SMED30001511

Overview
NameSMED30001511
Smed IDSMED30001511
Length (bp)832
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30001511 (SMED30001511) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30001511 (SMED30001511) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30001511 (SMED30001511) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30001511 (SMED30001511) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001511

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30001511 dd_Smed_v4_16888_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30001511 dd_Smed_v6_16888_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30001511 dd_Smed_v4_16888_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30001511 dd_Smed_v4_16888_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30001511 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.011526:5277..6106 -4111
Homology
BLAST of SMED30001511 vs. Ensembl Human
Match: TCTEX1D1 (Tctex1 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26882])

HSP 1 Score: 52.373 bits (124), Expect = 9.873e-8
Identity = 25/93 (26.88%), Postives = 50/93 (53.76%), Query Frame = 2
Query:  485 LKDV--------DYDPVVCRRYAQSLSSEIATHLDEINFPKYRRVIIIHFGRVHNLKDIFFSSRCVWSKITDRSLCVHKSLDNLFGIVQIFAI 739
            LKDV        +Y+P +CR+  +++S  I   + ++  P+Y+ ++I+H G++ N + I   SRC+W   +D          +LF +  ++A+
Sbjct:   85 LKDVVTSYLQVEEYEPELCRQMTKTISEVIKAQVKDLMIPRYKLIVIVHIGQL-NRQSILIGSRCLWDPKSDTFSSYVFRNSSLFALANVYAV 176          
BLAST of SMED30001511 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 53.5286 bits (127), Expect = 8.644e-9
Identity = 25/94 (26.60%), Postives = 51/94 (54.26%), Query Frame = 2
Query:  461 LLEKKLKS-LKDVDYDPVVCRRYAQSLSSEIATHLDEINFPKYRRVIIIHFGRVHNLKDIFFSSRCVWSKITDRSLCVHKSLDNLFGIVQIFAI 739
            +LE  L + L++  YDP  CR+  +++S  I T + E+  P+Y+ ++I++ G+  + + I   SRC+W+  +D            F +  ++A+
Sbjct:   21 ILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQ-RDDQSIVIGSRCLWNPKSDTVSSYTFKNSTFFALANVYAV 113          
BLAST of SMED30001511 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 53.5286 bits (127), Expect = 8.644e-9
Identity = 25/94 (26.60%), Postives = 51/94 (54.26%), Query Frame = 2
Query:  461 LLEKKLKS-LKDVDYDPVVCRRYAQSLSSEIATHLDEINFPKYRRVIIIHFGRVHNLKDIFFSSRCVWSKITDRSLCVHKSLDNLFGIVQIFAI 739
            +LE  L + L++  YDP  CR+  +++S  I T + E+  P+Y+ ++I++ G+  + + I   SRC+W+  +D            F +  ++A+
Sbjct:   21 ILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQ-RDDQSIVIGSRCLWNPKSDTVSSYTFKNSTFFALANVYAV 113          
BLAST of SMED30001511 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 53.9138 bits (128), Expect = 2.101e-8
Identity = 25/94 (26.60%), Postives = 51/94 (54.26%), Query Frame = 2
Query:  461 LLEKKLKS-LKDVDYDPVVCRRYAQSLSSEIATHLDEINFPKYRRVIIIHFGRVHNLKDIFFSSRCVWSKITDRSLCVHKSLDNLFGIVQIFAI 739
            +LE  L + L++  YDP  CR+  +++S  I T + E+  P+Y+ ++I++ G+  + + I   SRC+W+  +D            F +  ++A+
Sbjct:   78 ILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQ-RDDQSIVIGSRCLWNPKSDTVSSYTFKNSTFFALANVYAV 170          
BLAST of SMED30001511 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 53.9138 bits (128), Expect = 2.101e-8
Identity = 25/94 (26.60%), Postives = 51/94 (54.26%), Query Frame = 2
Query:  461 LLEKKLKS-LKDVDYDPVVCRRYAQSLSSEIATHLDEINFPKYRRVIIIHFGRVHNLKDIFFSSRCVWSKITDRSLCVHKSLDNLFGIVQIFAI 739
            +LE  L + L++  YDP  CR+  +++S  I T + E+  P+Y+ ++I++ G+  + + I   SRC+W+  +D            F +  ++A+
Sbjct:   78 ILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQ-RDDQSIVIGSRCLWNPKSDTVSSYTFKNSTFFALANVYAV 170          
BLAST of SMED30001511 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 53.9138 bits (128), Expect = 2.101e-8
Identity = 25/94 (26.60%), Postives = 51/94 (54.26%), Query Frame = 2
Query:  461 LLEKKLKS-LKDVDYDPVVCRRYAQSLSSEIATHLDEINFPKYRRVIIIHFGRVHNLKDIFFSSRCVWSKITDRSLCVHKSLDNLFGIVQIFAI 739
            +LE  L + L++  YDP  CR+  +++S  I T + E+  P+Y+ ++I++ G+  + + I   SRC+W+  +D            F +  ++A+
Sbjct:   78 ILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQ-RDDQSIVIGSRCLWNPKSDTVSSYTFKNSTFFALANVYAV 170          
BLAST of SMED30001511 vs. UniProt/SwissProt
Match: sp|Q9D5I4|TC1D1_MOUSE (Tctex1 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Tctex1d1 PE=2 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 1.470e-7
Identity = 25/94 (26.60%), Postives = 51/94 (54.26%), Query Frame = 2
Query:  461 LLEKKLKS-LKDVDYDPVVCRRYAQSLSSEIATHLDEINFPKYRRVIIIHFGRVHNLKDIFFSSRCVWSKITDRSLCVHKSLDNLFGIVQIFAI 739
            +LE  L + L++  YDP  CR+  +++S  I T + E+  P+Y+ ++I++ G+  + + I   SRC+W+  +D            F +  ++A+
Sbjct:   78 ILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQ-RDDQSIVIGSRCLWNPKSDTVSSYTFKNSTFFALANVYAV 170          
BLAST of SMED30001511 vs. UniProt/SwissProt
Match: sp|Q8N7M0|TC1D1_HUMAN (Tctex1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TCTEX1D1 PE=1 SV=2)

HSP 1 Score: 52.373 bits (124), Expect = 4.741e-7
Identity = 25/93 (26.88%), Postives = 50/93 (53.76%), Query Frame = 2
Query:  485 LKDV--------DYDPVVCRRYAQSLSSEIATHLDEINFPKYRRVIIIHFGRVHNLKDIFFSSRCVWSKITDRSLCVHKSLDNLFGIVQIFAI 739
            LKDV        +Y+P +CR+  +++S  I   + ++  P+Y+ ++I+H G++ N + I   SRC+W   +D          +LF +  ++A+
Sbjct:   85 LKDVVTSYLQVEEYEPELCRQMTKTISEVIKAQVKDLMIPRYKLIVIVHIGQL-NRQSILIGSRCLWDPKSDTFSSYVFRNSSLFALANVYAV 176          
BLAST of SMED30001511 vs. TrEMBL
Match: A0A2G8KR34 (Putative tctex1 domain-containing protein 1-like OS=Stichopus japonicus OX=307972 GN=BSL78_12686 PE=4 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.149e-11
Identity = 39/123 (31.71%), Postives = 64/123 (52.03%), Query Frame = 2
Query:  377 FYVRPIKKVK-LQVQXXXXXXXXXXXXVRLLEKKLKS-LKDVDYDPVVCRRYAQSLSSEIATHLDEINFPKYRRVIIIHFGRVHNLKDIFFSSRCVWSKITDRSLCVHKSLDNLFGIVQIFAI 739
            + + PIKK++  +VQ             RL E +L+  L D+ YDP+ CR   + ++S I   + E+N P+Y+ V+++  G       +   SRC+W+  TD SL VH     LF +V I+ +
Sbjct:   45 YQIEPIKKLRHSEVQ-------------RLAETELERFLADLRYDPITCRELTREIASAILEKIKEMNVPRYKYVVMVSLGSEKGNPGVQLGSRCLWNDSTDSSLTVHFHNKYLFAVVIIYGL 154          
BLAST of SMED30001511 vs. TrEMBL
Match: C3YDU2 (Uncharacterized protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_239782 PE=4 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 3.508e-7
Identity = 27/85 (31.76%), Postives = 42/85 (49.41%), Query Frame = 2
Query:  485 LKDVDYDPVVCRRYAQSLSSEIATHLDEINFPKYRRVIIIHFGRVHNLKDIFFSSRCVWSKITDRSLCVHKSLDNLFGIVQIFAI 739
            LKD  YD   CR  AQ L+ +I      +N  +Y+ V I+  G +     + F SRC+W+  TD    V  +  +LF +  I+ +
Sbjct:   32 LKDQPYDAATCRTQAQDLAGKIMDATKNLNIKRYKLVTIVSIGSLKERPGMHFGSRCLWNDKTDSFTTVKYTNGSLFAVAMIYGL 116          
BLAST of SMED30001511 vs. TrEMBL
Match: A0A1S3JDJ0 (tctex1 domain-containing protein 1-B OS=Lingula unguis OX=7574 GN=LOC106172364 PE=4 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 4.827e-7
Identity = 26/85 (30.59%), Postives = 45/85 (52.94%), Query Frame = 2
Query:  485 LKDVDYDPVVCRRYAQSLSSEIATHLDEINFPKYRRVIIIHFGRVHNLKDIFFSSRCVWSKITDRSLCVHKSLDNLFGIVQIFAI 739
            LKD+ YDP  C+  +Q L+  I   +    F +Y+ V+++  G +     + F SRC+W+K TD    V  +  +LF +  I+ +
Sbjct:  100 LKDMKYDPATCKHLSQELAGIIMERVKLFAFKRYKFVVVVSIGSLKERPGMQFGSRCLWNKGTDSFANVKFANGSLFAVAMIYGL 184          
BLAST of SMED30001511 vs. TrEMBL
Match: W4Y623 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 6.137e-7
Identity = 22/80 (27.50%), Postives = 43/80 (53.75%), Query Frame = 2
Query:  500 YDPVVCRRYAQSLSSEIATHLDEINFPKYRRVIIIHFGRVHNLKDIFFSSRCVWSKITDRSLCVHKSLDNLFGIVQIFAI 739
            YDP  CR  ++ ++  +   L  + +P+Y+ V++++ G       +   SRC+W+  TD    VH S  +LF +V ++ +
Sbjct:   69 YDPKQCRLLSRDIAGAVMEELKTMMYPRYKFVVVVNIGSKKEKPGVQLGSRCIWNDSTDSMTTVHYSNGSLFAVVMVYGL 148          
BLAST of SMED30001511 vs. TrEMBL
Match: K1RFR2 (Tctex1 domain-containing protein 1 OS=Crassostrea gigas OX=29159 GN=CGI_10027869 PE=4 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 1.140e-6
Identity = 25/85 (29.41%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  485 LKDVDYDPVVCRRYAQSLSSEIATHLDEINFPKYRRVIIIHFGRVHNLKDIFFSSRCVWSKITDRSLCVHKSLDNLFGIVQIFAI 739
            L  V+YDPV CR  +Q+++ +I   + ++ F +Y+ +  +  G +     + F SRC+W+K TD  + V  S  ++F +  I+ +
Sbjct:  151 LSKVEYDPVTCRDVSQTVAIDILERVKQMGFKRYKIITNVSIGSLREKPGMQFGSRCLWNKNTDNFVSVKYSNTSIFAVAMIYGL 235          
BLAST of SMED30001511 vs. Ensembl Cavefish
Match: tctex1d1 (Tctex1 domain containing 1 [Source:NCBI gene;Acc:103044040])

HSP 1 Score: 46.595 bits (109), Expect = 4.953e-6
Identity = 22/87 (25.29%), Postives = 50/87 (57.47%), Query Frame = 2
Query:  485 LKDVDYDPVVCRRYAQSLSSEIATHLDEINFPKYRRVIIIHFGRVHNLKDIFFSSRCVWSKITDRSLCVHKSLDN--LFGIVQIFAI 739
            L +V Y+  +CR+  +++S  +   + ++  P+Y+ +++I  G++   +++   SRC+W   +D + C + S  N  LF I  ++A+
Sbjct:   91 LLEVKYEAELCRQMTKTISEVVKARVKDMMIPRYKIIVVISIGQLTG-QNMHVGSRCLWDATSD-TFCSN-SFKNSSLFAIANVYAV 174          
BLAST of SMED30001511 vs. Ensembl Nematostella
Match: EDO45441 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTB6])

HSP 1 Score: 53.5286 bits (127), Expect = 8.471e-9
Identity = 21/88 (23.86%), Postives = 48/88 (54.55%), Query Frame = 2
Query:  476 LKSLKDVDYDPVVCRRYAQSLSSEIATHLDEINFPKYRRVIIIHFGRVHNLKDIFFSSRCVWSKITDRSLCVHKSLDNLFGIVQIFAI 739
            +++L DV+YDP  CR+  +++S  +   + E++  +Y+ + ++H G++   + +   SRC+W    D          +LFG+  ++ +
Sbjct:   88 IENLADVNYDPNTCRQLTKTISETLKNRVKELSVQRYKIICLVHIGQLGK-QAMRIGSRCLWDANFDTYTTYEFKNGSLFGVATVYGV 174          
BLAST of SMED30001511 vs. Ensembl Nematostella
Match: EDO46990 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNU7])

HSP 1 Score: 49.6766 bits (117), Expect = 6.606e-8
Identity = 25/87 (28.74%), Postives = 42/87 (48.28%), Query Frame = 2
Query:  479 KSLKDVDYDPVVCRRYAQSLSSEIATHLDEINFPKYRRVIIIHFGRVHNLKDIFFSSRCVWSKITDRSLCVHKSLDNLFGIVQIFAI 739
            K L +  YDP  CR  A  +  EI + +  + F +Y+ V + + G+V++ + I   SRC W +  D       +   LF +  I+ I
Sbjct:   27 KVLAESVYDPKTCRTQAMEIGDEILSQVKALGFDRYKIVCLTNIGKVND-QTIRIGSRCCWDQNLDNYAEAVYTNSTLFAVTAIYGI 112          
BLAST of SMED30001511 vs. Ensembl Nematostella
Match: EDO49885 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF13])

HSP 1 Score: 47.7506 bits (112), Expect = 1.957e-7
Identity = 25/95 (26.32%), Postives = 51/95 (53.68%), Query Frame = 2
Query:  455 VRLLEKKLKSLKDVDYDPVVCRRYAQSLSSEIATHLDEINFPKYRRVIIIHFGRVHNLKDIFFSSRCVWSKITDRSLCVHKSLDNLFGIVQIFAI 739
            +++LE++L++ K   Y+   C+  +  +S +I   +  + + +Y+ +  +  G VH  + +  SSRC+W  +TD S     +  +LF +  IF I
Sbjct:   12 LKILERELRAAK---YEARKCKVLSMDISEKIRDEVKRLAYDRYKIIAFVTIGSVHG-QGLLVSSRCLWFPLTDGSATAVFTNASLFAVATIFGI 102          
BLAST of SMED30001511 vs. Ensembl Nematostella
Match: EDO46089 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR15])

HSP 1 Score: 45.4394 bits (106), Expect = 2.083e-6
Identity = 21/85 (24.71%), Postives = 44/85 (51.76%), Query Frame = 2
Query:  485 LKDVDYDPVVCRRYAQSLSSEIATHLDEINFPKYRRVIIIHFGRVHNLKDIFFSSRCVWSKITDRSLCVHKSLDNLFGIVQIFAI 739
            L+ + Y+   C + A+ +S  I   +  +++ +Y+ V+++  G + + + +  SSRC+W   TD S        +LF +  +F I
Sbjct:   39 LEGMSYEATECSKLAREMSETIRNEVKALSWDRYKIVVMVSIGSLKD-QGLHISSRCLWYPNTDGSATAVYRNTSLFAVATVFGI 122          
BLAST of SMED30001511 vs. Ensembl Nematostella
Match: EDO46891 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNP6])

HSP 1 Score: 45.0542 bits (105), Expect = 3.196e-6
Identity = 21/85 (24.71%), Postives = 44/85 (51.76%), Query Frame = 2
Query:  485 LKDVDYDPVVCRRYAQSLSSEIATHLDEINFPKYRRVIIIHFGRVHNLKDIFFSSRCVWSKITDRSLCVHKSLDNLFGIVQIFAI 739
            L  V Y     R  +  L+ EI +H+  + + +Y+ + ++H G + + +D+  +SRC+W +  DR+       ++LF    +F +
Sbjct:   45 LGQVKYSAERSRVLSVPLAEEIKSHVKRLGYQRYKIICVVHIGSL-DGQDVRVASRCLWDENQDRAASGSFCNESLFASATVFGV 128          
BLAST of SMED30001511 vs. Planmine SMEST
Match: SMESG000029772.1 (SMESG000029772.1)

HSP 1 Score: 327.405 bits (838), Expect = 5.809e-114
Identity = 215/216 (99.54%), Postives = 215/216 (99.54%), Query Frame = 2
Query:   95 MASYNPRKNSNTLRYNKQSIPNGYSRKSSMDPKQSYFNKSSLNKAFSSLLNINRPSNYEMNXXXXXXXXXXXXXXXXXXXXXXXXXXXGKSTNMFYVRPIKKVKLQVQXXXXXXXXXXXXVRLLEKKLKSLKDVDYDPVVCRRYAQSLSSEIATHLDEINFPKYRRVIIIHFGRVHNLKDIFFSSRCVWSKITDRSLCVHKSLDNLFGIVQIFAIL 742
            MASYNPRKNSNTLRYNKQSI NGYSRKSSMDPKQSYFNKSSLNKAFSSLLNINRPSNYEMNSAKSIADISCDSSSTSSSVKIVQSITSGKSTNMFYVRPIKKVKLQVQEIFDIEAAEIIAVRLLEKKLKSLKDVDYDPVVCRRYAQSLSSEIATHLDEINFPKYRRVIIIHFGRVHNLKDIFFSSRCVWSKITDRSLCVHKSLDNLFGIVQIFAIL
Sbjct:    1 MASYNPRKNSNTLRYNKQSISNGYSRKSSMDPKQSYFNKSSLNKAFSSLLNINRPSNYEMNSAKSIADISCDSSSTSSSVKIVQSITSGKSTNMFYVRPIKKVKLQVQEIFDIEAAEIIAVRLLEKKLKSLKDVDYDPVVCRRYAQSLSSEIATHLDEINFPKYRRVIIIHFGRVHNLKDIFFSSRCVWSKITDRSLCVHKSLDNLFGIVQIFAIL 216          
The following BLAST results are available for this feature:
BLAST of SMED30001511 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TCTEX1D19.873e-826.88Tctex1 domain containing 1 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of SMED30001511 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001511 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001511 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001511 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001511 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tctex1d18.644e-926.60Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
Tctex1d18.644e-926.60Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
Tctex1d12.101e-826.60Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
Tctex1d12.101e-826.60Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
Tctex1d12.101e-826.60Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of SMED30001511 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q9D5I4|TC1D1_MOUSE1.470e-726.60Tctex1 domain-containing protein 1 OS=Mus musculus... [more]
sp|Q8N7M0|TC1D1_HUMAN4.741e-726.88Tctex1 domain-containing protein 1 OS=Homo sapiens... [more]
back to top
BLAST of SMED30001511 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2G8KR341.149e-1131.71Putative tctex1 domain-containing protein 1-like O... [more]
C3YDU23.508e-731.76Uncharacterized protein (Fragment) OS=Branchiostom... [more]
A0A1S3JDJ04.827e-730.59tctex1 domain-containing protein 1-B OS=Lingula un... [more]
W4Y6236.137e-727.50Uncharacterized protein OS=Strongylocentrotus purp... [more]
K1RFR21.140e-629.41Tctex1 domain-containing protein 1 OS=Crassostrea ... [more]
back to top
BLAST of SMED30001511 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tctex1d14.953e-625.29Tctex1 domain containing 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of SMED30001511 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001511 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001511 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO454418.471e-923.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469906.606e-828.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498851.957e-726.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460892.083e-624.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468913.196e-624.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30001511 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001511 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000029772.15.809e-11499.54SMESG000029772.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001511 ID=SMED30001511|Name=SMED30001511|organism=Schmidtea mediterranea sexual|type=transcript|length=832bp
CGTGAATATAATTAACTGATCTATCTAATAACTTTTTTATTGATTAGTGA
TGATTTTTGGCAATATAAGCAAAAATCATTAAAGCTTTTGAATTATGGCT
TCATACAATCCAAGAAAAAACTCCAATACACTTAGATATAATAAACAATC
GATACCAAATGGATATAGCCGAAAGAGTTCAATGGATCCAAAACAGTCAT
ACTTTAATAAAAGTTCTTTAAACAAAGCCTTTTCAAGTTTATTAAACATT
AATAGGCCATCTAACTATGAAATGAATAGCGCTAAAAGTATTGCGGATAT
ATCGTGCGATTCATCGTCAACTTCATCCTCTGTTAAAATTGTGCAATCTA
TCACATCAGGAAAATCTACAAATATGTTTTATGTAAGACCAATCAAAAAA
GTTAAACTTCAAGTACAGGAAATATTTGATATAGAAGCAGCGGAAATTAT
AGCTGTACGGCTTTTGGAAAAGAAATTGAAATCATTAAAAGATGTAGATT
ATGATCCTGTGGTATGTAGAAGGTATGCCCAATCATTGAGTTCAGAAATT
GCTACACATCTCGATGAAATAAATTTTCCAAAATACAGAAGAGTCATAAT
TATACATTTTGGAAGAGTTCATAACTTAAAAGATATTTTCTTCAGTTCAA
GATGTGTTTGGAGTAAAATCACTGATCGAAGTCTCTGTGTTCATAAAAGT
TTAGATAACCTTTTTGGAATCGTTCAGATTTTTGCAATTTTATAATGTTT
TTTTAAAATTGCACAGGTCAACAACTAGTCAAAAACTTTGCAGGAATTTA
TACATAATTCTCACATATTTGACAAAAGGGAC
back to top

protein sequence of SMED30001511-orf-1

>SMED30001511-orf-1 ID=SMED30001511-orf-1|Name=SMED30001511-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=217bp
MASYNPRKNSNTLRYNKQSIPNGYSRKSSMDPKQSYFNKSSLNKAFSSLL
NINRPSNYEMNSAKSIADISCDSSSTSSSVKIVQSITSGKSTNMFYVRPI
KKVKLQVQEIFDIEAAEIIAVRLLEKKLKSLKDVDYDPVVCRRYAQSLSS
EIATHLDEINFPKYRRVIIIHFGRVHNLKDIFFSSRCVWSKITDRSLCVH
KSLDNLFGIVQIFAIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR038586Tctex-1-like_sf
IPR005334Tctex-1-like
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005334Dynein light chain Tctex-1 likePFAMPF03645Tctex-1coord: 129..215
e-value: 4.0E-6
score: 27.0
IPR005334Dynein light chain Tctex-1 likePANTHERPTHR21255T-COMPLEX-ASSOCIATED-TESTIS-EXPRESSED 1/ DYNEIN LIGHT CHAINcoord: 104..215
IPR038586Tctex-1-like superfamilyGENE3DG3DSA:3.30.1140.40coord: 114..216
e-value: 5.8E-6
score: 28.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..31
NoneNo IPR availablePANTHERPTHR21255:SF23coord: 104..215