q +     ++   GKD+ + + +E+SG+    I A+   A    +Y A  LY+AMKGAGT +  L  IL +R+  +++NI + +  E+ + +E  ++ DTSG ++  L+   QGN
Sbjct:   30 KGFGTDEQAIVDVVANRSNDQRQKIKAAFKTAYGKDLIKDLKSELSGNVEELIIALFMPAT---YYDAWSLYHAMKGAGTQERVLIEILCTRTNSEIKNIVSCYKHEFGRDIEKDIRSDTSGHFERLLISMCQGN 161          

HSP 3 Score: 73.1738 bits (178), Expect = 8.770e-14
Identity = 46/144 (31.94%), Postives = 78/144 (54.17%), Query Frame = 3
Query:  138 HAEQDCEVLKKAMKG-IGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSG---NFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVS 557
             AEQD + L +A +G +GTDE +    L  RS  Q   + + Y  +  +DLI+ +  E SG   +  +AV +       + A  L+ +MKGAGT ++ L  I+ +R+   +  IK  Y +++   L   I S+TSG ++R+L++
Sbjct:  172 QAEQDAQRLYQAGEGKLGTDESSFNLVLASRSFPQLRAVAEAYARISKRDLISVIGREFSGYIEDGLKAVLQCAINRPAFFAERLYRSMKGAGTDDSTLIRIIVTRSEIDLVQIKQAYVQMHQKSLSAAISSDTSGDYRRLLIA 315          
BLAST of Annexin vs. Ensembl Xenopus
Match: trpv3 (transient receptor potential cation channel, subfamily V, member 3 [Source:Xenbase;Acc:XB-GENE-1013149])

HSP 1 Score: 294.278 bits (752), Expect = 5.753e-97
Identity = 160/326 (49.08%), Postives = 215/326 (65.95%), Query Frame = 3
Query:  108 KGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEE---SLFEP-DYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLL 1073
            +GTIK  PNF A  D E L+KAMKG GTDE+AIV+ +  RS  QR +IK  +KT +GKDLI DLKSELSGN    VEE   +LF P  YYDA SL+HAMKGAGT+E VL EIL +RTN +I+NI   YK  +  ++E++I S+TSG F+R+L+S  Q N+ E  +              V++ QA+Q+AQ LY AGE KLGTDE+ F  +   R+  QLRA  + Y +IS +D+   I  E SG     +KA+   A+N P +FA RLY +MKGAGT D+TL RI+++RSEIDL  IK  + + ++++L + +  DTSGDY+  L+
Sbjct:   12 QGTIKAAPNFDALSDAEKLRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTAYGKDLIKDLKSELSGN----VEELIIALFMPATYYDAWSLYHAMKGAGTQERVLIEILCTRTNSEIKNIVSCYKHEFGRDIEKDIRSDTSGHFERLLISMCQGNRDENQN--------------VNLQQAEQDAQRLYQAGEGKLGTDESSFNLVLASRSFPQLRAVAEAYARISKRDLISVIGREFSGYIEDGLKAVLQCAINRPAFFAERLYRSMKGAGTDDSTLIRIIVTRSEIDLVQIKQAYVQMHQKSLSAAISSDTSGDYRRLLI 319          

HSP 2 Score: 79.337 bits (194), Expect = 7.468e-16
Identity = 71/252 (28.17%), Postives = 115/252 (45.63%), Query Frame = 3
Query:  150 DCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAV-----------EESLFEPDYYDAHSLFHAMKGA-GTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVV--SINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQ 863
            D   L  AMKG GT E+ ++E L  R+ S+   I   YK  FG+D+  D++S+ SG+F + +           +    +    DA  L+ A +G  GT E+    +L SR+  Q+  +   Y ++   +L   I  E SG+                         E G KAV+  +IN+    A+ LY +  K  GTD++  I+I   R++  L      Y ++  K +  +I ++ SGD+R  + AIA Q
Sbjct:   98 DAWSLYHAMKGAGTQERVLIEILCTRTNSEIKNIVSCYKHEFGRDIEKDIRSDTSGHFERLLISMCQGNRDENQNVNLQQAEQDAQRLYQAGEGKLGTDESSFNLVLASRSFPQLRAVAEAYARISKRDLISVIGREFSGYI------------------------EDGLKAVLQCAINRPAFFAERLYRS-MKGAGTDDSTLIRIIVTRSEIDLVQIKQAYVQMHQKSLSAAISSDTSGDYRRLLIAIAGQ 324          

HSP 3 Score: 77.411 bits (189), Expect = 3.533e-15
Identity = 43/135 (31.85%), Postives = 74/135 (54.81%), Query Frame = 3
Query:  687 KKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            K  GTDE   + +   R+  Q +     ++   GKD+ + + +E+SG+    I A+   A    +Y A  LY+AMKGAGT +  L  IL +R+  +++NI + +  E+ + +E  ++ DTSG ++  L+   QGN
Sbjct:   35 KGFGTDEQAIVDVVANRSNDQRQKIKAAFKTAYGKDLIKDLKSELSGNVEELIIALFMPAT---YYDAWSLYHAMKGAGTQERVLIEILCTRTNSEIKNIVSCYKHEFGRDIEKDIRSDTSGHFERLLISMCQGN 166          

HSP 4 Score: 73.1738 bits (178), Expect = 9.079e-14
Identity = 46/144 (31.94%), Postives = 78/144 (54.17%), Query Frame = 3
Query:  138 HAEQDCEVLKKAMKG-IGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSG---NFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVS 557
             AEQD + L +A +G +GTDE +    L  RS  Q   + + Y  +  +DLI+ +  E SG   +  +AV +       + A  L+ +MKGAGT ++ L  I+ +R+   +  IK  Y +++   L   I S+TSG ++R+L++
Sbjct:  177 QAEQDAQRLYQAGEGKLGTDESSFNLVLASRSFPQLRAVAEAYARISKRDLISVIGREFSGYIEDGLKAVLQCAINRPAFFAERLYRSMKGAGTDDSTLIRIIVTRSEIDLVQIKQAYVQMHQKSLSAAISSDTSGDYRRLLIA 320          
BLAST of Annexin vs. Ensembl Xenopus
Match: mllt10 (MLLT10, histone lysine methyltransferase DOT1L cofactor [Source:Xenbase;Acc:XB-GENE-6408100])

HSP 1 Score: 293.893 bits (751), Expect = 6.626e-97
Identity = 157/329 (47.72%), Postives = 207/329 (62.92%), Query Frame = 3
Query:  108 KGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQ--AKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQG 1088
            KGTIKP+ NF+A  D + L+KAMKG GTDE AI++ +  R++SQR EIK  YKT  GKDL  DLKSEL+GNF + +   +     YD   L  AMKGAGT E  L EIL SR+ ++I+NI + Y+  Y   LE++I S+TS  F+RVLVS                L   G     ++N+  AKQ+A ELY AGEKK GTDE  F+ I C RN+  L   FDEY+KI+ KD+  SI +EMSG F  ++ A+     + P YFA RLY +MKG GT D TL R+++SR EID+  I++EF + Y ++L SF+K D SGDY+  LL+   G
Sbjct:    7 KGTIKPYANFNAADDVQKLRKAMKGAGTDEDAIIDVIANRTLSQRQEIKTAYKTTIGKDLEDDLKSELTGNFEKVIVGLITPSTLYDVEELKKAMKGAGTDEGCLIEILASRSAEEIKNINITYRIKYGKSLEDDICSDTSFMFQRVLVS----------------LAAGGRDQSTNVNEALAKQDANELYEAGEKKWGTDEVKFLTILCSRNRNHLLKVFDEYKKIAKKDLEASIKSEMSGHFEDALLAVVKCLRSRPGYFAERLYKSMKGLGTDDKTLIRVMVSRCEIDMLEIRSEFKKMYGKSLHSFIKGDCSGDYRKVLLKLCGG 319          
BLAST of Annexin vs. Ensembl Xenopus
Match: mllt10 (MLLT10, histone lysine methyltransferase DOT1L cofactor [Source:Xenbase;Acc:XB-GENE-6408100])

HSP 1 Score: 293.893 bits (751), Expect = 6.626e-97
Identity = 157/329 (47.72%), Postives = 207/329 (62.92%), Query Frame = 3
Query:  108 KGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQ--AKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQG 1088
            KGTIKP+ NF+A  D + L+KAMKG GTDE AI++ +  R++SQR EIK  YKT  GKDL  DLKSEL+GNF + +   +     YD   L  AMKGAGT E  L EIL SR+ ++I+NI + Y+  Y   LE++I S+TS  F+RVLVS                L   G     ++N+  AKQ+A ELY AGEKK GTDE  F+ I C RN+  L   FDEY+KI+ KD+  SI +EMSG F  ++ A+     + P YFA RLY +MKG GT D TL R+++SR EID+  I++EF + Y ++L SF+K D SGDY+  LL+   G
Sbjct:    5 KGTIKPYANFNAADDVQKLRKAMKGAGTDEDAIIDVIANRTLSQRQEIKTAYKTTIGKDLEDDLKSELTGNFEKVIVGLITPSTLYDVEELKKAMKGAGTDEGCLIEILASRSAEEIKNINITYRIKYGKSLEDDICSDTSFMFQRVLVS----------------LAAGGRDQSTNVNEALAKQDANELYEAGEKKWGTDEVKFLTILCSRNRNHLLKVFDEYKKIAKKDLEASIKSEMSGHFEDALLAVVKCLRSRPGYFAERLYKSMKGLGTDDKTLIRVMVSRCEIDMLEIRSEFKKMYGKSLHSFIKGDCSGDYRKVLLKLCGG 317          
BLAST of Annexin vs. Ensembl Xenopus
Match: pyy (peptide YY [Source:Xenbase;Acc:XB-GENE-986969])

HSP 1 Score: 298.13 bits (762), Expect = 1.828e-96
Identity = 160/336 (47.62%), Postives = 217/336 (64.58%), Query Frame = 3
Query:   84 IGAKGEKYKGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            I + G+  +GTI    NF A +D EVL+KAMKG GTDE+AI+ECLG RS  QR +I  ++KT +GKDLI DLKSELSGNF + +   +  P  YDAH +  A+KGAGT E  L EIL SR+N  +  I   YK  Y   LE+ I S+TSG F R+LVS  Q N+ E ++ D+         A+V     +++ QELY AGE +LGTDE+ F  I C R++  L A F EY+++  +DI +SI  EMSG+  + + A+     NTP +FA RLY +MKGAGT D TL RI++SRSE+DL +I++E+ R Y ++L + +  DTSGDY+  LL+   GN
Sbjct:  162 IPSYGKVTRGTITDAANFDALRDAEVLRKAMKGFGTDEQAIIECLGSRSNKQRQQISLSFKTAYGKDLIKDLKSELSGNFEKTILAMMKTPTLYDAHEIHEAIKGAGTDEECLIEILASRSNAAVHEICNAYKTEYKKTLEQAIKSDTSGHFLRLLVSLAQGNRDESNNVDM---------ALV-----QRDVQELYAAGENRLGTDESKFNAILCTRSRAHLNAVFSEYQRMCNRDIEKSICREMSGNLENGMLAVVKCLKNTPAFFAERLYKSMKGAGTKDKTLIRIMVSRSEVDLLDIRSEYKRMYGRSLYTDITGDTSGDYRKILLKLCGGN 483          
BLAST of Annexin vs. Ensembl Mouse
Match: Anxa7 (annexin A7 [Source:MGI Symbol;Acc:MGI:88031])

HSP 1 Score: 292.738 bits (748), Expect = 9.549e-95
Identity = 157/326 (48.16%), Postives = 216/326 (66.26%), Query Frame = 3
Query:  108 KGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPD-YYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFV 1082
            +GTI P  NF A +D E+L+KAMKG GTDE+AIV+ +  RS  QR +IK  +KTM+GKDLI DLKSELSGN  + +  +LF P  YYDA SL  AM+GAGT+E VL EIL +RTN++I +I   Y+  +  +LE++I S+TSG F+R+LVS  Q N+ E              +  V+   A+++AQ LY AGE +LGTDE+ F  I   R+  QL+AT + Y +++ +D+  S+  E SG   S +K I   A+N P +FA RLY +MKGAGT D+TL RI+++RSEIDL  IK  F++ Y++TL + +  DTSGDY+  LL  V
Sbjct:  151 QGTILPASNFDAMRDAEILRKAMKGFGTDEQAIVDVVSNRSNDQRQQIKAAFKTMYGKDLIKDLKSELSGNMEELI-LALFMPSTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIRDIVRCYQLEFGRDLEKDIRSDTSGHFERLLVSMCQGNRDE--------------RQSVNHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLKATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYSMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFTQMYQKTLSTMIASDTSGDYRKLLLAIV 461          

HSP 2 Score: 69.707 bits (169), Expect = 1.865e-12
Identity = 41/142 (28.87%), Postives = 73/142 (51.41%), Query Frame = 3
Query:  666 ELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            E+     K  GTDE   + +   R+  Q +     ++ + GKD+ + + +E+SG+    I A+   +    +Y A  L  AM+GAGT +  L  IL +R+  ++ +I   +  E+ + LE  ++ DTSG ++  L+   QGN
Sbjct:  167 EILRKAMKGFGTDEQAIVDVVSNRSNDQRQQIKAAFKTMYGKDLIKDLKSELSGNMEELILALFMPST---YYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIRDIVRCYQLEFGRDLEKDIRSDTSGHFERLLVSMCQGN 305          
BLAST of Annexin vs. Ensembl Mouse
Match: Anxa7 (annexin A7 [Source:MGI Symbol;Acc:MGI:88031])

HSP 1 Score: 292.738 bits (748), Expect = 9.549e-95
Identity = 157/326 (48.16%), Postives = 216/326 (66.26%), Query Frame = 3
Query:  108 KGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPD-YYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFV 1082
            +GTI P  NF A +D E+L+KAMKG GTDE+AIV+ +  RS  QR +IK  +KTM+GKDLI DLKSELSGN  + +  +LF P  YYDA SL  AM+GAGT+E VL EIL +RTN++I +I   Y+  +  +LE++I S+TSG F+R+LVS  Q N+ E              +  V+   A+++AQ LY AGE +LGTDE+ F  I   R+  QL+AT + Y +++ +D+  S+  E SG   S +K I   A+N P +FA RLY +MKGAGT D+TL RI+++RSEIDL  IK  F++ Y++TL + +  DTSGDY+  LL  V
Sbjct:  151 QGTILPASNFDAMRDAEILRKAMKGFGTDEQAIVDVVSNRSNDQRQQIKAAFKTMYGKDLIKDLKSELSGNMEELI-LALFMPSTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIRDIVRCYQLEFGRDLEKDIRSDTSGHFERLLVSMCQGNRDE--------------RQSVNHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLKATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYSMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFTQMYQKTLSTMIASDTSGDYRKLLLAIV 461          

HSP 2 Score: 69.707 bits (169), Expect = 1.865e-12
Identity = 41/142 (28.87%), Postives = 73/142 (51.41%), Query Frame = 3
Query:  666 ELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            E+     K  GTDE   + +   R+  Q +     ++ + GKD+ + + +E+SG+    I A+   +    +Y A  L  AM+GAGT +  L  IL +R+  ++ +I   +  E+ + LE  ++ DTSG ++  L+   QGN
Sbjct:  167 EILRKAMKGFGTDEQAIVDVVSNRSNDQRQQIKAAFKTMYGKDLIKDLKSELSGNMEELILALFMPST---YYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIRDIVRCYQLEFGRDLEKDIRSDTSGHFERLLVSMCQGN 305          
BLAST of Annexin vs. Ensembl Mouse
Match: Anxa7 (annexin A7 [Source:MGI Symbol;Acc:MGI:88031])

HSP 1 Score: 292.738 bits (748), Expect = 2.226e-94
Identity = 157/326 (48.16%), Postives = 216/326 (66.26%), Query Frame = 3
Query:  108 KGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPD-YYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFV 1082
            +GTI P  NF A +D E+L+KAMKG GTDE+AIV+ +  RS  QR +IK  +KTM+GKDLI DLKSELSGN  + +  +LF P  YYDA SL  AM+GAGT+E VL EIL +RTN++I +I   Y+  +  +LE++I S+TSG F+R+LVS  Q N+ E              +  V+   A+++AQ LY AGE +LGTDE+ F  I   R+  QL+AT + Y +++ +D+  S+  E SG   S +K I   A+N P +FA RLY +MKGAGT D+TL RI+++RSEIDL  IK  F++ Y++TL + +  DTSGDY+  LL  V
Sbjct:  173 QGTILPASNFDAMRDAEILRKAMKGFGTDEQAIVDVVSNRSNDQRQQIKAAFKTMYGKDLIKDLKSELSGNMEELI-LALFMPSTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIRDIVRCYQLEFGRDLEKDIRSDTSGHFERLLVSMCQGNRDE--------------RQSVNHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLKATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYSMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFTQMYQKTLSTMIASDTSGDYRKLLLAIV 483          

HSP 2 Score: 69.3218 bits (168), Expect = 2.519e-12
Identity = 41/142 (28.87%), Postives = 73/142 (51.41%), Query Frame = 3
Query:  666 ELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            E+     K  GTDE   + +   R+  Q +     ++ + GKD+ + + +E+SG+    I A+   +    +Y A  L  AM+GAGT +  L  IL +R+  ++ +I   +  E+ + LE  ++ DTSG ++  L+   QGN
Sbjct:  189 EILRKAMKGFGTDEQAIVDVVSNRSNDQRQQIKAAFKTMYGKDLIKDLKSELSGNMEELILALFMPST---YYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIRDIVRCYQLEFGRDLEKDIRSDTSGHFERLLVSMCQGN 327          
BLAST of Annexin vs. Ensembl Mouse
Match: Anxa4 (annexin A4 [Source:MGI Symbol;Acc:MGI:88030])

HSP 1 Score: 286.189 bits (731), Expect = 5.469e-94
Identity = 158/334 (47.31%), Postives = 207/334 (61.98%), Query Frame = 3
Query:   90 AKGEKYKGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            AKG    GT+K    F+A +D + L+KAMKG+GTDE AI+  L  R+ +QR EI+  YK+  G+DLI DLKSELS NF Q +   +     YD   L  AMKGAGT E  L EIL SRT ++I  I   Y++ Y   LEE+I S+TS  F+RVLVS   A + E ++ D   +              KQ+AQELY AGEK+ GTDE  F+ I C RN+  L   FDEY++IS KDI +SI +E SG F  ++ AI     + P YFA RLY +MKG GT D TL R+++SR+EID+ +I+A F R Y ++L SF+K DTSGDY+  LL    G+
Sbjct:    3 AKG----GTVKAASGFNATEDAQTLRKAMKGLGTDEDAIIGILAYRNTAQRQEIRSAYKSTIGRDLIEDLKSELSSNFEQVILGLMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRINQTYQQQYGRSLEEDICSDTSFMFQRVLVSLSAAGRDEGNYLDDALM--------------KQDAQELYEAGEKRWGTDEVKFLSILCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRSKPSYFAERLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRASFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGD 318          
BLAST of Annexin vs. Ensembl Mouse
Match: Anxa4 (annexin A4 [Source:MGI Symbol;Acc:MGI:88030])

HSP 1 Score: 286.189 bits (731), Expect = 5.469e-94
Identity = 158/334 (47.31%), Postives = 207/334 (61.98%), Query Frame = 3
Query:   90 AKGEKYKGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            AKG    GT+K    F+A +D + L+KAMKG+GTDE AI+  L  R+ +QR EI+  YK+  G+DLI DLKSELS NF Q +   +     YD   L  AMKGAGT E  L EIL SRT ++I  I   Y++ Y   LEE+I S+TS  F+RVLVS   A + E ++ D   +              KQ+AQELY AGEK+ GTDE  F+ I C RN+  L   FDEY++IS KDI +SI +E SG F  ++ AI     + P YFA RLY +MKG GT D TL R+++SR+EID+ +I+A F R Y ++L SF+K DTSGDY+  LL    G+
Sbjct:    3 AKG----GTVKAASGFNATEDAQTLRKAMKGLGTDEDAIIGILAYRNTAQRQEIRSAYKSTIGRDLIEDLKSELSSNFEQVILGLMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRINQTYQQQYGRSLEEDICSDTSFMFQRVLVSLSAAGRDEGNYLDDALM--------------KQDAQELYEAGEKRWGTDEVKFLSILCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRSKPSYFAERLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRASFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGD 318          
BLAST of Annexin vs. UniProt/SwissProt
Match: sp|P20072|ANXA7_BOVIN (Annexin A7 OS=Bos taurus OX=9913 GN=ANXA7 PE=1 SV=2)

HSP 1 Score: 297.36 bits (760), Expect = 1.438e-95
Identity = 159/325 (48.92%), Postives = 218/325 (67.08%), Query Frame = 3
Query:  111 GTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPD-YYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFV 1082
            GTI+P  NF A +D EVL+KAMKG GTDE+AI++ +  RS  QR +IK  +KTM+GKDLI DLKSELSGN  + +  +LF P  YYDA SL +AMKGAGT+E VL EIL +RTN++I  I   Y+  +  +LE++I S+TSG F+R+LVS  Q N+     D+ Q ++            A+++AQ LY AGE +LGTDE+ F  I   R+  QL+AT + Y +++ +D+  S+  E SG+  S +K I   A+N P +FA RLY +MKGAGT D+TL RI+++RSEIDL  IK  FS+ Y++TL + +  DTSGDY+  LL  V
Sbjct:  152 GTIRPAANFDAMRDAEVLRKAMKGFGTDEQAIIDVVANRSNDQRQKIKAAFKTMYGKDLIKDLKSELSGNMEELI-LALFMPSTYYDAWSLRNAMKGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGNR-----DENQNVNHQ---------LAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLKATMEAYSRMANRDLLNSVSREFSGNVESGLKTILQCALNRPAFFAERLYYSMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFSQMYQKTLGTMIASDTSGDYRKLLLAIV 461          

HSP 2 Score: 74.3294 bits (181), Expect = 4.302e-13
Identity = 43/135 (31.85%), Postives = 71/135 (52.59%), Query Frame = 3
Query:  687 KKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            K  GTDE   I +   R+  Q +     ++ + GKD+ + + +E+SG+    I A+   +    +Y A  L NAMKGAGT +  L  IL +R+  ++  I   +  E+ + LE  ++ DTSG ++  L+   QGN
Sbjct:  174 KGFGTDEQAIIDVVANRSNDQRQKIKAAFKTMYGKDLIKDLKSELSGNMEELILALFMPST---YYDAWSLRNAMKGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGN 305          
BLAST of Annexin vs. UniProt/SwissProt
Match: sp|P20073|ANXA7_HUMAN (Annexin A7 OS=Homo sapiens OX=9606 GN=ANXA7 PE=1 SV=3)

HSP 1 Score: 296.204 bits (757), Expect = 7.712e-95
Identity = 156/325 (48.00%), Postives = 213/325 (65.54%), Query Frame = 3
Query:  108 KGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFV 1082
            +GTI+P  NF A +D E+L+KAMKG GTDE+AIV+ +  RS  QR +IK  +KT +GKDLI DLKSELSGN  + +      P YYDA SL  AM+GAGT+E VL EIL +RTN++I  I   Y+  +  +LE++I S+TSG F+R+LVS  Q N+     D+ Q ++            A+++AQ LY AGE +LGTDE+ F  I   R+  QLRAT + Y +++ +D+  S+  E SG   S +K I   A+N P +FA RLY AMKGAGT D+TL RI+++RSEIDL  IK  F++ Y++TL + +  DTSGDY+  LL  V
Sbjct:  176 QGTIRPAANFDAIRDAEILRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTSYGKDLIKDLKSELSGNMEELILALFMPPTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGNR-----DENQSINHQ---------MAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYAMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTLGTMIAGDTSGDYRRLLLAIV 486          

HSP 2 Score: 67.0106 bits (162), Expect = 9.746e-11
Identity = 41/142 (28.87%), Postives = 70/142 (49.30%), Query Frame = 3
Query:  666 ELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            E+     K  GTDE   + +   R+  Q +     ++   GKD+ + + +E+SG+    I A+        +Y A  L  AM+GAGT +  L  IL +R+  ++  I   +  E+ + LE  ++ DTSG ++  L+   QGN
Sbjct:  192 EILRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTSYGKDLIKDLKSELSGNMEELILALFMPPT---YYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGN 330          
BLAST of Annexin vs. UniProt/SwissProt
Match: sp|Q4R5L5|ANXA7_MACFA (Annexin A7 OS=Macaca fascicularis OX=9541 GN=ANXA7 PE=2 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 3.796e-94
Identity = 155/325 (47.69%), Postives = 213/325 (65.54%), Query Frame = 3
Query:  108 KGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFV 1082
            +GTI+P  NF A +D E+L+KAMKG GTDE+AIV+ +  RS  QR +IK  +KT +GKDLI DLKSELSGN  + +      P YYDA +L  AM+GAGT+E VL EIL +RTN++I  I   Y+  +  +LE++I S+TSG F+R+LVS  Q N+     D+ Q ++            A+++AQ LY AGE +LGTDE+ F  I   R+  QLRAT + Y +++ +D+  S+  E SG   S +K I   A+N P +FA RLY AMKGAGT D+TL RI+++RSEIDL  IK  F++ Y++TL + +  DTSGDY+  LL  V
Sbjct:  176 QGTIRPAANFDAMRDAEILRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTSYGKDLIKDLKSELSGNMEELILALFMPPTYYDAWTLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGNR-----DENQSVNHQ---------MAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYAMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTLGTMIAGDTSGDYRRPLLAIV 486          

HSP 2 Score: 67.0106 bits (162), Expect = 1.085e-10
Identity = 40/135 (29.63%), Postives = 68/135 (50.37%), Query Frame = 3
Query:  687 KKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            K  GTDE   + +   R+  Q +     ++   GKD+ + + +E+SG+    I A+        +Y A  L  AM+GAGT +  L  IL +R+  ++  I   +  E+ + LE  ++ DTSG ++  L+   QGN
Sbjct:  199 KGFGTDEQAIVDVVANRSNDQRQKIKAAFKTSYGKDLIKDLKSELSGNMEELILALFMPPT---YYDAWTLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGN 330          
BLAST of Annexin vs. UniProt/SwissProt
Match: sp|Q07076|ANXA7_MOUSE (Annexin A7 OS=Mus musculus OX=10090 GN=Anxa7 PE=1 SV=2)

HSP 1 Score: 292.738 bits (748), Expect = 6.680e-94
Identity = 157/326 (48.16%), Postives = 216/326 (66.26%), Query Frame = 3
Query:  108 KGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPD-YYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFV 1082
            +GTI P  NF A +D E+L+KAMKG GTDE+AIV+ +  RS  QR +IK  +KTM+GKDLI DLKSELSGN  + +  +LF P  YYDA SL  AM+GAGT+E VL EIL +RTN++I +I   Y+  +  +LE++I S+TSG F+R+LVS  Q N+ E              +  V+   A+++AQ LY AGE +LGTDE+ F  I   R+  QL+AT + Y +++ +D+  S+  E SG   S +K I   A+N P +FA RLY +MKGAGT D+TL RI+++RSEIDL  IK  F++ Y++TL + +  DTSGDY+  LL  V
Sbjct:  151 QGTILPASNFDAMRDAEILRKAMKGFGTDEQAIVDVVSNRSNDQRQQIKAAFKTMYGKDLIKDLKSELSGNMEELI-LALFMPSTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIRDIVRCYQLEFGRDLEKDIRSDTSGHFERLLVSMCQGNRDE--------------RQSVNHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLKATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYSMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFTQMYQKTLSTMIASDTSGDYRKLLLAIV 461          

HSP 2 Score: 69.707 bits (169), Expect = 1.305e-11
Identity = 41/142 (28.87%), Postives = 73/142 (51.41%), Query Frame = 3
Query:  666 ELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            E+     K  GTDE   + +   R+  Q +     ++ + GKD+ + + +E+SG+    I A+   +    +Y A  L  AM+GAGT +  L  IL +R+  ++ +I   +  E+ + LE  ++ DTSG ++  L+   QGN
Sbjct:  167 EILRKAMKGFGTDEQAIVDVVSNRSNDQRQQIKAAFKTMYGKDLIKDLKSELSGNMEELILALFMPST---YYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIRDIVRCYQLEFGRDLEKDIRSDTSGHFERLLVSMCQGN 305          
BLAST of Annexin vs. UniProt/SwissProt
Match: sp|P97429|ANXA4_MOUSE (Annexin A4 OS=Mus musculus OX=10090 GN=Anxa4 PE=1 SV=4)

HSP 1 Score: 286.189 bits (731), Expect = 3.825e-93
Identity = 158/334 (47.31%), Postives = 207/334 (61.98%), Query Frame = 3
Query:   90 AKGEKYKGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            AKG    GT+K    F+A +D + L+KAMKG+GTDE AI+  L  R+ +QR EI+  YK+  G+DLI DLKSELS NF Q +   +     YD   L  AMKGAGT E  L EIL SRT ++I  I   Y++ Y   LEE+I S+TS  F+RVLVS   A + E ++ D   +              KQ+AQELY AGEK+ GTDE  F+ I C RN+  L   FDEY++IS KDI +SI +E SG F  ++ AI     + P YFA RLY +MKG GT D TL R+++SR+EID+ +I+A F R Y ++L SF+K DTSGDY+  LL    G+
Sbjct:    3 AKG----GTVKAASGFNATEDAQTLRKAMKGLGTDEDAIIGILAYRNTAQRQEIRSAYKSTIGRDLIEDLKSELSSNFEQVILGLMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRINQTYQQQYGRSLEEDICSDTSFMFQRVLVSLSAAGRDEGNYLDDALM--------------KQDAQELYEAGEKRWGTDEVKFLSILCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRSKPSYFAERLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRASFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGD 318          
BLAST of Annexin vs. TrEMBL
Match: A0A1S3JHE8 (Annexin OS=Lingula unguis OX=7574 GN=LOC106173262 PE=3 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 1.755e-108
Identity = 170/339 (50.15%), Postives = 242/339 (71.39%), Query Frame = 3
Query:   84 IGAKGEKYKGTIKP--FPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPD-YYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            IG   E++ GTI P  + +F AE+D EVL+KAMKG+GTDE+AI+  L +RS  QR EI+K +KTM+GKDLI +L+SELSG+  +A+   LF+P+ YYDA SL +AM G GT+E+VL EIL +RTN QI+ I   YK  +  +LE +I+ +TSG FKR+L+SC Q N+ EL+    Q++   GP+AV+    A+++A+EL+ AGEK+LGTDE+ F++I   RN YQ+RATF+EY K+SG DI ++I +EMSG    +  A+     + P +FAT+L+ AM+G GT D+TL RI++SRSE+DL+NIK  F R+Y + L   V+ +TSGDY+  +L  + GN
Sbjct:  290 IGGTAEQFVGTIHPANYMSFSAEKDAEVLRKAMKGLGTDEQAIIGVLSKRSNQQRQEIEKMFKTMYGKDLIRELESELSGDLKEAI-MGLFKPNAYYDAWSLHNAMVGLGTKESVLIEILCTRTNAQIKQIVQAYKDHFKRDLERDIMDDTSGHFKRLLISCCQGNRAELTDAQWQQVFSSGPEAVIDRALARRDAEELFRAGEKQLGTDESTFLRIMATRNYYQMRATFEEYAKVSGHDILQAISSEMSGSLEDAFTALVMSCRDRPEFFATKLHKAMQGLGTDDSTLIRIIVSRSEVDLQNIKQAFLRKYGKPLMKMVEGETSGDYRRLMLALIGGN 627          
BLAST of Annexin vs. TrEMBL
Match: A0A2T7PZC2 (Annexin OS=Pomacea canaliculata OX=400727 GN=C0Q70_01396 PE=3 SV=1)

HSP 1 Score: 339.347 bits (869), Expect = 4.221e-108
Identity = 162/326 (49.69%), Postives = 234/326 (71.78%), Query Frame = 3
Query:  105 YKGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFV 1082
            ++ T+   PNF AE+D E L+K+MKG GTDE+ I+  +G+R  +QR EI K YKTM+G+DLIADL+SELSGNF + +      P YYDA SL HAM+G GT+E+VL EIL +R+N+QI +I   YK+ +  +LE++I  +TSG FK++L+SC Q N+ EL+ + + ++   G  AVV+   A+Q+AQ+L  AG K LGTDE+ FI +  +R+ YQL+ATF EY+K++GKDI +SI +E SGDF + ++AI   A N P YFA +L++++KG GT D+ L RI++SR EIDL++IK  +  +Y++TL+S V  DTSGDY+  LL  +
Sbjct:  245 FRPTVVASPNFSAERDSETLRKSMKGAGTDERTIIGIIGKRCNTQRQEIAKIYKTMYGRDLIADLESELSGNFRETIMGMFKPPAYYDAWSLNHAMEGLGTKESVLIEILCTRSNQQIRDIVACYKEHFKRDLEKDISDDTSGHFKKLLISCCQGNRQELTPEQLSQVRSQGASAVVNAELARQDAQKLQEAGIKHLGTDESTFISVLALRHMYQLQATFSEYQKLTGKDILDSISSETSGDFETGLRAIVRSAKNRPEYFADKLHDSIKGLGTDDSRLIRIIVSRCEIDLQDIKDAYLTKYQKTLDSEVASDTSGDYKRILLALI 570          

HSP 2 Score: 83.9593 bits (206), Expect = 1.057e-13
Identity = 51/158 (32.28%), Postives = 80/158 (50.63%), Query Frame = 3
Query:  621 PKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYF-ATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            P  V S N + +   E      K  GTDE   I I   R   Q +     Y+ + G+D+   +++E+SG+FR +I  +       P Y+ A  L +AM+G GT ++ L  IL +RS   + +I A +   +K+ LE  + DDTSG ++  L+   QGN
Sbjct:  247 PTVVASPNFSAERDSETLRKSMKGAGTDERTIIGIIGKRCNTQRQEIAKIYKTMYGRDLIADLESELSGNFRETIMGM----FKPPAYYDAWSLNHAMEGLGTKESVLIEILCTRSNQQIRDIVACYKEHFKRDLEKDISDDTSGHFKKLLISCCQGN 400          
BLAST of Annexin vs. TrEMBL
Match: A0A1S3JHA6 (Annexin OS=Lingula unguis OX=7574 GN=LOC106173262 PE=3 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 5.200e-108
Identity = 170/339 (50.15%), Postives = 242/339 (71.39%), Query Frame = 3
Query:   84 IGAKGEKYKGTIKP--FPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPD-YYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            IG   E++ GTI P  + +F AE+D EVL+KAMKG+GTDE+AI+  L +RS  QR EI+K +KTM+GKDLI +L+SELSG+  +A+   LF+P+ YYDA SL +AM G GT+E+VL EIL +RTN QI+ I   YK  +  +LE +I+ +TSG FKR+L+SC Q N+ EL+    Q++   GP+AV+    A+++A+EL+ AGEK+LGTDE+ F++I   RN YQ+RATF+EY K+SG DI ++I +EMSG    +  A+     + P +FAT+L+ AM+G GT D+TL RI++SRSE+DL+NIK  F R+Y + L   V+ +TSGDY+  +L  + GN
Sbjct:  330 IGGTAEQFVGTIHPANYMSFSAEKDAEVLRKAMKGLGTDEQAIIGVLSKRSNQQRQEIEKMFKTMYGKDLIRELESELSGDLKEAI-MGLFKPNAYYDAWSLHNAMVGLGTKESVLIEILCTRTNAQIKQIVQAYKDHFKRDLERDIMDDTSGHFKRLLISCCQGNRAELTDAQWQQVFSSGPEAVIDRALARRDAEELFRAGEKQLGTDESTFLRIMATRNYYQMRATFEEYAKVSGHDILQAISSEMSGSLEDAFTALVMSCRDRPEFFATKLHKAMQGLGTDDSTLIRIIVSRSEVDLQNIKQAFLRKYGKPLMKMVEGETSGDYRRLMLALIGGN 667          
BLAST of Annexin vs. TrEMBL
Match: A0A5J4P079 (Annexin OS=Paragonimus westermani OX=34504 GN=DEA37_0014028 PE=3 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 1.355e-103
Identity = 165/326 (50.61%), Postives = 222/326 (68.10%), Query Frame = 3
Query:  105 YKGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFV 1082
            ++ ++KP  NF+A  DCE+L+KAMKGIGTDE AI+  +GRRS +QR  I   +KTM+GKDLI + KSELSG+F+  V+   + P+ +DA  L+ AMKG GT E+ L EIL SRTN+QI  IK  + KLY  +LE+ +VSETS  FKRVLVS LQA++ E             P   V +  AK EA++LY AGEK+LGTDE+ F+ I C R+  QLRA FDEY+K++  DI +++++EMSGD  ++  AI   A N P YFA  L  +MKG GT+D  L RI++SR EID+E IK EF   Y ++L +++KDDTSGDY+  LL  +
Sbjct:   22 FEPSLKPVTNFNASTDCELLRKAMKGIGTDEDAIINIMGRRSATQRNAIVAQFKTMYGKDLINEFKSELSGHFYDCVKALCYLPEEFDAVQLYEAMKGVGTDEDTLIEILCSRTNRQIVKIKEAFTKLYQKDLEKEVVSETSRHFKRVLVSLLQASRDE------------NPN--VDLYAAKSEAEKLYKAGEKRLGTDESQFLSILCTRSYEQLRAIFDEYKKLTKHDIEQALESEMSGDLLNAFMAIVSCARNKPRYFAQLLEKSMKGLGTSDQMLIRIVVSRCEIDMERIKKEFQTAYGKSLATWIKDDTSGDYERLLLTLI 333          

HSP 2 Score: 78.1814 bits (191), Expect = 3.644e-12
Identity = 53/153 (34.64%), Postives = 79/153 (51.63%), Query Frame = 3
Query:  666 ELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYF-ATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQG--N*KLNVDEY 1115
            EL     K +GTDE   I I   R+  Q  A   +++ + GKD+     +E+SG F   +KA+ +     P  F A +LY AMKG GT + TL  IL SR+   +  IK  F++ Y++ LE  V  +TS  ++  L+  +Q   +   NVD Y
Sbjct:   39 ELLRKAMKGIGTDEDAIINIMGRRSATQRNAIVAQFKTMYGKDLINEFKSELSGHFYDCVKALCY----LPEEFDAVQLYEAMKGVGTDEDTLIEILCSRTNRQIVKIKEAFTKLYQKDLEKEVVSETSRHFKRVLVSLLQASRDENPNVDLY 187          
BLAST of Annexin vs. TrEMBL
Match: A0A210QSV8 (Annexin OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05600 PE=3 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 1.704e-103
Identity = 171/336 (50.89%), Postives = 230/336 (68.45%), Query Frame = 3
Query:   87 GAKGEKYKGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEP-DYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            G +GE  + T++P   F  EQD E+L+KAMKG GTDEKAI+  +  R+  QR +I   +KTM+GKDLIADLKSELSG+  + +   +F+P  Y+DA SL  AM   GT+E VL EIL +R+N +I+ I   YKK +S  LE++I SETSG FKR+L+SC Q N+ EL+ D  Q+L   G + VV    A+Q+AQ+LY AGEK +GTDE+ F+ +  +RN YQLRATF EY+KISGKDI +S+ +E SGD     KA+   A+N P YFA  L+ +M G GT D+TL RI++SRSEIDL++IK E+   + +TL + V  DT GDY+  LL  + GN
Sbjct:  293 GGQGEVARPTVRPAKPFSPEQDAEILRKAMKGFGTDEKAIISVISARTNQQRQQILTMFKTMYGKDLIADLKSELSGDLEELI-MGMFKPTTYFDAWSLHKAMTCVGTKEAVLIEILCTRSNAEIKEIVECYKKHFSRSLEQDISSETSGHFKRLLISCCQGNRNELTPDQQQRLAYQGLEGVVDRALAQQDAQKLYQAGEKMIGTDESAFLTVMAVRNHYQLRATFQEYQKISGKDILKSVKSEFSGDVEDGFKALISSAMNRPKYFADLLHKSMAGLGTKDSTLIRIIVSRSEIDLQDIKEEYLVHHHKTLRTAVAGDTRGDYEKLLLALI-GN 626          
BLAST of Annexin vs. Ensembl Cavefish
Match: ENSAMXT00000004530.2 (annexin A11-like [Source:NCBI gene;Acc:103040502])

HSP 1 Score: 296.975 bits (759), Expect = 2.931e-96
Identity = 159/336 (47.32%), Postives = 211/336 (62.80%), Query Frame = 3
Query:   84 IGAKGEKYKGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            I A    ++GTIK +P     +D EVL+KAMKG GTDE AI+E LG RS  QR  + + YKT +GKDLI+DLKSEL+GNF   V   +  P  YDA+ L  ++ GAGT E  L EIL+SR+N +I  I  +YK  Y   LE+ I  +TSG F+R+LVS  Q N+ E              +  V +  AKQ+AQ+LY AGE KLGTDE+ F  I C R+K  LR  F EY+++ GKDI +SI  EMSGD    + A+     NTP YFA RL  AMKGAGT D TL RI+++RSE+D+ +I+ E+ R + ++L + +  DTSGDY+  LL+   G+
Sbjct:  159 IPAVNRGFRGTIKDYPGADPLRDVEVLRKAMKGFGTDENAIIELLGNRSGKQRAPLVRAYKTTYGKDLISDLKSELTGNFEALVLAMVKGPAEYDAYELHSSIAGAGTDEACLIEILSSRSNAEIREINQIYKTEYKKTLEDAIQHDTSGHFRRLLVSLCQGNRDE--------------RETVDVALAKQDAQKLYAAGENKLGTDESQFNAILCARSKPHLRQVFQEYQQMCGKDIEKSICREMSGDLERGLLAVVKCLKNTPGYFAERLNKAMKGAGTKDRTLIRIMVTRSEVDMLDIRQEYIRNFGKSLYTDISSDTSGDYKKLLLKLCGGS 480          
BLAST of Annexin vs. Ensembl Cavefish
Match: anxa11a (annexin A11 [Source:NCBI gene;Acc:103039162])

HSP 1 Score: 295.819 bits (756), Expect = 2.788e-95
Identity = 156/329 (47.42%), Postives = 211/329 (64.13%), Query Frame = 3
Query:  105 YKGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            ++G+I   P     +D EVL+KAMKG GTDE+AI+  LG RS  QR+ +  +YKT +GKDL+ DLKSELSGNF + V   L  P  YDA  L  A+KGAGT E  L EIL+SR+N +I  I  ++K  Y   LE++I  +TSG F+R+LVS  Q N+ E  +              V I  AKQ+AQ LY AGE KLGTDE+ F  I C R+K  LRA F+EY+ + G+DI +SI+ EMSGD  + + A+     +TP YFA RLY AMKG GT D TL RI++SRSE+D+ +I+  + ++Y ++L + +  DTSGDY+  LL+   G+
Sbjct:  211 FRGSIPDCPGADPLKDAEVLRKAMKGFGTDEQAIINLLGSRSNKQRVPLLISYKTAYGKDLVKDLKSELSGNFEKLVLAMLKTPAQYDASELREAIKGAGTDEACLIEILSSRSNAEIREINQIFKAEYKKSLEDSISGDTSGHFRRLLVSLAQGNRDEREN--------------VDIALAKQDAQTLYQAGENKLGTDESKFNAILCARSKPHLRAVFNEYQHMCGRDIEKSIEREMSGDLENGMLAVVKCIKDTPTYFAERLYKAMKGLGTKDRTLIRIMVSRSEVDMLDIRQAYVKKYGKSLYTDISGDTSGDYKKLLLKLCGGS 525          
BLAST of Annexin vs. Ensembl Cavefish
Match: anxa4 (annexin A4 [Source:NCBI gene;Acc:103027730])

HSP 1 Score: 280.796 bits (717), Expect = 5.626e-92
Identity = 151/325 (46.46%), Postives = 204/325 (62.77%), Query Frame = 3
Query:  108 KGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFV 1082
            +GT+     F+ +QD E L+KAMKG GTDE AI+  L  R+I+QR  IK++YK   GK+L  DLKSEL+GNF + V   L     YDA+ L +A+KGAGT E  L EIL SRT  ++  +   Y K Y   LE+++  +TSG FKRVLVS L A + E +  D Q L             A Q+A+E+Y AGE   GTDE  F+ + C+RN+  L   F+EY++ISG+DI +SI  EMSG       AI     + P +FA RL+ +MKG GTTD+ L R+++SRSEID+++IKAEF + Y ++L SF+K DTSGDY+  LL   
Sbjct:    7 RGTVTEAAGFNPDQDAEALRKAMKGAGTDEAAIISILPHRTIAQRQLIKESYKRAVGKELADDLKSELTGNFEKVVIGLLMTAPVYDAYELRNAIKGAGTDEACLIEILASRTISEMRTLVATYNKEYGKSLEDDVCGDTSGMFKRVLVSLLTAGRDESNTVD-QAL-------------AAQDAKEIYEAGEAHWGTDEVKFLTVLCVRNRNHLLKVFEEYKRISGRDIEDSIKREMSGCLEEVFLAIVRCIKSKPGFFAERLHKSMKGLGTTDSILIRVMVSRSEIDMQDIKAEFLKTYGKSLHSFIKGDTSGDYRKILLELC 317          
BLAST of Annexin vs. Ensembl Cavefish
Match: anxa5b (annexin A5-like [Source:NCBI gene;Acc:103025290])

HSP 1 Score: 278.87 bits (712), Expect = 2.513e-91
Identity = 156/328 (47.56%), Postives = 199/328 (60.67%), Query Frame = 3
Query:  108 KGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            +GT+KP   F A +D EVL KAMKG+GTDE  I++ L  RS +QR +IK  YKT+ GKDL+ DLKSEL G F   V   +  P  +D  +L +A+KGAGT E  L EIL SRT  +I  I   YK+ Y   LE+++  +TSG FKRVLV  LQAN+ +                 V     + +AQ L+NAGEKK GTDE  FI I   R+   LR  FD Y K+SG  I ESI  E SG  R  + AI   A + P YFA  LYN+MKGAGT D TL RI++SRSEIDL +I+AEF + +  +L   +++DTSGDY+  LL    G+
Sbjct:    4 RGTVKPQSGFDANKDAEVLFKAMKGLGTDEATILQLLTSRSNAQRQQIKTAYKTLHGKDLVNDLKSELGGKFEDLVVGLMATPVMFDVTTLRNAIKGAGTNEKALIEILASRTPNEIREIIKTYKQEYDHNLEDDVTGDTSGHFKRVLVILLQANRQQ----------------GVQTGNIQSDAQALFNAGEKKYGTDEDEFITILGNRSAEHLRQVFDAYMKLSGFQIEESIQRETSGGLRDVLLAIVKCARSVPAYFAECLYNSMKGAGTDDATLIRIMVSRSEIDLLDIRAEFRKLFATSLHKMIQNDTSGDYRKTLLLLCAGD 315          
BLAST of Annexin vs. Ensembl Cavefish
Match: ENSAMXT00000004017.2 (annexin A5-like [Source:NCBI gene;Acc:103024763])

HSP 1 Score: 266.159 bits (679), Expect = 2.287e-86
Identity = 149/328 (45.43%), Postives = 194/328 (59.15%), Query Frame = 3
Query:  108 KGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            +GT+KP   F A +D  VL KAMKG+GTDE  I++ L  RS +QR +IK  YKT+ GKDL+ DLKSE+ G F   V   +  P  +D  +L +A+KG GT E  L EIL SRT  +I  I   YK+ Y   LE+++  +T+G FKRVLV  LQAN+ +                 V     + +AQ L+NAGEKK GTDE  FI I   R+   LR  FD Y K+SG  I ESI  E SG  R  + AI   A + P Y A  LYN++KGAGT D TL RI++SRSEIDL +I+AEF + +  +L   +++D SGDY   LL    G+
Sbjct:    4 RGTVKPQSGFDANKDAGVLFKAMKGLGTDEATILQLLTSRSNAQRQQIKTAYKTLHGKDLVNDLKSEMGGKFEDLVVGLMATPVMFDVTTLRNAIKGTGTNEKTLIEILASRTPNEIREIIKTYKQEYDHNLEDDVTGDTTGHFKRVLVVLLQANRQQ----------------GVQTGNIQSDAQALFNAGEKKYGTDEDEFITILGNRSAEHLRQVFDAYMKLSGFQIEESIQKETSGGTRDILLAIVKCARSVPAYLAECLYNSLKGAGTDDATLMRIMVSRSEIDLLDIRAEFRKSFATSLHKMIQNDVSGDYCKTLLLLCAGD 315          
BLAST of Annexin vs. Ensembl Sea Lamprey
Match: ANXA7 (annexin A7 [Source:HGNC Symbol;Acc:HGNC:545])

HSP 1 Score: 297.36 bits (760), Expect = 2.341e-97
Identity = 162/329 (49.24%), Postives = 219/329 (66.57%), Query Frame = 3
Query:  108 KGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEP-DYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            +GT+KP  NF+ + DCE+L+KAMKG+GT+E+ +++ +  RS +QR +IK T+KTM+GKDLI DL+SELSGN F+ +  +LF P  YYDA SL  A++GAGT E VL EIL SRTN++I +I   YK  +  +LE++I S+TSG FKR+L+S  Q N+ E                 V +  A  +AQ+L +AGE KLGTDE+ F  I  +R+  QL+ATF EY K+S +DI  +ID E SG+ +  +KAI   A N P +FA RLY AMKG GT D+TL RI+ SRSEIDL N+K  F  +Y +TL   ++ DTSGDY+  L   V  N
Sbjct:  147 QGTVKPIGNFNVQDDCEMLRKAMKGLGTNEQVLMDLVVNRSNAQRQKIKLTFKTMYGKDLIRDLRSELSGN-FEEIMLALFMPTTYYDAWSLQKAIQGAGTNEKVLVEILCSRTNQEIRDIVSCYKDEFGRDLEKDIKSDTSGHFKRLLISMCQGNRDE--------------SLSVDLALALSDAQKLQSAGEGKLGTDESAFNMILAVRSFPQLQATFQEYIKLSQRDIINTIDREFSGNVKDGLKAIVQCAKNRPVFFAERLYEAMKGGGTDDSTLIRIVTSRSEIDLVNVKHAFLEKYNKTLYKMIEGDTSGDYKRMLQAIVGQN 460          
BLAST of Annexin vs. Ensembl Sea Lamprey
Match: ANXA7 (annexin A7 [Source:HGNC Symbol;Acc:HGNC:545])

HSP 1 Score: 295.434 bits (755), Expect = 1.479e-95
Identity = 156/329 (47.42%), Postives = 227/329 (69.00%), Query Frame = 3
Query:  108 KGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEP-DYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            +GTI    NF+A+ D EVL++AMKG+GTDE+A+++ +  RS  QR +IK  +KTM+GKDLI DL+SELSGNF + +  +LF P  YYDA SL  A+KGAGT E VL EI+ +RTN++I+ I  +Y++ ++  LE++I S+TSG FKR+L+S  Q N+     D+ Q          V +++A+ +AQ LY AGE KLGTDE+ F  I   R+  QL+ATF+EY +++ +DI  +ID E SGD R  ++AI     + P YFA RL+++MKG GT D+ L R+++SRSEIDL++IK  F ++Y++TL + ++ DTSGDY+  L+  V  N
Sbjct:  231 RGTIHTASNFNAQDDAEVLRRAMKGLGTDERALIDIIVNRSNDQRQKIKLAFKTMYGKDLIRDLRSELSGNFEEII-LALFMPTTYYDAWSLMKAIKGAGTDEKVLIEIMCTRTNQEIKEIVRVYREEFNRTLEKDIRSDTSGHFKRLLISMCQGNR-----DESQ---------TVDMSKAQSDAQRLYTAGEGKLGTDESTFNMILACRSFPQLQATFNEYTRMAQRDIVNTIDREFSGDIRDGMRAIVQCVRSRPAYFAERLFHSMKGLGTDDSGLIRVIVSRSEIDLQDIKQAFLQQYQKTLYTMIQGDTSGDYKRILVAIVGMN 544          
BLAST of Annexin vs. Ensembl Sea Lamprey
Match: ANXA11 (annexin A11 [Source:HGNC Symbol;Acc:HGNC:535])

HSP 1 Score: 265.774 bits (678), Expect = 1.027e-84
Identity = 150/336 (44.64%), Postives = 207/336 (61.61%), Query Frame = 3
Query:   87 GAKGEKY-KGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            G  G+K  +GT+K    F+A +D E L+KAMKG GTDEKAI++ L  RS  QR EI  ++KT +GKDL+ +LKSELSGNF   V   L  P  YD   +  A+KGAGT E  L EIL SR+NK+I  I   YK +    LE++I+S+TS  FKR+LV+  Q  + E +  D+ ++              +++AQ+L  AGE ++GTDE+ F  I C R++  L   F+EY +IS  DI +SI  EMSG     + A+     NT  +FA RLY +MKG GT D+TL RI++SR E+DL +I+ EF + Y ++L SF+  DTSGDY+  LL    G+
Sbjct:  168 GPSGQKKGRGTVKEQSGFNALKDAETLRKAMKGFGTDEKAIIDVLTARSNKQRQEIALSFKTAYGKDLVKELKSELSGNFELVVVALLETPTQYDVSQIQAAIKGAGTDEECLIEILASRSNKEIHEINKHYKSVTKRSLEQDIMSDTSANFKRLLVALCQGGRDESTTVDMARV--------------QKDAQDLLAAGENRIGTDESRFNSILCGRSQAHLLRVFEEYGRISKHDIEKSIKREMSGSLEDGMVAVVKCLRNTQGFFAERLYKSMKGLGTKDSTLIRIMVSRCEVDLFDIRREFKQLYGKSLHSFIAGDTSGDYKKILLSLCGGD 489          
BLAST of Annexin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001517.1 (pep scaffold:Pmarinus_7.0:GL476341:319620:335761:1 gene:ENSPMAG00000001365.1 transcript:ENSPMAT00000001517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 257.684 bits (657), Expect = 7.887e-84
Identity = 138/324 (42.59%), Postives = 200/324 (61.73%), Query Frame = 3
Query:  114 TIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQ 1085
            TI P+ +F A +D + L+KA KG+GTDE  I+E L  R+  QR +IK+ YK  +G DL+  LK EL G+F + V   +  P  YDA  L  AMKGAGT E+VL EIL +RTNKQI+ ++ +Y +L+  +LE ++ SETSG  +++L++ +Q N+ E +               V+++ A  +A+EL+ AG+   GTDE  F  +   RN  QLRATF  Y+   G+DI + + +E SG  + +  AI   A++   YFA +LY +MKG GT D TL R ++SRS+IDL  IK  F ++Y++TL SFV  D SGDY+  LL  + 
Sbjct:    7 TIHPYADFDAAKDAKDLRKACKGLGTDEDKIIEILANRTAKQRHQIKEEYKRSYGDDLVEVLKGELKGDFEKVVLALMDLPAVYDAKELRKAMKGAGTDEDVLVEILCTRTNKQIQKMRFVYNELFDRDLESDLKSETSGAVEKLLIALVQGNRDETTD--------------VNMSLANSDAKELHEAGKGHWGTDELAFNSVLATRNMMQLRATFKAYKTNYGEDIEDVVKSETSGMLQDAYLAIVHCAMDAQEYFAKKLYKSMKGTGTDDDTLIRCIVSRSQIDLGTIKETFQQKYEKTLASFVAGDCSGDYKKILLAVIH 316          

HSP 2 Score: 77.7962 bits (190), Expect = 2.656e-16
Identity = 51/149 (34.23%), Postives = 81/149 (54.36%), Query Frame = 3
Query:  648 AKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTP-FYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            A ++A++L  A  K LGTDE   I+I   R   Q     +EY++  G D+ E +  E+ GDF   + A+    ++ P  Y A  L  AMKGAGT +  L  IL +R+   ++ ++  ++  + + LES +K +TSG  +  L+  VQGN
Sbjct:   16 AAKDAKDLRKAC-KGLGTDEDKIIEILANRTAKQRHQIKEEYKRSYGDDLVEVLKGELKGDFEKVVLAL----MDLPAVYDAKELRKAMKGAGTDEDVLVEILCTRTNKQIQKMRFVYNELFDRDLESDLKSETSGAVEKLLIALVQGN 159          
BLAST of Annexin vs. Ensembl Sea Lamprey
Match: anxa2a (annexin A2a [Source:ZFIN;Acc:ZDB-GENE-030131-4282])

HSP 1 Score: 191.045 bits (484), Expect = 1.038e-57
Identity = 118/323 (36.53%), Postives = 188/323 (58.20%), Query Frame = 3
Query:  105 YKGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVN-TPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFL 1070
            Y  T+KP+PNF+A  D   L+KA+   G DEK I+  L  R+ +QR EI K+YK    KDL  DLK  LSG+    +   L  P  YDAH +   ++G GT E  L E+L +R N ++ ++ V YK  +  ++ ++I  +TSG F++++++  +  + E    D  K H+             ++A+EL+ AG K+ GTD   FI I   R+   L+  F+ Y+      I +S + E+ GD R++  ++A +A+N TP +FA +L+++MKG GT D  L  I++SR E+DL +I+ EF ++YK++L S +  DT+GDY+  L
Sbjct:   24 YGPTVKPYPNFNANNDAAALQKAITTKGVDEKTIISILTNRTNTQRQEIIKSYKNATSKDLATDLKGALSGHLETVILGLLMTPAIYDAHIIRQTLQGLGTDEECLIEMLVTRDNLRLRSMAVAYKSEFKSDMMQDIAKDTSGDFQKLVLALAKGARIE----DSTKDHD----------LVDEDARELFEAGVKRKGTDVGKFITIMSQRSFSHLKKVFEAYKSYYPAGIVDSFEKEVGGDLRNAFVSLA-KAINYTPGFFAEKLHDSMKGLGTKDHMLIHIMVSRCELDLLHIRTEFKKKYKKSLYSAIASDTNGDYEVAL 331          

HSP 2 Score: 57.3806 bits (137), Expect = 1.818e-9
Identity = 34/132 (25.76%), Postives = 60/132 (45.45%), Query Frame = 3
Query:  696 GTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTP-FYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQG 1088
            G DE   I I   R   Q +     Y+  + KD+   +   +SG   + I  +    + TP  Y A  +   ++G GT +  L  +L++R  + L ++   +  E+K  +   +  DTSGD+Q  +L   +G
Sbjct:   51 GVDEKTIISILTNRTNTQRQEIIKSYKNATSKDLATDLKGALSGHLETVILGL----LMTPAIYDAHIIRQTLQGLGTDEECLIEMLVTRDNLRLRSMAVAYKSEFKSDMMQDIAKDTSGDFQKLVLALAKG 178          
BLAST of Annexin vs. Ensembl Nematostella
Match: EDO28444 (Annexin [Source:UniProtKB/TrEMBL;Acc:A7T6G0])

HSP 1 Score: 270.011 bits (689), Expect = 1.382e-88
Identity = 145/307 (47.23%), Postives = 199/307 (64.82%), Query Frame = 3
Query:  174 MKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPD-YYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            M+G+GT+E  ++  L  RS +QR+EI+K YKTM+GKDL+ DLKSELSGN  + +  ++ EP   YDA  L   M+GAGT E  L +IL +R+N++IE IK  YK+ Y  +LE++ VSETSG FKR+LVS  Q N+                   V + +A +EAQ+LY AGEKK GTDE+ F  +   R+  QL+ATF+EY KIS +DI  SID EMSGD ++  + I   A N   YFA RL+ +MKGAGT D+ L R+++SRSE+DL  IKA F ++Y +T+   ++ D SGDY+  L+  V  N
Sbjct:    1 MRGMGTNEAELIGILANRSNAQRVEIRKRYKTMYGKDLMNDLKSELSGNLEECLL-AMMEPSVLYDAKCLRRGMRGAGTDEETLIDILCTRSNQEIEAIKREYKEYYKRDLEKDCVSETSGHFKRLLVSMCQGNRD--------------TNMTVDMAKATKEAQDLYKAGEKKWGTDESRFNVVLASRSFPQLQATFNEYIKISQRDIMNSIDREMSGDLKAGFRCIVQCARNPAEYFADRLWKSMKGAGTDDSLLIRVVVSRSEVDLVEIKASFLQKYHKTVYKMIEGDCSGDYKKLLMALVGKN 292          

HSP 2 Score: 76.2554 bits (186), Expect = 1.474e-15
Identity = 47/140 (33.57%), Postives = 73/140 (52.14%), Query Frame = 3
Query:  687 KKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN*KLNV 1106
            + +GT+EA  I I   R+  Q       Y+ + GKD+   + +E+SG+    + A+   +V    Y A  L   M+GAGT + TL  IL +RS  ++E IK E+   YK+ LE     +TSG ++  L+   QGN   N+
Sbjct:    2 RGMGTNEAELIGILANRSNAQRVEIRKRYKTMYGKDLMNDLKSELSGNLEECLLAMMEPSV---LYDAKCLRRGMRGAGTDEETLIDILCTRSNQEIEAIKREYKEYYKRDLEKDCVSETSGHFKRLLVSMCQGNRDTNM 138          

HSP 3 Score: 62.7734 bits (151), Expect = 4.558e-11
Identity = 63/250 (25.20%), Postives = 112/250 (44.80%), Query Frame = 3
Query:  150 DCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNF-------FQAVEESLFEPDYY----DAHSLFHAM-KGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFK---RVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAI 854
            D + L++ M+G GTDE+ +++ L  RS  +   IK+ YK  + +DL  D  SE SG+F        Q   ++    D      +A  L+ A  K  GT E+    +L SR+  Q++     Y K+   ++  +I  E SG  K   R +V C +                         N A+  A  L+ +  K  GTD+++ I++   R++  L      + +   K +++ I+ + SGD++  + A+
Sbjct:   65 DAKCLRRGMRGAGTDEETLIDILCTRSNQEIEAIKREYKEYYKRDLEKDCVSETSGHFKRLLVSMCQGNRDTNMTVDMAKATKEAQDLYKAGEKKWGTDESRFNVVLASRSFPQLQATFNEYIKISQRDIMNSIDREMSGDLKAGFRCIVQCAR-------------------------NPAEYFADRLWKS-MKGAGTDDSLLIRVVVSRSEVDLVEIKASFLQKYHKTVYKMIEGDCSGDYKKLLMAL 288          
BLAST of Annexin vs. Ensembl Nematostella
Match: EDO32043 (Annexin [Source:UniProtKB/TrEMBL;Acc:A7SW86])

HSP 1 Score: 267.314 bits (682), Expect = 5.524e-87
Identity = 145/325 (44.62%), Postives = 200/325 (61.54%), Query Frame = 3
Query:  108 KGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFV 1082
            + +++ + +F   +D + L+KAMKG+G D KA++  L  R+ SQR  I   YKTMFG+DLI DLKSE+ G F   V   +  P  YDA  L  A+KG GT E VL E+LT+RTN +I  I+  Y  L+S +LE++I  +TSG FK+ L+S   AN+ E               A V  ++A+Q+AQ LY AGE + GTDE+ F  I   R+  QLRATF+EY KI   DI ESI  EMSGD R  +  I     N P +FA +LY +MKG GT D TL RI+++RSE+D+ +I+ EF + Y  TL  ++ DDT G+Y+  LL+ +
Sbjct:   16 RPSVREYTSFDGRKDADTLRKAMKGLGCDNKALMYLLCSRTNSQRQRISLEYKTMFGRDLIKDLKSEVGGYFEDTVIALMTPPAEYDATLLRKAIKGLGTDEAVLIEVLTTRTNDEIIAIRNAYNTLFSRDLEKDIAGDTSGKFKKFLISLCNANRIE--------------TAPVDYSKAQQDAQALYKAGEGRWGTDESKFNSILASRSFDQLRATFNEYSKICKYDIEESIKREMSGDLRDGMVTIVRVVKNAPAFFAEKLYKSMKGLGTDDKTLIRIVVTRSEVDMLDIRDEFHKMYGTTLARYISDDTKGNYKKILLQLI 326          

HSP 2 Score: 88.9669 bits (219), Expect = 8.161e-20
Identity = 75/273 (27.47%), Postives = 123/273 (45.05%), Query Frame = 3
Query:   96 GEKYKGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNF-------FQAVEESLFEPDY----YDAHSLFHAMKG-AGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTP 878
            G  ++ T+       AE D  +L+KA+KG+GTDE  ++E L  R+  + + I+  Y T+F +DL  D+  + SG F         A        DY     DA +L+ A +G  GT E+    IL SR+  Q+      Y K+   ++EE+I  E SG  +  +V+ ++  K                      N     A++LY +  K LGTD+   I+I   R++  +    DE+ K+ G  +   I ++  G++    K I  Q +  P
Sbjct:   84 GGYFEDTVIALMTPPAEYDATLLRKAIKGLGTDEAVLIEVLTTRTNDEIIAIRNAYNTLFSRDLEKDIAGDTSGKFKKFLISLCNANRIETAPVDYSKAQQDAQALYKAGEGRWGTDESKFNSILASRSFDQLRATFNEYSKICKYDIEESIKREMSGDLRDGMVTIVRVVK----------------------NAPAFFAEKLYKS-MKGLGTDDKTLIRIVVTRSEVDMLDIRDEFHKMYGTTLARYISDDTKGNY----KKILLQLIGEP 329          

HSP 3 Score: 77.0258 bits (188), Expect = 1.064e-15
Identity = 67/249 (26.91%), Postives = 112/249 (44.98%), Query Frame = 3
Query:  366 DAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAI--AFQAVNTPFYF------ATRLYNAMKG-AGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQ 1085
            DA +L  AMKG G     L  +L SRTN Q + I + YK ++  +L +++ SE  G+F+  +++ +    P   +D                         L     K LGTDEAV I++   R   ++ A  + Y  +  +D+ + I  + SG F+  + ++  A +    P  +      A  LY A +G  GT ++    IL SRS   L     E+S+  K  +E  +K + SGD +  ++  V+
Sbjct:   30 DADTLRKAMKGLGCDNKALMYLLCSRTNSQRQRISLEYKTMFGRDLIKDLKSEVGGYFEDTVIALMT---PPAEYD-----------------------ATLLRKAIKGLGTDEAVLIEVLTTRTNDEIIAIRNAYNTLFSRDLEKDIAGDTSGKFKKFLISLCNANRIETAPVDYSKAQQDAQALYKAGEGRWGTDESKFNSILASRSFDQLRATFNEYSKICKYDIEESIKREMSGDLRDGMVTIVR 252          

HSP 4 Score: 62.7734 bits (151), Expect = 5.165e-11
Identity = 40/148 (27.03%), Postives = 73/148 (49.32%), Query Frame = 3
Query:  648 AKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
             +++A  L  A  K LG D    + + C R   Q +    EY+ + G+D+ + + +E+ G F  ++ A+         Y AT L  A+KG GT +  L  +L +R+  ++  I+  ++  + + LE  +  DTSG ++ FL+     N
Sbjct:   27 GRKDADTLRKA-MKGLGCDNKALMYLLCSRTNSQRQRISLEYKTMFGRDLIKDLKSEVGGYFEDTVIALMTPPAE---YDATLLRKAIKGLGTDEAVLIEVLTTRTNDEIIAIRNAYNTLFSRDLEKDIAGDTSGKFKKFLISLCNAN 170          
BLAST of Annexin vs. Ensembl Nematostella
Match: EDO44051 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWX3])

HSP 1 Score: 248.825 bits (634), Expect = 4.719e-80
Identity = 137/328 (41.77%), Postives = 205/328 (62.50%), Query Frame = 3
Query:  102 KYKGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQ 1085
            +Y GT+    NF A    E LKKAMKG G DE+AI+E L   ++ QRL I +++K  + KDL+ +LKSELSG F  A+   L  P+  DA++L  AM+G GT ++VL EIL SR+ +++++IK  Y   +  +L   + SETSG F+ +LV+ L A +  +S D+I           V+ +QA ++A+ LY AGEKK GTDE+VF KI   R+  QLRA +  Y+ ++  DI E+ID+E++GD+  ++KAI       P YFA  L +A+ G  T  + + RI+ISRSE+DL +IKA +   Y +TL + VK+   GD++  LL+ ++
Sbjct:    1 EYHGTVVAAENFDAGDCAEKLKKAMKGFGDDEEAIIEVLQSCNLEQRLAIAQSFKQQYDKDLVNELKSELSGKFEDAIVALLLPPEQLDANALHGAMQGLGTNDSVLIEILCSRSAEELQSIKKAYNTAHGKDLVAAVKSETSGDFQALLVALLDAKR--VSADEI-----------VNEDQAYEDAKNLYEAGEKKWGTDESVFTKILTCRSDLQLRALYQAYQHVAKCDILETIDDELTGDYHDAVKAIVRCTRRPPLYFAESLNSALNGLRTDSSLVTRIIISRSEVDLADIKAVYKDTYGKTLATEVKELLKGDHETLLLKILR 315          
BLAST of Annexin vs. Ensembl Nematostella
Match: EDO29757 (Annexin [Source:UniProtKB/TrEMBL;Acc:A7T2R2])

HSP 1 Score: 131.724 bits (330), Expect = 1.358e-36
Identity = 77/200 (38.50%), Postives = 113/200 (56.50%), Query Frame = 3
Query:  486 LYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRA-TFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFV 1082
            ++S +LE++I  +TSG FK+ L+S   AN+ E               A V   +A+Q+AQ LY AGE + GTDE+  +      + +  RA       +I   DI ESI  EMSGD R  +  I     N P +FA +LY +MKG GT D TL RI+++RSE+D+ +I+ EF + Y  TL  ++ DDT G+Y+  LL+ +
Sbjct:    1 MFSRDLEKDIAGDTSGKFKKFLISLCNANRIET--------------APVDYLKAQQDAQALYKAGEGRWGTDESNHV-TETQESSFGERARMLTPSVRICKYDIEESIKREMSGDLRDGMVTIVRVVKNAPAFFAEKLYKSMKGLGTDDKTLIRIVVTRSEVDMLDIRDEFHKMYGTTLAKYISDDTKGNYKKILLQLI 185          

HSP 2 Score: 53.9138 bits (128), Expect = 1.215e-8
Identity = 41/152 (26.97%), Postives = 71/152 (46.71%), Query Frame = 3
Query:  123 PFPNFHAEQDCEVLKKAMKG-IGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQA----VEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCL 563
            P     A+QD + L KA +G  GTDE   V      S  +R  +      +   D+   +K E+SG+        V      P ++ A  L+ +MKG GT +  L  I+ +R+   + +I+  + K+Y   L + I  +T G +K++L+  +
Sbjct:   35 PVDYLKAQQDAQALYKAGEGRWGTDESNHVTETQESSFGERARMLTPSVRICKYDIEESIKREMSGDLRDGMVTIVRVVKNAPAFF-AEKLYKSMKGLGTDDKTLIRIVVTRSEVDMLDIRDEFHKMYGTTLAKYISDDTKGNYKKILLQLI 185          
BLAST of Annexin vs. Ensembl Nematostella
Match: EDO44049 (Annexin [Source:UniProtKB/TrEMBL;Acc:A7RWX1])

HSP 1 Score: 108.997 bits (271), Expect = 1.648e-28
Identity = 65/176 (36.93%), Postives = 105/176 (59.66%), Query Frame = 3
Query:  390 MKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYF-ATRLYNAMK 914
            ++G GT E+ L  IL +R+NK+I +IK +YKK Y   LE+++  +TSG F+ +LV  LQ  + E   D+I +            + A ++A+ L  AG KK GTDE  FI+IF  R+  QL+A F EY K +  DI ++I +EM GD + ++  +  +A+ +P    A +L++A++
Sbjct:    2 LQGFGTDEDALISILCTRSNKEINDIKEVYKKNYDTTLEDDVKGDTSGDFEDLLVKLLQGKRDE--SDEINE------------DLAHKDAEALIEAGIKKWGTDEDCFIEIFTTRSYPQLQAMFPEYSKWAKCDIEDTISSEMDGDLKDAL-LVLVKAIQSPTQMTADKLHSALQ 162          

HSP 2 Score: 60.8474 bits (146), Expect = 3.488e-11
Identity = 44/144 (30.56%), Postives = 73/144 (50.69%), Query Frame = 3
Query:  174 MKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNF----FQAVEESLFEPD-------YYDAHSLFHA-MKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQA 569
            ++G GTDE A++  L  RS  +  +IK+ YK  +   L  D+K + SG+F     + ++    E D       + DA +L  A +K  GT E+   EI T+R+  Q++ +   Y K    ++E+ I SE  G  K  L+  ++A
Sbjct:    2 LQGFGTDEDALISILCTRSNKEINDIKEVYKKNYDTTLEDDVKGDTSGDFEDLLVKLLQGKRDESDEINEDLAHKDAEALIEAGIKKWGTDEDCFIEIFTTRSYPQLQAMFPEYSKWAKCDIEDTISSEMDGDLKDALLVLVKA 145          

HSP 3 Score: 50.8322 bits (120), Expect = 1.036e-7
Identity = 24/60 (40.00%), Postives = 38/60 (63.33%), Query Frame = 3
Query:  909 MKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQG 1088
            ++G GT +  L  IL +RS  ++ +IK  + + Y  TLE  VK DTSGD++  L++ +QG
Sbjct:    2 LQGFGTDEDALISILCTRSNKEINDIKEVYKKNYDTTLEDDVKGDTSGDFEDLLVKLLQG 61          
BLAST of Annexin vs. Ensembl Medaka
Match: anxa11a (annexin A5 [Source:NCBI gene;Acc:101174691])

HSP 1 Score: 308.145 bits (788), Expect = 3.066e-100
Identity = 160/327 (48.93%), Postives = 213/327 (65.14%), Query Frame = 3
Query:  111 GTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            GTI  FP     +D EVL+KAMKG GTDE+AI+  LG RS  QR+ + + YKT +GKDL+ DL SELSG+F + V  +L  P  +DA  L  A+KGAGT E  L EIL+SR+N +I+ I  +YK+ Y   LE++I  +TSG F+R+L+S  Q N+ E              +  V  + A Q+AQ LY AGE KLGTDE+ F  I C R+K  LRA F EY+++ G+DI +SI  EMSGD  S + A+     NTP YFA RLY AMKGAGT DTTL RI++SRSE+DL +I+ E+ + Y ++L + +  DTSGDY+  LL+F  G+
Sbjct:  194 GTITDFPGADPLKDVEVLRKAMKGFGTDEQAIINLLGSRSNKQRVPLLRAYKTSYGKDLVKDLHSELSGDFRKLVLATLKTPAEFDASELHSAIKGAGTDEACLIEILSSRSNAEIKEINRIYKQEYKKSLEDSISGDTSGHFRRLLISLAQGNRDE--------------RETVDASLAAQDAQALYAAGENKLGTDESKFNAILCARSKPHLRAVFHEYQRMCGRDIEKSISREMSGDLESGMLAVVKCIKNTPAYFAERLYKAMKGAGTKDTTLIRIMVSRSEVDLLDIRKEYVKNYGKSLYTAISGDTSGDYKKLLLKFCGGS 506          
BLAST of Annexin vs. Ensembl Medaka
Match: anxa11 (annexin max4 [Source:NCBI gene;Acc:100049456])

HSP 1 Score: 293.123 bits (749), Expect = 6.437e-95
Identity = 157/326 (48.16%), Postives = 209/326 (64.11%), Query Frame = 3
Query:  105 YKGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFV 1082
            Y+G+IK FP     +D EVL+KAMKG GTDEKAI+E LG R+  QR+ +   YKT +GKDL  DLKSEL+GNF   V   L  P  +DA  L  A+KGAGT E  L EIL+SR+N +I  I  +YK  Y   LE++I S+TSG F+R+LVS  Q N+ E              +  V I+ AKQ+AQ+LY AGE K+GTDE+ F  I C R+K  LRA F EY+++ GK+I +SI  E SG+    + A+     NTP YFA RL  AMKGAGT D TL R+++SRSE+D+ +I+ E+ + Y ++L + +  DTSGDY+  LL+  
Sbjct:  153 YRGSIKDFPGADPLRDVEVLRKAMKGFGTDEKAIIELLGNRTNKQRVPLVAAYKTTYGKDLFRDLKSELTGNFEDLVVAMLKTPTQFDASELREAIKGAGTDEACLIEILSSRSNAEIIEINKVYKAEYGKTLEDSISSDTSGHFRRLLVSLCQGNRDE--------------RETVDISLAKQDAQKLYAAGENKVGTDESQFNAILCARSKPHLRAVFHEYQQMCGKEIEKSICRETSGNLEDGMVAVVKCIKNTPAYFAERLRKAMKGAGTKDRTLIRVMVSRSEVDMLDIRQEYLKAYGKSLYTDISGDTSGDYKNLLLKLC 464          

HSP 2 Score: 79.7221 bits (195), Expect = 8.820e-16
Identity = 48/136 (35.29%), Postives = 71/136 (52.21%), Query Frame = 3
Query:  687 KKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYF-ATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            K  GTDE   I++   R   Q       Y+   GKD+F  + +E++G+F   + A+    + TP  F A+ L  A+KGAGT +  L  IL SRS  ++  I   +  EY +TLE  +  DTSG ++  L+   QGN
Sbjct:  177 KGFGTDEKAIIELLGNRTNKQRVPLVAAYKTTYGKDLFRDLKSELTGNFEDLVVAM----LKTPTQFDASELREAIKGAGTDEACLIEILSSRSNAEIIEINKVYKAEYGKTLEDSISSDTSGHFRRLLVSLCQGN 308          
BLAST of Annexin vs. Ensembl Medaka
Match: anxa10 (annexin A10 [Source:NCBI gene;Acc:100049533])

HSP 1 Score: 286.574 bits (732), Expect = 2.565e-94
Identity = 156/329 (47.42%), Postives = 205/329 (62.31%), Query Frame = 3
Query:  108 KGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPE-LSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            KGT+K   NF A  D EVL KAMKGIGTDE AI++ +  RS +QR EIK TYKT+FGKDLI DLK EL G F   +   +  P  YD  SL +A+KGAGT E VL EIL SRT +Q+++I   Y+K Y  +LEE+I  +TSG FKR+LV  LQAN+   +   DI+                  +AQ L+ AGE+K GTDE  F+ +   R+   LR  FD Y K+SG +I ESI  E SG  +  + A+   A + P YFA  LYNAMKGAGT D TL R++++R E+D+ +I+AEF + + ++L S +K DT GDY+  LL    G+
Sbjct:    4 KGTVKAAANFKASADAEVLHKAMKGIGTDEDAILQLVCARSNAQRQEIKATYKTLFGKDLIDDLKGELGGKFETLIVALMTPPTAYDVVSLRNAIKGAGTDEKVLVEILASRTPQQVKDIIAAYRKEYDADLEEDICGDTSGHFKRLLVILLQANRQTGVQEGDIE-----------------NDAQVLFKAGEQKFGTDEQTFVTLLGNRSAQHLRKVFDAYMKLSGYEIEESIKRETSGSLKDLLLAVVKCARSVPAYFAETLYNAMKGAGTDDDTLIRVMVTRGEVDMLDIRAEFRKLFARSLFSMIKGDTGGDYRKALLLLCGGD 315          

HSP 2 Score: 83.9593 bits (206), Expect = 1.280e-17
Identity = 73/266 (27.44%), Postives = 117/266 (43.98%), Query Frame = 3
Query:   87 GAKGEKYKGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNF-------FQA-----VEESLFEPDYYDAHSLFHAMKGA-GTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSI 845
            G  G K++  I          D   L+ A+KG GTDEK +VE L  R+  Q  +I   Y+  +  DL  D+  + SG+F        QA     V+E   E    DA  LF A +   GT E     +L +R+ + +  +   Y KL   E+EE+I  ETSG  K +L++ ++  +   ++                       A+ LYNA  K  GTD+   I++   R +  +     E+ K+  + +F  I  +  GD+R ++
Sbjct:   69 GELGGKFETLIVALMTPPTAYDVVSLRNAIKGAGTDEKVLVEILASRTPQQVKDIIAAYRKEYDADLEEDICGDTSGHFKRLLVILLQANRQTGVQEGDIEN---DAQVLFKAGEQKFGTDEQTFVTLLGNRSAQHLRKVFDAYMKLSGYEIEESIKRETSGSLKDLLLAVVKCARSVPAY----------------------FAETLYNA-MKGAGTDDDTLIRVMVTRGEVDMLDIRAEFRKLFARSLFSMIKGDTGGDYRKAL 308          

HSP 3 Score: 80.1073 bits (196), Expect = 2.290e-16
Identity = 52/158 (32.91%), Postives = 84/158 (53.16%), Query Frame = 3
Query:  645 QAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTP--FYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN*KLNVDE 1112
            +A  +A+ L+ A  K +GTDE   +++ C R+  Q +     Y+ + GKD+ + +  E+ G F + I A+      TP   Y    L NA+KGAGT +  L  IL SR+   +++I A + +EY   LE  +  DTSG ++  L+  +Q N +  V E
Sbjct:   14 KASADAEVLHKA-MKGIGTDEDAILQLVCARSNAQRQEIKATYKTLFGKDLIDDLKGELGGKFETLIVALM-----TPPTAYDVVSLRNAIKGAGTDEKVLVEILASRTPQQVKDIIAAYRKEYDADLEEDICGDTSGHFKRLLVILLQANRQTGVQE 165          
BLAST of Annexin vs. Ensembl Medaka
Match: anxa11 (annexin max4 [Source:NCBI gene;Acc:100049456])

HSP 1 Score: 292.352 bits (747), Expect = 3.727e-94
Identity = 157/326 (48.16%), Postives = 209/326 (64.11%), Query Frame = 3
Query:  105 YKGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFV 1082
            Y+G+IK FP     +D EVL+KAMKG GTDEKAI+E LG R+  QR+ +   YKT +GKDL  DLKSEL+GNF   V   L  P  +DA  L  A+KGAGT E  L EIL+SR+N +I  I  +YK  Y   LE++I S+TSG F+R+LVS  Q N+ E              +  V I+ AKQ+AQ+LY AGE K+GTDE+ F  I C R+K  LRA F EY+++ GK+I +SI  E SG+    + A+     NTP YFA RL  AMKGAGT D TL R+++SRSE+D+ +I+ E+ + Y ++L + +  DTSGDY+  LL+  
Sbjct:  193 YRGSIKDFPGADPLRDVEVLRKAMKGFGTDEKAIIELLGNRTNKQRVPLVAAYKTTYGKDLFRDLKSELTGNFEDLVVAMLKTPTQFDASELREAIKGAGTDEACLIEILSSRSNAEIIEINKVYKAEYGKTLEDSISSDTSGHFRRLLVSLCQGNRDE--------------RETVDISLAKQDAQKLYAAGENKVGTDESQFNAILCARSKPHLRAVFHEYQQMCGKEIEKSICRETSGNLEDGMVAVVKCIKNTPAYFAERLRKAMKGAGTKDRTLIRVMVSRSEVDMLDIRQEYLKAYGKSLYTDISGDTSGDYKNLLLKLC 504          

HSP 2 Score: 79.337 bits (194), Expect = 1.265e-15
Identity = 48/136 (35.29%), Postives = 71/136 (52.21%), Query Frame = 3
Query:  687 KKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYF-ATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            K  GTDE   I++   R   Q       Y+   GKD+F  + +E++G+F   + A+    + TP  F A+ L  A+KGAGT +  L  IL SRS  ++  I   +  EY +TLE  +  DTSG ++  L+   QGN
Sbjct:  217 KGFGTDEKAIIELLGNRTNKQRVPLVAAYKTTYGKDLFRDLKSELTGNFEDLVVAM----LKTPTQFDASELREAIKGAGTDEACLIEILSSRSNAEIIEINKVYKAEYGKTLEDSISSDTSGHFRRLLVSLCQGN 348          
BLAST of Annexin vs. Ensembl Medaka
Match: anxa4 (annexin A4 [Source:NCBI gene;Acc:100049454])

HSP 1 Score: 271.937 bits (694), Expect = 1.220e-88
Identity = 147/327 (44.95%), Postives = 200/327 (61.16%), Query Frame = 3
Query:  108 KGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQG 1088
            +GT+     F+ + D + L++AMKG GTDE AI++ L  R+I+QR  IK  YK   GKDL  DL SELSG+F   V   L     YDA+ L  AMKGAGT E  L +IL SR+N ++  I  +YKK Y   LE+ +  +TSG F+RVLVS L A +     D+  K+ E          QA ++A++++ AGE + GTDE  F+ + C+RN+  L   FDEY+KIS +DI +SI  EMSG       AI     + P +FA RLY +MKG GTTD+ L RI++SR+EID+ +IK  F + Y ++L SF+K DTSGDY+  LL    G
Sbjct:    7 RGTVTEASGFNPDDDAQKLREAMKGAGTDEAAIIKVLAHRTIAQRQRIKLAYKQSVGKDLAEDLSSELSGHFQSVVLGLLMPAPVYDAYELKAAMKGAGTEEACLIDILASRSNSEMNAINEVYKKEYGKTLEDAVCGDTSGMFQRVLVSLLTAGR-----DESDKVDEA---------QAVKDAKDIFEAGEARWGTDEVKFLTVLCVRNRNHLLRVFDEYKKISKRDIEDSIKREMSGSLEDVFLAIVKCLRSKPAFFAERLYKSMKGLGTTDSVLIRIMVSRAEIDMLDIKEHFLKTYGKSLHSFIKGDTSGDYRKILLELCGG 319          
BLAST of Annexin vs. Planmine SMEST
Match: SMESG000042839.1 (SMESG000042839.1)

HSP 1 Score: 694.886 bits (1792), Expect = 0.000e+0
Identity = 338/339 (99.71%), Postives = 338/339 (99.71%), Query Frame = 3
Query:   75 MEFIGAKGEKYKGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            MEFIGAKGEKYKGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNF QAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN
Sbjct:    1 MEFIGAKGEKYKGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFCQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 339          
BLAST of Annexin vs. Planmine SMEST
Match: SMESG000030132.1 (SMESG000030132.1)

HSP 1 Score: 546.969 bits (1408), Expect = 0.000e+0
Identity = 259/339 (76.40%), Postives = 305/339 (89.97%), Query Frame = 3
Query:   75 MEFIGAKGEKYKGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
            M+ IG KGE+YKGTIKPFPNF+ E DCEVL+KAMKGIGTDEKAI+ECLGRR ++QRLEIKKTYKTMFGKDLI  LKSE+SGNF +AV ESL++ DYYDA SL  AMKGAGTRENVLTEILTSR+N QIENIK+LYKK ++ +LE++I+ ETSGFFKRVLVSCLQ+NKPEL+++ I+++ E G  AVV+INQA+QEA ELYNAGEKK+GTDEA+FIKIFCMRNKYQLRATFDEYEKI+GKDIF+SID+EMSGD +S +KAIAFQAVN PFYFAT+LY +MKGAGT DTTL R+L++RSEIDL NIK EF RE+  TLE+FVKDDTSGDY+A+L+RFV+GN
Sbjct:    1 MDQIGVKGERYKGTIKPFPNFNVEHDCEVLRKAMKGIGTDEKAIIECLGRRCLAQRLEIKKTYKTMFGKDLIEALKSEISGNFKKAVIESLYDLDYYDAFSLHEAMKGAGTRENVLTEILTSRSNHQIENIKILYKKFFNHDLEQDIIKETSGFFKRVLVSCLQSNKPELTNEQIREVQERGISAVVNINQARQEATELYNAGEKKIGTDEAMFIKIFCMRNKYQLRATFDEYEKIAGKDIFDSIDSEMSGDLQSVLKAIAFQAVNKPFYFATKLYKSMKGAGTNDTTLVRVLLTRSEIDLLNIKKEFQREFNDTLENFVKDDTSGDYRAYLMRFVEGN 339          
BLAST of Annexin vs. Planmine SMEST
Match: SMESG000023108.1 (SMESG000023108.1)

HSP 1 Score: 294.664 bits (753), Expect = 1.078e-92
Identity = 160/328 (48.78%), Postives = 210/328 (64.02%), Query Frame = 3
Query:  111 GTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSV-ELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 1091
             T+ PFPNF+A +DCE L+KAMKG+GTDE AI++ +G+RS  QR+EI + +KT+ G+DLIAD  SELSGNF +  +     PD YDA  L  AMKG GT E+ L EI+ +RTN QI++ K  YK+LY+  +LE++I+SETS  FKR+L+S LQA     S D+ Q             N A Q+A+ELY AGEKK GTDE+ F +I   R+   LRA F+EYEK+S   + ++I +EMSGD  + +        N P YFA  L  +MKG GT D TL RI+I+R EID+  IK  F  EY + L  ++KDDTSGDY   LL     N
Sbjct:  413 ATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQA-----SRDESQTFDR---------NLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEN 726          
The following BLAST results are available for this feature:
BLAST of Annexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANXA77.578e-9648.00annexin A7 [Source:HGNC Symbol;Acc:HGNC:545][more]
ANXA71.606e-9548.00annexin A7 [Source:HGNC Symbol;Acc:HGNC:545][more]
ANXA51.485e-9246.58annexin A5 [Source:HGNC Symbol;Acc:HGNC:543][more]
ANXA42.315e-9246.79annexin A4 [Source:HGNC Symbol;Acc:HGNC:542][more]
ANXA116.806e-9246.04annexin A11 [Source:HGNC Symbol;Acc:HGNC:535][more]
back to top
BLAST of Annexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nex-22.498e-7941.95Annexin [Source:UniProtKB/TrEMBL;Acc:Q7JMT5][more]
nex-22.498e-7941.95Annexin [Source:UniProtKB/TrEMBL;Acc:Q7JMT5][more]
nex-26.237e-7941.95Annexin [Source:UniProtKB/TrEMBL;Acc:Q7JMT5][more]
nex-13.875e-5837.20Annexin [Source:UniProtKB/TrEMBL;Acc:G5EEA8][more]
nex-13.875e-5837.20Annexin [Source:UniProtKB/TrEMBL;Acc:G5EEA8][more]
back to top
BLAST of Annexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AnxB116.315e-8145.85gene:FBgn0030749 transcript:FBtr0334038[more]
AnxB116.315e-8145.85gene:FBgn0030749 transcript:FBtr0074302[more]
AnxB116.315e-8145.85gene:FBgn0030749 transcript:FBtr0334041[more]
AnxB108.490e-7944.06gene:FBgn0000084 transcript:FBtr0070025[more]
AnxB103.481e-7844.24gene:FBgn0000084 transcript:FBtr0301931[more]
back to top
BLAST of Annexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
anxa11a1.912e-9748.02annexin A11a [Source:ZFIN;Acc:ZDB-GENE-030707-4][more]
anxa11a8.694e-9748.02annexin A11a [Source:ZFIN;Acc:ZDB-GENE-030707-4][more]
anxa11b3.027e-9647.42annexin A11b [Source:ZFIN;Acc:ZDB-GENE-030707-5][more]
anxa45.448e-9044.95annexin A4 [Source:ZFIN;Acc:ZDB-GENE-030707-1][more]
anxa45.448e-9044.95annexin A4 [Source:ZFIN;Acc:ZDB-GENE-030707-1][more]
back to top
BLAST of Annexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpv33.852e-9749.08transient receptor potential cation channel, subfa... [more]
trpv35.753e-9749.08transient receptor potential cation channel, subfa... [more]
mllt106.626e-9747.72MLLT10, histone lysine methyltransferase DOT1L cof... [more]
mllt106.626e-9747.72MLLT10, histone lysine methyltransferase DOT1L cof... [more]
pyy1.828e-9647.62peptide YY [Source:Xenbase;Acc:XB-GENE-986969][more]
back to top
BLAST of Annexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Anxa79.549e-9548.16annexin A7 [Source:MGI Symbol;Acc:MGI:88031][more]
Anxa79.549e-9548.16annexin A7 [Source:MGI Symbol;Acc:MGI:88031][more]
Anxa72.226e-9448.16annexin A7 [Source:MGI Symbol;Acc:MGI:88031][more]
Anxa45.469e-9447.31annexin A4 [Source:MGI Symbol;Acc:MGI:88030][more]
Anxa45.469e-9447.31annexin A4 [Source:MGI Symbol;Acc:MGI:88030][more]
back to top
BLAST of Annexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P20072|ANXA7_BOVIN1.438e-9548.92Annexin A7 OS=Bos taurus OX=9913 GN=ANXA7 PE=1 SV=... [more]
sp|P20073|ANXA7_HUMAN7.712e-9548.00Annexin A7 OS=Homo sapiens OX=9606 GN=ANXA7 PE=1 S... [more]
sp|Q4R5L5|ANXA7_MACFA3.796e-9447.69Annexin A7 OS=Macaca fascicularis OX=9541 GN=ANXA7... [more]
sp|Q07076|ANXA7_MOUSE6.680e-9448.16Annexin A7 OS=Mus musculus OX=10090 GN=Anxa7 PE=1 ... [more]
sp|P97429|ANXA4_MOUSE3.825e-9347.31Annexin A4 OS=Mus musculus OX=10090 GN=Anxa4 PE=1 ... [more]
back to top
BLAST of Annexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JHE81.755e-10850.15Annexin OS=Lingula unguis OX=7574 GN=LOC106173262 ... [more]
A0A2T7PZC24.221e-10849.69Annexin OS=Pomacea canaliculata OX=400727 GN=C0Q70... [more]
A0A1S3JHA65.200e-10850.15Annexin OS=Lingula unguis OX=7574 GN=LOC106173262 ... [more]
A0A5J4P0791.355e-10350.61Annexin OS=Paragonimus westermani OX=34504 GN=DEA3... [more]
A0A210QSV81.704e-10350.89Annexin OS=Mizuhopecten yessoensis OX=6573 GN=KP79... [more]
back to top
BLAST of Annexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000004530.22.931e-9647.32annexin A11-like [Source:NCBI gene;Acc:103040502][more]
anxa11a2.788e-9547.42annexin A11 [Source:NCBI gene;Acc:103039162][more]
anxa45.626e-9246.46annexin A4 [Source:NCBI gene;Acc:103027730][more]
anxa5b2.513e-9147.56annexin A5-like [Source:NCBI gene;Acc:103025290][more]
ENSAMXT00000004017.22.287e-8645.43annexin A5-like [Source:NCBI gene;Acc:103024763][more]
back to top
BLAST of Annexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANXA72.341e-9749.24annexin A7 [Source:HGNC Symbol;Acc:HGNC:545][more]
ANXA71.479e-9547.42annexin A7 [Source:HGNC Symbol;Acc:HGNC:545][more]
ANXA111.027e-8444.64annexin A11 [Source:HGNC Symbol;Acc:HGNC:535][more]
ENSPMAT00000001517.17.887e-8442.59pep scaffold:Pmarinus_7.0:GL476341:319620:335761:1... [more]
anxa2a1.038e-5736.53annexin A2a [Source:ZFIN;Acc:ZDB-GENE-030131-4282][more]
back to top
BLAST of Annexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Annexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO284441.382e-8847.23Annexin [Source:UniProtKB/TrEMBL;Acc:A7T6G0][more]
EDO320435.524e-8744.62Annexin [Source:UniProtKB/TrEMBL;Acc:A7SW86][more]
EDO440514.719e-8041.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297571.358e-3638.50Annexin [Source:UniProtKB/TrEMBL;Acc:A7T2R2][more]
EDO440491.648e-2836.93Annexin [Source:UniProtKB/TrEMBL;Acc:A7RWX1][more]
back to top
BLAST of Annexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
anxa11a3.066e-10048.93annexin A5 [Source:NCBI gene;Acc:101174691][more]
anxa116.437e-9548.16annexin max4 [Source:NCBI gene;Acc:100049456][more]
anxa102.565e-9447.42annexin A10 [Source:NCBI gene;Acc:100049533][more]
anxa113.727e-9448.16annexin max4 [Source:NCBI gene;Acc:100049456][more]
anxa41.220e-8844.95annexin A4 [Source:NCBI gene;Acc:100049454][more]
back to top
BLAST of Annexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000042839.10.000e+099.71SMESG000042839.1[more]
SMESG000030132.10.000e+076.40SMESG000030132.1[more]
SMESG000023108.11.078e-9248.78SMESG000023108.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001515 ID=SMED30001515|Name=Annexin|organism=Schmidtea mediterranea sexual|type=transcript|length=1229bp
GTTTTCATCTATTAACACATTTAGTGAGTAACATTTTCATAATAAATAAT
CAAATTCACTTTCATAGTTAAAACATGGAATTCATTGGTGCTAAGGGTGA
AAAATACAAGGGTACAATTAAACCATTCCCAAATTTCCATGCTGAGCAAG
ATTGTGAAGTGTTGAAAAAAGCAATGAAAGGAATTGGAACTGACGAGAAA
GCCATTGTTGAATGCCTCGGCAGACGAAGTATTTCTCAAAGATTGGAAAT
TAAGAAAACTTACAAAACAATGTTTGGAAAAGATTTAATTGCTGACCTTA
AATCTGAATTAAGTGGAAATTTCTTTCAAGCCGTTGAAGAATCTTTATTT
GAACCTGATTACTATGATGCACATAGTCTGTTTCACGCAATGAAGGGCGC
TGGGACCCGTGAAAATGTTCTTACTGAAATATTAACGTCAAGAACAAATA
AACAAATAGAAAATATTAAAGTACTTTACAAGAAATTGTACAGCGTAGAA
CTTGAAGAAAATATTGTCAGTGAAACTAGTGGATTTTTTAAACGTGTTCT
CGTGTCATGTTTACAGGCAAATAAACCGGAATTGTCGCACGATGACATTC
AAAAATTGCATGAGCACGGTCCGAAAGCTGTTGTAAGCATTAATCAAGCT
AAACAGGAAGCTCAAGAACTTTATAATGCTGGAGAAAAAAAGCTTGGTAC
GGATGAAGCTGTGTTCATAAAAATATTTTGCATGAGAAATAAATACCAAC
TTCGTGCGACTTTTGATGAGTATGAAAAGATTTCTGGAAAAGATATTTTC
GAATCTATTGATAATGAAATGTCGGGAGACTTTCGATCAAGTATAAAAGC
TATAGCTTTTCAAGCTGTTAATACACCTTTCTATTTTGCCACTCGTCTCT
ACAATGCCATGAAAGGGGCTGGTACCACTGATACTACTCTCAGGAGAATT
CTAATTTCACGAAGCGAGATAGACCTAGAAAATATCAAGGCCGAATTCTC
AAGAGAATACAAGCAAACACTTGAAAGCTTTGTGAAAGACGACACTTCCG
GAGATTATCAAGCTTTCTTACTGAGATTTGTGCAAGGAAATTGAAAATTG
AATGTTGACGAATATCTTTAAAACTCTTTTCGACTTTCTTTAATTATTTA
TAAGTATGATTGCCTTCACATTTTTATTTCGCTTGTACTAAATTTAAAAC
AAATATATATTTTGGGTTGAGGAAAAAAA
back to top

protein sequence of SMED30001515-orf-1

>SMED30001515-orf-1 ID=SMED30001515-orf-1|Name=SMED30001515-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=340bp
MEFIGAKGEKYKGTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGR
RSISQRLEIKKTYKTMFGKDLIADLKSELSGNFFQAVEESLFEPDYYDAH
SLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSVELEENIVSE
TSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELY
NAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMS
GDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEID
LENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR037104Annexin_sf
IPR001464Annexin
IPR018502Annexin_repeat
IPR018252Annexin_repeat_CS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0005544calcium-dependent phospholipid binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001464AnnexinPRINTSPR00196ANNEXINcoord: 35..57
score: 49.52
coord: 102..123
score: 61.7
coord: 75..91
score: 42.81
coord: 323..336
score: 51.32
coord: 279..299
score: 65.17
IPR018502Annexin repeatSMARTSM00335annex3coord: 38..90
e-value: 2.0E-16
score: 70.5
coord: 283..335
e-value: 1.7E-14
score: 64.2
coord: 110..162
e-value: 1.7E-17
score: 74.1
coord: 208..260
e-value: 2.8E-13
score: 60.1
IPR018502Annexin repeatPFAMPF00191Annexincoord: 194..260
e-value: 1.2E-21
score: 76.5
coord: 97..161
e-value: 2.2E-20
score: 72.5
coord: 25..86
e-value: 3.5E-21
score: 75.1
coord: 270..333
e-value: 2.0E-19
score: 69.4
IPR037104Annexin superfamilyGENE3DG3DSA:1.10.220.10coord: 93..166
e-value: 1.5E-24
score: 87.8
IPR037104Annexin superfamilyGENE3DG3DSA:1.10.220.10coord: 20..91
e-value: 5.0E-25
score: 89.3
IPR037104Annexin superfamilyGENE3DG3DSA:1.10.220.10coord: 182..263
e-value: 1.3E-24
score: 88.1
IPR037104Annexin superfamilyGENE3DG3DSA:1.10.220.10coord: 267..339
e-value: 1.8E-24
score: 87.7
IPR037104Annexin superfamilySUPERFAMILYSSF47874Annexincoord: 7..335
NoneNo IPR availablePANTHERPTHR10502:SF181coord: 7..336
NoneNo IPR availablePANTHERPTHR10502ANNEXINcoord: 7..336
NoneNo IPR availablePROSITEPS51897ANNEXIN_2coord: 266..337
score: 24.404
NoneNo IPR availablePROSITEPS51897ANNEXIN_2coord: 21..92
score: 23.108
NoneNo IPR availablePROSITEPS51897ANNEXIN_2coord: 93..164
score: 24.948
NoneNo IPR availablePROSITEPS51897ANNEXIN_2coord: 190..262
score: 24.94
IPR018252Annexin repeat, conserved sitePROSITEPS00223ANNEXIN_1coord: 283..335