Rho guanine nucleotide exchange factor 17

Overview
NameRho guanine nucleotide exchange factor 17
Smed IDSMED30001497
Length (bp)4780
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rho guanine nucleotide exchange factor 17 (SMED30001497) t-SNE clustered cells

Violin plots show distribution of expression levels for Rho guanine nucleotide exchange factor 17 (SMED30001497) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rho guanine nucleotide exchange factor 17 (SMED30001497) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rho guanine nucleotide exchange factor 17 (SMED30001497) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001497

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30001497SMESG000018133.1 dd_Smed_v4_2922_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001497SMESG000018133.1 dd_Smed_v4_2922_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001497SMESG000018133.1 dd_Smed_v4_2922_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001497SMESG000018133.1 dd_Smed_v4_2922_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30001497SMESG000018133.1 dd_Smed_v4_2922_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30001497SMESG000018133.1 dd_Smed_v4_2922_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30001497SMESG000018133.1 dd_Smed_v4_2922_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001497SMESG000018133.1 Contig30441newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001497SMESG000018133.1 Contig30441uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001497SMESG000018133.1 Contig31715newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001497SMESG000018133.1 Contig31715uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30001497SMESG000018133.1 dd_Smed_v6_2922_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
musculature systemSMED30001497SMESG000018133.1 dd_Smed_v6_2922_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30001497SMESG000018133.1 dd_Smed_v6_2922_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Human
Match: ARHGEF17 (Rho guanine nucleotide exchange factor 17 [Source:HGNC Symbol;Acc:HGNC:21726])

HSP 1 Score: 209.534 bits (532), Expect = 2.379e-54
Identity = 120/375 (32.00%), Postives = 200/375 (53.33%), Query Frame = 3
Query: 3663 SQSCSESGESETDESNNKLVRKISSEDSPKNKKLSD-------PFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVESLDRGHTGNVRFXXXXXXX-------XXXXXXXXXXXXXXPC------------TTMATQMKIICGGDGYEDF-TSKSNRENNQDIGRDDAINHIQIWDI 4706
            S S    G   T   + + +R+ SS  S     L D        +++++W+G EDG + V+ S+D++R  ++  K+   ++V  +L+ +N+V+VSL NGELV ++R    +WD        L +Q SPI  M++V G +W   Q  +++++P ++++E+ F + + +  R ++ +  S   VW+T + S+ + LYH  ++E L EV++ P V + L   D II +HK ACLRIT LLVC+++LW GTSAGV+LT+P    T S  +  +       L +GHTG+VRFL +++                       P                  +M +I GGDGYEDF  S     +++ +GRDD+ NH+ +W +
Sbjct:  675 SGSFGPGGPCGTSPMDGRALRR-SSHGSFTRGSLEDLLSVDPEAYQSSVWLGTEDGCVHVYQSSDSIRDRRNSMKLQHAASVTCILYLNNQVFVSLANGELVVYQREAGHFWDPQNFKSVTLGTQGSPITKMVSVGGRLWCGCQNRVLVLSPDTLQLEHMFYVGQ-DSSRCVACMVDSSLGVWVTLKGSAHVCLYHPDTFEQLAEVDVTPPVHRMLAGSDAIIRQHKAACLRITALLVCEELLWVGTSAGVVLTMPTSPGTVSCPRAPL---SPTGLGQGHTGHVRFLAAVQLPDGFNLLCPTPPPPPDTGPEKLPSLEHRDSPWHRGPAPARPKMLVISGGDGYEDFRLSSGGGSSSETVGRDDSTNHLLLWRV 1044          

HSP 2 Score: 205.682 bits (522), Expect = 4.811e-53
Identity = 155/512 (30.27%), Postives = 263/512 (51.37%), Query Frame = 3
Query: 2040 RYLIIQELLSVESEYVKVLEILVNHFMVPLKLEK---LLDETSIDTIFNKINELMNYHAEFLS----ILQVWKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKIN-AVKEAKQD----------ETFLEGQKLLERLLSPMTMNQNRQFIRHD---PVTVEDRKEAYCIFSFSDQIIVXXXXXXXXXXXXXPPVLRLMTPSGLDFVDNI-KYKFISRXXX------XXXXXXXXXDTDQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIASQFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKLVDVPRT--PRFNQALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAVPG 3485
            R  +   LL  E  YV+ L  L+  +M PLK  +   L D + +D IF++I EL+ +H +FL      +Q W  +  +G  + + FS+  +   Y+++I+NF  ++  +  A  ++ +  KF+EQ  +++K K  L  L+++PVQRIPRYELL+K L+++TP D  D+  LL+AQ  + Q+A +IN  V+ A++           E  +EG   +E L +P+     R+F+R +    V     K+   +F F+D I+ TT KR+     +    + L T + +  +D   KYK + ++ +      +      N +  QK + R  E     DL+ L ++  L   L   HQ +D  ++ L A + +D+ E +    A +   +   +   T  EG +   F F   + +L +E+   + K KL        P F +A+ I +T+SGMQF CA P          +VW+C SDG+ G +CLLS++ +P V   + +  C+A+++CI AVPG
Sbjct:   48 RKHVAMTLLDTEQSYVESLRTLMQGYMQPLKQPENSVLCDPSLVDEIFDQIPELLEHHEQFLEQVRHCMQTWHAQQKVGALLVQSFSKDVLVNIYSAYIDNFLNAKDAVRVAKEARPAFLKFLEQSMRENKEKQALSDLMIKPVQRIPRYELLVKDLLKHTPEDHPDHPLLLEAQRNIKQVAERINKGVRSAEEAERHARVLQEIEAHIEG---MEDLQAPL-----RRFLRQEMVIEVKAIGGKKDRSLFLFTDLIVCTTLKRKSGSLRRS--SMSLYTAASV--IDTASKYKMLWKLPLEDADIIKGASQATNRENIQKAISRLDE-----DLTTLGQMSKLSESLGFPHQSLDDALRDLSAAMHRDLSEKQALCYALSFPPT-KLELCATRPEGTDSYIFEFPHPDARLGFEQAFDEAKRKLASSKSCLDPEFLKAIPIMKTRSGMQFSCAAPTLNSCPEPSPEVWVCNSDGYVGQVCLLSLRAEPDV--EACIAVCSARILCIGAVPG 539          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Human
Match: ARHGEF17 (Rho guanine nucleotide exchange factor 17 [Source:HGNC Symbol;Acc:HGNC:21726])

HSP 1 Score: 211.46 bits (537), Expect = 3.802e-54
Identity = 157/518 (30.31%), Postives = 264/518 (50.97%), Query Frame = 3
Query: 2022 KQKVEKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEK---LLDETSIDTIFNKINELMNYHAEFLS----ILQVWKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKIN-AVKEAKQD----------ETFLEGQKLLERLLSPMTMNQNRQFIRHD---PVTVEDRKEAYCIFSFSDQIIVXXXXXXXXXXXXXPPVLRLMTPSGLDFVDNI-KYKFISRXXX------XXXXXXXXXDTDQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIASQFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKLVDVPRT--PRFNQALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAVPG 3485
            K +V+ R  +   LL  E  YV+ L  L+  +M PLK  +   L D + +D IF++I EL+ +H +FL      +Q W  +  +G  + + FS+  +   Y+++I+NF  ++  +  A  ++ +  KF+EQ  +++K K  L  L+++PVQRIPRYELL+K L+++TP D  D+  LL+AQ  + Q+A +IN  V+ A++           E  +EG   +E L +P+     R+F+R +    V     K+   +F F+D I+ TT KR+     +    + L T      +D   KYK + ++ +      +      N +  QK + R  E     DL+ L ++  L   L   HQ +D  ++ L A + +D+ E +    A +   +   +   T  EG +   F F   + +L +E+   + K KL        P F +A+ I +T+SGMQF CA P          +VW+C SDG+ G +CLLS++ +P V     +  C+A+++CI AVPG
Sbjct: 1061 KPQVDMRKHVAMTLLDTEQSYVESLRTLMQGYMQPLKQPENSVLCDPSLVDEIFDQIPELLEHHEQFLEQVRHCMQTWHAQQKVGALLVQSFSKDVLVNIYSAYIDNFLNAKDAVRVAKEARPAFLKFLEQSMRENKEKQALSDLMIKPVQRIPRYELLVKDLLKHTPEDHPDHPLLLEAQRNIKQVAERINKGVRSAEEAERHARVLQEIEAHIEG---MEDLQAPL-----RRFLRQEMVIEVKAIGGKKDRSLFLFTDLIVCTTLKRKSGSLRRS--SMSLYT--AASVIDTASKYKMLWKLPLEDADIIKGASQATNRENIQKAISRLDE-----DLTTLGQMSKLSESLGFPHQSLDDALRDLSAAMHRDLSEKQALCYALSFPPTKL-ELCATRPEGTDSYIFEFPHPDARLGFEQAFDEAKRKLASSKSCLDPEFLKAIPIMKTRSGMQFSCAAPTLNSCPEPSPEVWVCNSDGYVGQVCLLSLRAEPDVEACIAV--CSARILCIGAVPG 1558          

HSP 2 Score: 210.69 bits (535), Expect = 5.295e-54
Identity = 110/331 (33.23%), Postives = 186/331 (56.19%), Query Frame = 3
Query: 3774 FKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVESLDRGHTGNVRFXXXXXXX-------XXXXXXXXXXXXXXPC------------TTMATQMKIICGGDGYEDFT-SKSNRENNQDIGRDDAINHIQIWDI 4706
            +++++W+G EDG + V+ S+D++R  ++  K+   ++V  +L+ +N+V+VSL NGELV ++R    +WD        L +Q SPI  M++V G +W   Q  +++++P ++++E+ F + + +  R ++ +  S   VW+T + S+ + LYH  ++E L EV++ P V + L   D II +HK ACLRIT LLVC+++LW GTSAGV+LT+P    T S  +  +       L +GHTG+VRFL +++                       P                  +M +I GGDGYEDF  S     +++ +GRDD+ NH+ +W +
Sbjct: 1737 YQSSVWLGTEDGCVHVYQSSDSIRDRRNSMKLQHAASVTCILYLNNQVFVSLANGELVVYQREAGHFWDPQNFKSVTLGTQGSPITKMVSVGGRLWCGCQNRVLVLSPDTLQLEHMFYVGQ-DSSRCVACMVDSSLGVWVTLKGSAHVCLYHPDTFEQLAEVDVTPPVHRMLAGSDAIIRQHKAACLRITALLVCEELLWVGTSAGVVLTMPTSPGTVSCPRAPL---SPTGLGQGHTGHVRFLAAVQLPDGFNLLCPTPPPPPDTGPEKLPSLEHRDSPWHRGPAPARPKMLVISGGDGYEDFRLSSGGGSSSETVGRDDSTNHLLLWRV 2063          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Human
Match: SPAG9 (sperm associated antigen 9 [Source:HGNC Symbol;Acc:HGNC:14524])

HSP 1 Score: 113.235 bits (282), Expect = 2.764e-24
Identity = 70/223 (31.39%), Postives = 114/223 (51.12%), Query Frame = 3
Query: 3783 TMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNII 4451
            TMW+G ++G + V  S    R  K    I L  +++S++H    V V+L +G L  F R ++G WDL    +  L      I+ M  V   +W   +  I ++ P ++KIE +F      + + +  LA  G  VW++    S + LYHA +Y++L +V+I P V + L        +   + +RIT L+V  + LW GT  GVI++IP+    T T KT+ +
Sbjct:  971 TMWLGAQNGCLYVHSSVAQWR--KCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVDGQWDLSNYHLLDLGRPHHSIRCMTVVHDKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQ-VRQLAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTG-----KLGFSFVRITALMVSCNRLWVGTGNGVIISIPL----TETNKTSGV 1181          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Human
Match: SPAG9 (sperm associated antigen 9 [Source:HGNC Symbol;Acc:HGNC:14524])

HSP 1 Score: 112.849 bits (281), Expect = 2.969e-24
Identity = 70/223 (31.39%), Postives = 114/223 (51.12%), Query Frame = 3
Query: 3783 TMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNII 4451
            TMW+G ++G + V  S    R  K    I L  +++S++H    V V+L +G L  F R ++G WDL    +  L      I+ M  V   +W   +  I ++ P ++KIE +F      + + +  LA  G  VW++    S + LYHA +Y++L +V+I P V + L        +   + +RIT L+V  + LW GT  GVI++IP+    T T KT+ +
Sbjct:  961 TMWLGAQNGCLYVHSSVAQWR--KCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVDGQWDLSNYHLLDLGRPHHSIRCMTVVHDKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQ-VRQLAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTG-----KLGFSFVRITALMVSCNRLWVGTGNGVIISIPL----TETNKTSGV 1171          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Human
Match: SPAG9 (sperm associated antigen 9 [Source:HGNC Symbol;Acc:HGNC:14524])

HSP 1 Score: 112.849 bits (281), Expect = 3.092e-24
Identity = 70/223 (31.39%), Postives = 114/223 (51.12%), Query Frame = 3
Query: 3783 TMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNII 4451
            TMW+G ++G + V  S    R  K    I L  +++S++H    V V+L +G L  F R ++G WDL    +  L      I+ M  V   +W   +  I ++ P ++KIE +F      + + +  LA  G  VW++    S + LYHA +Y++L +V+I P V + L        +   + +RIT L+V  + LW GT  GVI++IP+    T T KT+ +
Sbjct:  957 TMWLGAQNGCLYVHSSVAQWR--KCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVDGQWDLSNYHLLDLGRPHHSIRCMTVVHDKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQ-VRQLAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTG-----KLGFSFVRITALMVSCNRLWVGTGNGVIISIPL----TETNKTSGV 1167          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Celegans
Match: osg-1 (Rho guanine nucleotide exchange factor osg-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21653])

HSP 1 Score: 185.652 bits (470), Expect = 4.317e-47
Identity = 154/544 (28.31%), Postives = 270/544 (49.63%), Query Frame = 3
Query: 1932 PDLFDENSIKLEVSSDETILEEVDDRILLEKQKVEK--------RYLIIQELLSVESEYVKVLEILVNHFMVPLK--LEKLLDETS-IDTIFNKINELMNYHAEFLSILQV----WKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKINAVKEAKQ--DETFLEGQKLLERLLSPMTMNQNRQFIRHDPVTVEDRKEAYCIFSFSDQIIVXXXXXXXXXXXXXPPVL-RLMTPSGLDFVDNIKYKFISRXXXXXXXXXXXXDTDQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIAS-------QFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKLV-DVPRTPRFN-QALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAVP 3482
            P ++ +    LE    E  L E D  ILL K++           R+L  +ELL  E  +V+ LE LV  +M PL+  LE  L E S +D IF +I E++ +H   L+ L      W     +GD +   FS+  + E Y SF++NF  ++  +  A   K + +K+  +  +D  NKL L +LL+ P+QR+PRYEL++K+++++TP + +D   LL AQ  +H LA+ IN  K+  +  ++   E + +++ L   +T  ++R  +RHD +T++      CIF  SD ++V       T   KKP VL   M+   + F++  ++K + ++ +E+++  ++  +  + + R  E   R+D  +L+++  L S L         C +++   +L+ ME S NS     +N  ++S          V T  G E     F   EK+  +E + KD K  L  ++   P  + + +   +T+ G+Q C A  + G        +W+C SD F+G + ++++    I   +    G NA V  +  VP
Sbjct:  316 PYVYSDGGEALETCGMEDSLHEAD--ILLWKKRSRASLRRHYSVRHLAARELLDTEKSFVEGLEFLVTKYMRPLRQPLECTLIEASLVDKIFYRIPEILAHHQVLLTTLSQRIDQWHKDAILGDVLLAHFSKQSMIETYISFVDNFKFAKASIIQA-RQKHAFEKYYNRCCRDHPNKLDLDSLLISPIQRVPRYELIVKQMLKHTPVEHEDRERLLRAQRHIHCLAVAINQHKDGSEQMEQRLREIEAIVDGLDDLVT--KDRTLLRHDIITLKGTDRERCIFMLSDLLLV-------TSVKKKPKVLYSKMSSQSMGFLEGNRFKLLFKVALEDVQISKDTLSQLEEVERKLE-SSREDDRVLKKMSQLCSLLK--------CERKVLMEMLETMETS-NSMSIRELNEQMSSDPDLSAVHLDVLTSNGFEPFVLEFPNAEKRSVFEAMFKDAKATLAKNLLAAPSCSLKTIIAHQTRPGLQLCTATVVPGKRVDSTPSLWVCASDKFSGQVAVMALDTGEITIESCSAIG-NAAVTAMCTVP 836          

HSP 2 Score: 83.5741 bits (205), Expect = 1.054e-15
Identity = 76/314 (24.20%), Postives = 139/314 (44.27%), Query Frame = 3
Query: 3777 KATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNG---ELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVESLDRGHTGNVRF---XXXXXXXXXXXXXXXXXXXXXPCTTMATQMKIICGGDGYEDFTSKSNRENNQDIGRDDAINHIQIW 4700
            + T+WIG +DG + V  S + VR     R   L +++ S+   +  V V+       +L+ F+   +G WDL+         Q +PI +M  +   +   S   +      + K +    +  S+D   I+ +  +GQ V++    S+++ +    +   +   N+   V  +L   + I+  HK  CLRI+CL V +  LW GTSAG +L+  + +  +  T      P +   + GH+G  R    + +   S   S +  R     P    ++Q+ ++  G+G +D T+  +          DAINH+  W
Sbjct:  883 QTTVWIGNDDGEVFVVNSTERVRSRARDRLARLRNSITSICAANGNVLVATSYSNQVQLLLFRPASDGSWDLENPQTVGHVCQ-APITSMQLIGRRVIIASGNWLHAYFVDTGKFQPPVEILPSSDV--ITLMYVTGQNVFLCGRKSTEVFVVDVFNLSIINHFNVVSFVRSQLSGREHILREHKMGCLRISCLTVARSHLWIGTSAGCVLSTSVQSARSQPT------PDLRVCEIGHSGPCRILLPVHTPSHSNHPSRKQKRSSLNVP-AQQSSQLMLVSCGEGLDDGTATQDPST-------DAINHLIFW 1179          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Celegans
Match: unc-16 (JNK-interacting protein [Source:UniProtKB/Swiss-Prot;Acc:P34609])

HSP 1 Score: 104.76 bits (260), Expect = 1.062e-22
Identity = 63/213 (29.58%), Postives = 115/213 (53.99%), Query Frame = 3
Query: 3783 TMWIGLEDGIILVFYSADNVRVTKSK---RKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPI 4412
            T+W+G ++  I + +SA    VT  K   R+I +  AV+S++H+ ++++ +L NG +  F R+  G W  +     ++ S TS ++++  V+  IW T +  +V+++  S++I   F      D + + ++   G  VW++    S + LYHA +YE+L +V+I P V + L        +   + +R T LLV    LW GT  GVI+++P 
Sbjct:  208 TVWMGGQNQYIYI-HSA----VTAWKQCLRRIKMPDAVLSIVHYKSRIFAALANGTIAIFHRNKHGEWSDEGYHSLRVGSATSSVRSLCLVSTNIWATYKNCVVVLDAESLQIVKVFAAHPRKDSQ-VRNMQWVGAGVWLSIRLDSTLRLYHAHTYEHLQDVDIEPYVTKMLGT-----SKLDFSYMRTTALLVSNRRLWIGTGTGVIISVPF 409          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Celegans
Match: unc-16 (JNK-interacting protein [Source:UniProtKB/Swiss-Prot;Acc:P34609])

HSP 1 Score: 104.76 bits (260), Expect = 1.062e-22
Identity = 63/213 (29.58%), Postives = 115/213 (53.99%), Query Frame = 3
Query: 3783 TMWIGLEDGIILVFYSADNVRVTKSK---RKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPI 4412
            T+W+G ++  I + +SA    VT  K   R+I +  AV+S++H+ ++++ +L NG +  F R+  G W  +     ++ S TS ++++  V+  IW T +  +V+++  S++I   F      D + + ++   G  VW++    S + LYHA +YE+L +V+I P V + L        +   + +R T LLV    LW GT  GVI+++P 
Sbjct:  208 TVWMGGQNQYIYI-HSA----VTAWKQCLRRIKMPDAVLSIVHYKSRIFAALANGTIAIFHRNKHGEWSDEGYHSLRVGSATSSVRSLCLVSTNIWATYKNCVVVLDAESLQIVKVFAAHPRKDSQ-VRNMQWVGAGVWLSIRLDSTLRLYHAHTYEHLQDVDIEPYVTKMLGT-----SKLDFSYMRTTALLVSNRRLWIGTGTGVIISVPF 409          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Celegans
Match: unc-16 (JNK-interacting protein [Source:UniProtKB/Swiss-Prot;Acc:P34609])

HSP 1 Score: 104.76 bits (260), Expect = 1.157e-22
Identity = 63/213 (29.58%), Postives = 115/213 (53.99%), Query Frame = 3
Query: 3783 TMWIGLEDGIILVFYSADNVRVTKSK---RKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPI 4412
            T+W+G ++  I + +SA    VT  K   R+I +  AV+S++H+ ++++ +L NG +  F R+  G W  +     ++ S TS ++++  V+  IW T +  +V+++  S++I   F      D + + ++   G  VW++    S + LYHA +YE+L +V+I P V + L        +   + +R T LLV    LW GT  GVI+++P 
Sbjct:  236 TVWMGGQNQYIYI-HSA----VTAWKQCLRRIKMPDAVLSIVHYKSRIFAALANGTIAIFHRNKHGEWSDEGYHSLRVGSATSSVRSLCLVSTNIWATYKNCVVVLDAESLQIVKVFAAHPRKDSQ-VRNMQWVGAGVWLSIRLDSTLRLYHAHTYEHLQDVDIEPYVTKMLGT-----SKLDFSYMRTTALLVSNRRLWIGTGTGVIISVPF 437          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Celegans
Match: unc-16 (JNK-interacting protein [Source:UniProtKB/Swiss-Prot;Acc:P34609])

HSP 1 Score: 104.76 bits (260), Expect = 1.157e-22
Identity = 63/213 (29.58%), Postives = 115/213 (53.99%), Query Frame = 3
Query: 3783 TMWIGLEDGIILVFYSADNVRVTKSK---RKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPI 4412
            T+W+G ++  I + +SA    VT  K   R+I +  AV+S++H+ ++++ +L NG +  F R+  G W  +     ++ S TS ++++  V+  IW T +  +V+++  S++I   F      D + + ++   G  VW++    S + LYHA +YE+L +V+I P V + L        +   + +R T LLV    LW GT  GVI+++P 
Sbjct:  236 TVWMGGQNQYIYI-HSA----VTAWKQCLRRIKMPDAVLSIVHYKSRIFAALANGTIAIFHRNKHGEWSDEGYHSLRVGSATSSVRSLCLVSTNIWATYKNCVVVLDAESLQIVKVFAAHPRKDSQ-VRNMQWVGAGVWLSIRLDSTLRLYHAHTYEHLQDVDIEPYVTKMLGT-----SKLDFSYMRTTALLVSNRRLWIGTGTGVIISVPF 437          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Fly
Match: CG43102 (gene:FBgn0262562 transcript:FBtr0305013)

HSP 1 Score: 372.474 bits (955), Expect = 3.042e-108
Identity = 278/990 (28.08%), Postives = 494/990 (49.90%), Query Frame = 3
Query: 1995 EVDDRILLEKQKVEKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEK---LLDETSIDTIFNKINELMNYHAEFLSILQV----WKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKINA-----VKEAKQDETFLEGQKLLER---LLSPMTMNQNRQFIRHDPVTVEDRKEA---YCIFSFSDQIIVXXXXXXXXXXXXXPPVLRLMTPSGLDFVDNIKYKFISRXXXXXXXXXXXXDTDQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIASQFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKL---VDVPRTPRFNQALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAV-----------------PGYLGSTRRSSLSMDGRFSRPIERKRKQTGEVYQLDTQVETQEDD-----------ADVEQDQSANVDDSNTSQSCS-ESGESETDES----------NNKLVRKISS--------EDSPKNKKLSDPFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVESLDRGHTGNVRFXXXXXXXXXXXXXXXXXXXXXPCTTMATQMK------------------IICGGDGYEDFTSKSNRENNQDIGRDDAINHIQIWDI 4706
            E+  +  L   + + R  ++QE+   E  YV+ L+ +V  ++  LK  +   ++D  ++D IF  + +++  H +FLS L+     W  +  +GD   + FS+  V E YTSF+ N + ++  + +  + + S  KF+E   ++ K KL L  LL++PVQ+ P YELL +RLI++T  D  D  +L D    VH + + IN      ++  +++ T  E + ++E    L++P      RQF+  D V++   + A      F F+D +++T+ K+R     K  P   +   +    +D  KYKF+++I+++ +E  +++D + K ++   E    +D + LQ+I  +   +   HQ ++  I+ L+  V + + E + +     +      +  V++  G +++   F   EK+  WE+   + K KL   ++    P F  ++ I +T++G+QF CA      N    RDVW+C SDG+ G +C++S+  +P VT  + +  CNA+++C+ +V                  G  G   +        +++ +   RK     +Q  +   T   +           A  E   +A    S+T    +  S + ET+ +           + LV ++ S        +DS  N +  +  ++TMWIG EDG I V+ S DN+R+ K++ KI+  SAV S+L+ DN+V+VSL NG++  + R     W+   S    + + TSP+  ++ V G +W + Q  I +++  ++ + N   +  S+D +PI+++  S   VWI+ +NS+ I  +H+ +++ + EVN+ PAV + L   D+II +HK ACLR+T LL CKD++W GTSAGV+LTIP           NI+   +     GHTG+VRFL  +E++      S         ++ + +                    II GGDGYEDF +      ++  GR+D+ NH+ IW I
Sbjct:  140 EISSKWNLGGYEGDTRTYVVQEIYRNEQSYVESLQTVVVKYLKVLKAPEHAGMIDTRTVDEIFFMVPDILEIHEKFLSDLKSRLDDWDVQQKVGDAFMDTFSKLEVLEVYTSFVNNCNRAKNAIRSMKHQRPSFSKFLETTAREHKGKLTLDNLLIKPVQKFPNYELLFQRLIKHTDHDHPDTKHLQDVLKLVHDILVHINCKEREIMENGQREATLRELEGVIEGITDLIAP-----ERQFLLFDLVSMPSGQGARKDRGFFLFNDLLVLTSIKKRSGTIRK--PNSSICPGTVATTLDTNKYKFLTKISLDCLEIVKSKDENIKRIVSEIETL-AEDCNKLQQITDITVTIKYPHQYLEDVIRELHREVQRQLSERQTNDTQLNM-----LELTVSSPNGNQKLAVVFSKTEKRTQWEESFNEAKQKLAATLERHPIPEFLTSIPIRKTRAGLQFTCAAATLSDN----RDVWVCNSDGYVGQVCIMSLHPEPNVTSCNGV--CNARILCVASVPAYSSAASSRNSSSEQPAGSGGQEEKDKRHTPQSYTQQLRDYRKSISPSFQSASASATATPEKKKLTPTPTPVAGGEPADAATTGGSDTQLELNLSSSDDETEAAAASLNVAGSTGSTLVERVPSPAPSYHGHQDS--NPEEGESNQSTMWIGTEDGCIHVYNSTDNIRIKKNRIKIEHHSAVYSILYLDNRVFVSLANGDICVYLRDGATSWNTCSSHCLSIGTVTSPVNKLLNVNGRLWCSIQGIIKVLDVETLTVVNQIQI--SSDSKPITNMTVSNNHVWISIQNSAHIKCFHSNTHQLVTEVNLAPAVNKMLSNCDEIIRQHKAACLRVTSLLCCKDLIWIGTSAGVLLTIPAQGYEKGA--INIVPTGIP---HGHTGHVRFLTFVETTGLEGAASGAGGGRDAGSSNSDEYTKQGSIKHSKSKSETNNTLIISGGDGYEDFRNSGANSLSEIAGREDSTNHLLIWQI 1101          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Fly
Match: CG43102 (gene:FBgn0262562 transcript:FBtr0305012)

HSP 1 Score: 374.4 bits (960), Expect = 2.340e-106
Identity = 281/996 (28.21%), Postives = 501/996 (50.30%), Query Frame = 3
Query: 1986 ILEEVDDRILLEKQK---VEKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEK---LLDETSIDTIFNKINELMNYHAEFLSILQV----WKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKINA-----VKEAKQDETFLEGQKLLER---LLSPMTMNQNRQFIRHDPVTVEDRKEA---YCIFSFSDQIIVXXXXXXXXXXXXXPPVLRLMTPSGLDFVDNIKYKFISRXXXXXXXXXXXXDTDQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIASQFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKL---VDVPRTPRFNQALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAV-----------------PGYLGSTRRSSLSMDGRFSRPIERKRKQTGEVYQLDTQVETQEDD-----------ADVEQDQSANVDDSNTSQSCS-ESGESETDES----------NNKLVRKISS--------EDSPKNKKLSDPFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVESLDRGHTGNVRFXXXXXXXXXXXXXXXXXXXXXPCTTMATQMK------------------IICGGDGYEDFTSKSNRENNQDIGRDDAINHIQIWDI 4706
            +L+   + ++ E++K    + R  ++QE+   E  YV+ L+ +V  ++  LK  +   ++D  ++D IF  + +++  H +FLS L+     W  +  +GD   + FS+  V E YTSF+ N + ++  + +  + + S  KF+E   ++ K KL L  LL++PVQ+ P YELL +RLI++T  D  D  +L D    VH + + IN      ++  +++ T  E + ++E    L++P      RQF+  D V++   + A      F F+D +++T+ K+R     K  P   +   +    +D  KYKF+++I+++ +E  +++D + K ++   E    +D + LQ+I  +   +   HQ ++  I+ L+  V + + E + +    T  N +  +  V++  G +++   F   EK+  WE+   + K KL   ++    P F  ++ I +T++G+QF CA      N    RDVW+C SDG+ G +C++S+  +P VT  + +  CNA+++C+ +V                  G  G   +        +++ +   RK     +Q  +   T   +           A  E   +A    S+T    +  S + ET+ +           + LV ++ S        +DS  N +  +  ++TMWIG EDG I V+ S DN+R+ K++ KI+  SAV S+L+ DN+V+VSL NG++  + R     W+   S    + + TSP+  ++ V G +W + Q  I +++  ++ + N   +  S+D +PI+++  S   VWI+ +NS+ I  +H+ +++ + EVN+ PAV + L   D+II +HK ACLR+T LL CKD++W GTSAGV+LTIP           NI+      +  GHTG+VRFL  +E++      S         ++ + +                    II GGDGYEDF +      ++  GR+D+ NH+ IW I
Sbjct:  575 LLKGSSENMISEQRKKTIADTRTYVVQEIYRNEQSYVESLQTVVVKYLKVLKAPEHAGMIDTRTVDEIFFMVPDILEIHEKFLSDLKSRLDDWDVQQKVGDAFMDTFSKLEVLEVYTSFVNNCNRAKNAIRSMKHQRPSFSKFLETTAREHKGKLTLDNLLIKPVQKFPNYELLFQRLIKHTDHDHPDTKHLQDVLKLVHDILVHINCKEREIMENGQREATLRELEGVIEGITDLIAP-----ERQFLLFDLVSMPSGQGARKDRGFFLFNDLLVLTSIKKRSGTIRK--PNSSICPGTVATTLDTNKYKFLTKISLDCLEIVKSKDENIKRIVSEIETL-AEDCNKLQQITDITVTIKYPHQYLEDVIRELHREVQRQLSERQTND---TQLNML--ELTVSSPNGNQKLAVVFSKTEKRTQWEESFNEAKQKLAATLERHPIPEFLTSIPIRKTRAGLQFTCAAATLSDN----RDVWVCNSDGYVGQVCIMSLHPEPNVTSCNGV--CNARILCVASVPAYSSAASSRNSSSEQPAGSGGQEEKDKRHTPQSYTQQLRDYRKSISPSFQSASASATATPEKKKLTPTPTPVAGGEPADAATTGGSDTQLELNLSSSDDETEAAAASLNVAGSTGSTLVERVPSPAPSYHGHQDS--NPEEGESNQSTMWIGTEDGCIHVYNSTDNIRIKKNRIKIEHHSAVYSILYLDNRVFVSLANGDICVYLRDGATSWNTCSSHCLSIGTVTSPVNKLLNVNGRLWCSIQGIIKVLDVETLTVVNQIQI--SSDSKPITNMTVSNNHVWISIQNSAHIKCFHSNTHQLVTEVNLAPAVNKMLSNCDEIIRQHKAACLRVTSLLCCKDLIWIGTSAGVLLTIPAQGYEKGA--INIVP---TGIPHGHTGHVRFLTFVETTGLEGAASGAGGGRDAGSSNSDEYTKQGSIKHSKSKSETNNTLIISGGDGYEDFRNSGANSLSEIAGREDSTNHLLIWQI 1542          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Fly
Match: CG43102 (gene:FBgn0262562 transcript:FBtr0344631)

HSP 1 Score: 374.4 bits (960), Expect = 1.241e-105
Identity = 283/995 (28.44%), Postives = 499/995 (50.15%), Query Frame = 3
Query: 1986 ILEEVDDRILLEKQK---VEKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEK---LLDETSIDTIFNKINELMNYHAEFLSILQV----WKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKINAVKEAKQDETFLEGQ-----KLLERLLSPMT--MNQNRQFIRHDPVTVEDRKEA---YCIFSFSDQIIVXXXXXXXXXXXXXPPVLRLMTPSGLDFVDNIKYKFISRXXXXXXXXXXXXDTDQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIASQFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKL---VDVPRTPRFNQALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAV-----------------PGYLGSTRRSSLSMDGRFSRPIERKRKQTGEVYQLDTQVETQEDD-----------ADVEQDQSANVDDSNTSQSCS-ESGESETDES----------NNKLVRKISS--------EDSPKNKKLSDPFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVESLDRGHTGNVRFXXXXXXXXXXXXXXXXXXXXXPCTTMATQMK------------------IICGGDGYEDFTSKSNRENNQDIGRDDAINHIQIWDI 4706
            +L+   + ++ E++K    + R  ++QE+   E  YV+ L+ +V  ++  LK  +   ++D  ++D IF  + +++  H +FLS L+     W  +  +GD   + FS+  V E YTSF+ N + ++  + +  + + S  KF+E   ++ K KL L  LL++PVQ+ P YELL +RLI++T  D  D  +L D    VH + + IN     K+ E    GQ     + LE ++  +T  +   RQF+  D V++   + A      F F+D +++T+ K+R     K  P   +   +    +D  KYKF+++I+++ +E  +++D + K ++   E    +D + LQ+I  +   +   HQ ++  I+ L+  V + + E + +    T  N +  +  V++  G +++   F   EK+  WE+   + K KL   ++    P F  ++ I +T++G+QF CA      N    RDVW+C SDG+ G +C++S+  +P VT  + +  CNA+++C+ +V                  G  G   +        +++ +   RK     +Q  +   T   +           A  E   +A    S+T    +  S + ET+ +           + LV ++ S        +DS  N +  +  ++TMWIG EDG I V+ S DN+R+ K++ KI+  SAV S+L+ DN+V+VSL NG++  + R     W+   S    + + TSP+  ++ V G +W + Q  I +++  ++ + N   +  S+D +PI+++  S   VWI+ +NS+ I  +H+ +++ + EVN+ PAV + L   D+II +HK ACLR+T LL CKD++W GTSAGV+LTIP           NI+      +  GHTG+VRFL  +E++      S         ++ + +                    II GGDGYEDF +      ++  GR+D+ NH+ IW I
Sbjct:  908 LLKGSSENMISEQRKKTIADTRTYVVQEIYRNEQSYVESLQTVVVKYLKVLKAPEHAGMIDTRTVDEIFFMVPDILEIHEKFLSDLKSRLDDWDVQQKVGDAFMDTFSKLEVLEVYTSFVNNCNRAKNAIRSMKHQRPSFSKFLETTAREHKGKLTLDNLLIKPVQKFPNYELLFQRLIKHTDHDHPDTKHLQDVLKLVHDILVHIN----CKEREIMENGQREATLRELEGVIEGITDLIAPERQFLLFDLVSMPSGQGARKDRGFFLFNDLLVLTSIKKRSGTIRK--PNSSICPGTVATTLDTNKYKFLTKISLDCLEIVKSKDENIKRIVSEIETL-AEDCNKLQQITDITVTIKYPHQYLEDVIRELHREVQRQLSERQTND---TQLNML--ELTVSSPNGNQKLAVVFSKTEKRTQWEESFNEAKQKLAATLERHPIPEFLTSIPIRKTRAGLQFTCAAATLSDN----RDVWVCNSDGYVGQVCIMSLHPEPNVTSCNGV--CNARILCVASVPAYSSAASSRNSSSEQPAGSGGQEEKDKRHTPQSYTQQLRDYRKSISPSFQSASASATATPEKKKLTPTPTPVAGGEPADAATTGGSDTQLELNLSSSDDETEAAAASLNVAGSTGSTLVERVPSPAPSYHGHQDS--NPEEGESNQSTMWIGTEDGCIHVYNSTDNIRIKKNRIKIEHHSAVYSILYLDNRVFVSLANGDICVYLRDGATSWNTCSSHCLSIGTVTSPVNKLLNVNGRLWCSIQGIIKVLDVETLTVVNQIQI--SSDSKPITNMTVSNNHVWISIQNSAHIKCFHSNTHQLVTEVNLAPAVNKMLSNCDEIIRQHKAACLRVTSLLCCKDLIWIGTSAGVLLTIPAQGYEKGA--INIVP---TGIPHGHTGHVRFLTFVETTGLEGAASGAGGGRDAGSSNSDEYTKQGSIKHSKSKSETNNTLIISGGDGYEDFRNSGANSLSEIAGREDSTNHLLIWQI 1875          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Fly
Match: CG43102 (gene:FBgn0262562 transcript:FBtr0330032)

HSP 1 Score: 374.4 bits (960), Expect = 2.735e-105
Identity = 283/995 (28.44%), Postives = 499/995 (50.15%), Query Frame = 3
Query: 1986 ILEEVDDRILLEKQK---VEKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEK---LLDETSIDTIFNKINELMNYHAEFLSILQV----WKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKINAVKEAKQDETFLEGQ-----KLLERLLSPMT--MNQNRQFIRHDPVTVEDRKEA---YCIFSFSDQIIVXXXXXXXXXXXXXPPVLRLMTPSGLDFVDNIKYKFISRXXXXXXXXXXXXDTDQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIASQFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKL---VDVPRTPRFNQALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAV-----------------PGYLGSTRRSSLSMDGRFSRPIERKRKQTGEVYQLDTQVETQEDD-----------ADVEQDQSANVDDSNTSQSCS-ESGESETDES----------NNKLVRKISS--------EDSPKNKKLSDPFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVESLDRGHTGNVRFXXXXXXXXXXXXXXXXXXXXXPCTTMATQMK------------------IICGGDGYEDFTSKSNRENNQDIGRDDAINHIQIWDI 4706
            +L+   + ++ E++K    + R  ++QE+   E  YV+ L+ +V  ++  LK  +   ++D  ++D IF  + +++  H +FLS L+     W  +  +GD   + FS+  V E YTSF+ N + ++  + +  + + S  KF+E   ++ K KL L  LL++PVQ+ P YELL +RLI++T  D  D  +L D    VH + + IN     K+ E    GQ     + LE ++  +T  +   RQF+  D V++   + A      F F+D +++T+ K+R     K  P   +   +    +D  KYKF+++I+++ +E  +++D + K ++   E    +D + LQ+I  +   +   HQ ++  I+ L+  V + + E + +    T  N +  +  V++  G +++   F   EK+  WE+   + K KL   ++    P F  ++ I +T++G+QF CA      N    RDVW+C SDG+ G +C++S+  +P VT  + +  CNA+++C+ +V                  G  G   +        +++ +   RK     +Q  +   T   +           A  E   +A    S+T    +  S + ET+ +           + LV ++ S        +DS  N +  +  ++TMWIG EDG I V+ S DN+R+ K++ KI+  SAV S+L+ DN+V+VSL NG++  + R     W+   S    + + TSP+  ++ V G +W + Q  I +++  ++ + N   +  S+D +PI+++  S   VWI+ +NS+ I  +H+ +++ + EVN+ PAV + L   D+II +HK ACLR+T LL CKD++W GTSAGV+LTIP           NI+      +  GHTG+VRFL  +E++      S         ++ + +                    II GGDGYEDF +      ++  GR+D+ NH+ IW I
Sbjct: 1481 LLKGSSENMISEQRKKTIADTRTYVVQEIYRNEQSYVESLQTVVVKYLKVLKAPEHAGMIDTRTVDEIFFMVPDILEIHEKFLSDLKSRLDDWDVQQKVGDAFMDTFSKLEVLEVYTSFVNNCNRAKNAIRSMKHQRPSFSKFLETTAREHKGKLTLDNLLIKPVQKFPNYELLFQRLIKHTDHDHPDTKHLQDVLKLVHDILVHIN----CKEREIMENGQREATLRELEGVIEGITDLIAPERQFLLFDLVSMPSGQGARKDRGFFLFNDLLVLTSIKKRSGTIRK--PNSSICPGTVATTLDTNKYKFLTKISLDCLEIVKSKDENIKRIVSEIETL-AEDCNKLQQITDITVTIKYPHQYLEDVIRELHREVQRQLSERQTND---TQLNML--ELTVSSPNGNQKLAVVFSKTEKRTQWEESFNEAKQKLAATLERHPIPEFLTSIPIRKTRAGLQFTCAAATLSDN----RDVWVCNSDGYVGQVCIMSLHPEPNVTSCNGV--CNARILCVASVPAYSSAASSRNSSSEQPAGSGGQEEKDKRHTPQSYTQQLRDYRKSISPSFQSASASATATPEKKKLTPTPTPVAGGEPADAATTGGSDTQLELNLSSSDDETEAAAASLNVAGSTGSTLVERVPSPAPSYHGHQDS--NPEEGESNQSTMWIGTEDGCIHVYNSTDNIRIKKNRIKIEHHSAVYSILYLDNRVFVSLANGDICVYLRDGATSWNTCSSHCLSIGTVTSPVNKLLNVNGRLWCSIQGIIKVLDVETLTVVNQIQI--SSDSKPITNMTVSNNHVWISIQNSAHIKCFHSNTHQLVTEVNLAPAVNKMLSNCDEIIRQHKAACLRVTSLLCCKDLIWIGTSAGVLLTIPAQGYEKGA--INIVP---TGIPHGHTGHVRFLTFVETTGLEGAASGAGGGRDAGSSNSDEYTKQGSIKHSKSKSETNNTLIISGGDGYEDFRNSGANSLSEIAGREDSTNHLLIWQI 2448          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Fly
Match: CG43102 (gene:FBgn0262562 transcript:FBtr0305009)

HSP 1 Score: 374.4 bits (960), Expect = 2.853e-105
Identity = 283/995 (28.44%), Postives = 499/995 (50.15%), Query Frame = 3
Query: 1986 ILEEVDDRILLEKQK---VEKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEK---LLDETSIDTIFNKINELMNYHAEFLSILQV----WKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKINAVKEAKQDETFLEGQ-----KLLERLLSPMT--MNQNRQFIRHDPVTVEDRKEA---YCIFSFSDQIIVXXXXXXXXXXXXXPPVLRLMTPSGLDFVDNIKYKFISRXXXXXXXXXXXXDTDQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIASQFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKL---VDVPRTPRFNQALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAV-----------------PGYLGSTRRSSLSMDGRFSRPIERKRKQTGEVYQLDTQVETQEDD-----------ADVEQDQSANVDDSNTSQSCS-ESGESETDES----------NNKLVRKISS--------EDSPKNKKLSDPFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVESLDRGHTGNVRFXXXXXXXXXXXXXXXXXXXXXPCTTMATQMK------------------IICGGDGYEDFTSKSNRENNQDIGRDDAINHIQIWDI 4706
            +L+   + ++ E++K    + R  ++QE+   E  YV+ L+ +V  ++  LK  +   ++D  ++D IF  + +++  H +FLS L+     W  +  +GD   + FS+  V E YTSF+ N + ++  + +  + + S  KF+E   ++ K KL L  LL++PVQ+ P YELL +RLI++T  D  D  +L D    VH + + IN     K+ E    GQ     + LE ++  +T  +   RQF+  D V++   + A      F F+D +++T+ K+R     K  P   +   +    +D  KYKF+++I+++ +E  +++D + K ++   E    +D + LQ+I  +   +   HQ ++  I+ L+  V + + E + +    T  N +  +  V++  G +++   F   EK+  WE+   + K KL   ++    P F  ++ I +T++G+QF CA      N    RDVW+C SDG+ G +C++S+  +P VT  + +  CNA+++C+ +V                  G  G   +        +++ +   RK     +Q  +   T   +           A  E   +A    S+T    +  S + ET+ +           + LV ++ S        +DS  N +  +  ++TMWIG EDG I V+ S DN+R+ K++ KI+  SAV S+L+ DN+V+VSL NG++  + R     W+   S    + + TSP+  ++ V G +W + Q  I +++  ++ + N   +  S+D +PI+++  S   VWI+ +NS+ I  +H+ +++ + EVN+ PAV + L   D+II +HK ACLR+T LL CKD++W GTSAGV+LTIP           NI+      +  GHTG+VRFL  +E++      S         ++ + +                    II GGDGYEDF +      ++  GR+D+ NH+ IW I
Sbjct: 1481 LLKGSSENMISEQRKKTIADTRTYVVQEIYRNEQSYVESLQTVVVKYLKVLKAPEHAGMIDTRTVDEIFFMVPDILEIHEKFLSDLKSRLDDWDVQQKVGDAFMDTFSKLEVLEVYTSFVNNCNRAKNAIRSMKHQRPSFSKFLETTAREHKGKLTLDNLLIKPVQKFPNYELLFQRLIKHTDHDHPDTKHLQDVLKLVHDILVHIN----CKEREIMENGQREATLRELEGVIEGITDLIAPERQFLLFDLVSMPSGQGARKDRGFFLFNDLLVLTSIKKRSGTIRK--PNSSICPGTVATTLDTNKYKFLTKISLDCLEIVKSKDENIKRIVSEIETL-AEDCNKLQQITDITVTIKYPHQYLEDVIRELHREVQRQLSERQTND---TQLNML--ELTVSSPNGNQKLAVVFSKTEKRTQWEESFNEAKQKLAATLERHPIPEFLTSIPIRKTRAGLQFTCAAATLSDN----RDVWVCNSDGYVGQVCIMSLHPEPNVTSCNGV--CNARILCVASVPAYSSAASSRNSSSEQPAGSGGQEEKDKRHTPQSYTQQLRDYRKSISPSFQSASASATATPEKKKLTPTPTPVAGGEPADAATTGGSDTQLELNLSSSDDETEAAAASLNVAGSTGSTLVERVPSPAPSYHGHQDS--NPEEGESNQSTMWIGTEDGCIHVYNSTDNIRIKKNRIKIEHHSAVYSILYLDNRVFVSLANGDICVYLRDGATSWNTCSSHCLSIGTVTSPVNKLLNVNGRLWCSIQGIIKVLDVETLTVVNQIQI--SSDSKPITNMTVSNNHVWISIQNSAHIKCFHSNTHQLVTEVNLAPAVNKMLSNCDEIIRQHKAACLRVTSLLCCKDLIWIGTSAGVLLTIPAQGYEKGA--INIVP---TGIPHGHTGHVRFLTFVETTGLEGAASGAGGGRDAGSSNSDEYTKQGSIKHSKSKSETNNTLIISGGDGYEDFRNSGANSLSEIAGREDSTNHLLIWQI 2448          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Zebrafish
Match: ARHGEF17 (si:ch211-248g20.5 [Source:NCBI gene;Acc:100002227])

HSP 1 Score: 206.068 bits (523), Expect = 1.131e-57
Identity = 121/337 (35.91%), Postives = 193/337 (57.27%), Query Frame = 3
Query: 3768 DPFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVE-SLDRGHTGNVRF---------------------XXXXXXXXXXXXXXXXXXXXXPCTTMATQ--MKIICGGDGYEDFTSKSNRENNQDIGRDDAINHIQIWDI 4706
            + +++++W+G EDG I V+ S+DN+R  K+  K+   ++V+ +L+ DNKV+VSL NGE++ ++R    +WD   S    L S + P+  M+ V G +W   Q  I+IIN +++  E+ F + + +  R ++ + C G+ VWI  + S+++ LYH+++YE L EV++ PAV + L   D II +HK ACLRIT LL CKD+LW GTSAGV+LT+ +P V++ST   ++  P +      GHTG+VRF                       +   S     Q          T + T+  + +I GGDGYEDF   ++ E    +GRDD+ NH+ +W +
Sbjct:   58 EAYQSSVWLGTEDGCIHVYQSSDNIRNRKNSMKMQHSASVLCILYLDNKVFVSLANGEVIVYQREAGSFWDPQSSQTLCLGSPSGPVTKMVPVAGKLWCGCQNRILIINTSTLTQEHWFQVGQ-DSGRCVTSMVCFGKGVWIALQGSAQVRLYHSSTYESLTEVDVAPAVHKMLAGSDAIIRQHKAACLRITALLACKDLLWIGTSAGVVLTLVVPPVSSSTGSGSLRVPLIPMGSAHGHTGHVRFLTCIELPEGFDVSFPPPAESASQNSSDSGTGGLQRRDSARRRASTLLPTKSNLLVISGGDGYEDFRLTNSSET---VGRDDSTNHLLLWRV 390          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Zebrafish
Match: ARHGEF17 (si:ch211-248g20.5 [Source:NCBI gene;Acc:100002227])

HSP 1 Score: 213.001 bits (541), Expect = 1.067e-55
Identity = 123/339 (36.28%), Postives = 194/339 (57.23%), Query Frame = 3
Query: 3768 DP--FKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVE-SLDRGHTGNVRF---------------------XXXXXXXXXXXXXXXXXXXXXPCTTMATQ--MKIICGGDGYEDFTSKSNRENNQDIGRDDAINHIQIWDI 4706
            DP  +++++W+G EDG I V+ S+DN+R  K+  K+   ++V+ +L+ DNKV+VSL NGE++ ++R    +WD   S    L S + P+  M+ V G +W   Q  I+IIN +++  E+ F + + +  R ++ + C G+ VWI  + S+++ LYH+++YE L EV++ PAV + L   D II +HK ACLRIT LL CKD+LW GTSAGV+LT+ +P V++ST   ++  P +      GHTG+VRF                       +   S     Q          T + T+  + +I GGDGYEDF   ++ E    +GRDD+ NH+ +W +
Sbjct:  657 DPEAYQSSVWLGTEDGCIHVYQSSDNIRNRKNSMKMQHSASVLCILYLDNKVFVSLANGEVIVYQREAGSFWDPQSSQTLCLGSPSGPVTKMVPVAGKLWCGCQNRILIINTSTLTQEHWFQVGQ-DSGRCVTSMVCFGKGVWIALQGSAQVRLYHSSTYESLTEVDVAPAVHKMLAGSDAIIRQHKAACLRITALLACKDLLWIGTSAGVVLTLVVPPVSSSTGSGSLRVPLIPMGSAHGHTGHVRFLTCIELPEGFDVSFPPPAESASQNSSDSGTGGLQRRDSARRRASTLLPTKSNLLVISGGDGYEDFRLTNSSET---VGRDDSTNHLLLWRV 991          

HSP 2 Score: 209.534 bits (532), Expect = 1.423e-54
Identity = 159/519 (30.64%), Postives = 271/519 (52.22%), Query Frame = 3
Query: 2040 RYLIIQELLSVESEYVKVLEILVNHFMVPLKLEK---LLDETSIDTIFNKINELMNYHAEFLS----ILQVWKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKR-LIEYTPSDSDDYNYLLDAQTAVHQLAIKINAVKEAKQD-----------ETFLEGQKLLERLLSPMTMNQNRQFIRHDPV----TVEDRKEAYCIFSFSDQIIVXXXXXXXXXXXXXPPVLRLMTPSGLDFVD-NIKYKFISR------XXXXXXXXXXXXDTDQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIASQFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKLV--DVPRTPRFNQALSITRTQSGMQFCCA-----CPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAVPG 3485
            R  ++  LL  E  YV+ L  L+  +M PLK  +   L D + +D +F +I E++ +H +FL      +  W  K TIG  + + FS+  +   Y+++I+NF  ++  +  A  +K +  KF+EQ  ++++ K  L  L+++PVQRIPRYELL+K+ L+++TP D  DY +LLDAQ  + +LA +IN  + + ++           E  +EG   +E +L+P      R+F+R + V    TV  +K+   +F FSD +I TT KR+     +    L     S    +D + KYKF+ +        ++      N +  QK + R  E     DLS L ++  L   L   HQ +D  IK L A+V +++ E ++   + T+   + ++  ++         F F + + + ++E+  ++ K KL        P F +A+ I +T+SGMQF CA     CP   Y      +VW+C SDG+ G +CLL+++ +P  T+ + +  C+A++ICI  VPG
Sbjct:    3 RRHVMMNLLDAEQSYVESLRTLIQGYMKPLKHPENPPLCDPSLVDEMFYQIPEILEHHEQFLEQVLDCVHQWHDKQTIGHVLIQSFSKETLANIYSAYIDNFMNAKDAVRIAKEAKPAFLKFLEQSMRENREKQALGDLMIKPVQRIPRYELLVKQDLLKHTPEDHPDYLFLLDAQKNIKRLAERINKGRRSAEELERETRVMQEIEAHIEG---VEHILNP-----QRKFLRQEMVVEAKTVGGKKD-RSLFLFSDLLICTTLKRKSGSLRRSSMSLY----SAASVIDTSSKYKFLWKLPLEDIEVVKGSNQATNRENVQKTISRLDE-----DLSTLGQVSKLSETLSFPHQSLDDVIKDLMASVHRELAEKQSLAFSMTL---LPTKLELSCTSAESSFIFEFSSPDTRSNFEQAFEEAKKKLAMNKDQWDPEFLKAIPIMKTRSGMQFSCASPSHSCPENTY------EVWVCNSDGYVGQVCLLNIRDEP--TVEACIAVCSARIICIATVPG 492          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Zebrafish
Match: SPAG9 (sperm associated antigen 9b [Source:NCBI gene;Acc:100333761])

HSP 1 Score: 114.775 bits (286), Expect = 4.666e-25
Identity = 82/305 (26.89%), Postives = 140/305 (45.90%), Query Frame = 3
Query: 3783 TMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKV---ESLDR--------------------GHTGNVRFXXXXXXXXXXXXXXXXXXXXXPCTTMATQMKIICGGDGYEDF 4628
            TMW+G ++G + V  S    R  K    I L  +V+ ++H   +V V+L +G L  F R ++G WDL    +  L      I+ M  V   +W   +  I +++P ++KIE +F       +  +  LA  G  +W++    S + L+HA ++++L +V+I P V + L        +   + +RIT L+V    LW GT  GVI++IP+ + T +++K      +V   ES D+                    GH   V+F              + + S SP   +   + ++ GG+GY DF
Sbjct:  902 TMWLGAQNGCVYVHSSVAQWR--KCLHSIKLKDSVLGIVHVKGRVLVALADGTLAIFHRGVDGQWDLSNYHLLDLGRPHHSIRCMTMVHDKVWCGYRNKIFVVHPKAMKIEKSFD-AHPRKESQVRQLAWDGDGIWVSIRLDSTLRLFHAHTHQHLQDVDIEPYVSKMLGTG-----KLGFSFVRITALMVSCSRLWIGTGNGVIISIPLTDNTAASSKQPGTAIRVYGDESGDKVTTGTFVPFCSMAHAQLCFHGHRDAVKF----------FTAIADKSSESPTPELVKSVLVMSGGEGYIDF 1188          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Zebrafish
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:ZFIN;Acc:ZDB-GENE-090303-6])

HSP 1 Score: 113.235 bits (282), Expect = 1.654e-24
Identity = 66/210 (31.43%), Postives = 110/210 (52.38%), Query Frame = 3
Query: 3783 TMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPI 4412
            TMW+G ++G + V  +  N +  K    I L  +V+S++H   +V V+L +G L  F R  +G WDL    +  L      I+ M  V   +W  ++  I +I P S++IE +F      + + +  LA  G  VW++    S + LYHA ++++L +V+I P V + L        +   + +RIT LL+  + LW GT  GVI++IP+
Sbjct:  939 TMWLGAQNGWLYVHSAVSNWK--KCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRSEDGQWDLSNYHLMDLGRPHHSIRCMAVVHDKVWCGNKNKIHVIQPKSMQIEKSFDAHPRKESQ-VRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTG-----KLGFSFVRITALLIGGNRLWVGTGNGVIISIPL 1140          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Zebrafish
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:ZFIN;Acc:ZDB-GENE-090303-6])

HSP 1 Score: 113.235 bits (282), Expect = 1.665e-24
Identity = 75/266 (28.20%), Postives = 129/266 (48.50%), Query Frame = 3
Query: 3624 EQDQSANVDD---SNTSQSCSESGESETDESNNKLVRKISSEDSPKNKKLSDPFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPI 4412
            E   S N D    S T    +++  SE   +  K+    +  +   +++       TMW+G ++G + V  +  N +  K    I L  +V+S++H   +V V+L +G L  F R  +G WDL    +  L      I+ M  V   +W  ++  I +I P S++IE +F      + + +  LA  G  VW++    S + LYHA ++++L +V+I P V + L        +   + +RIT LL+  + LW GT  GVI++IP+
Sbjct:  897 EAGPSENADSTLGSFTEHVFTDNTHSEPGVAKEKVSSAPADSEEAADERAGTSAAPTMWLGAQNGWLYVHSAVSNWK--KCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRSEDGQWDLSNYHLMDLGRPHHSIRCMAVVHDKVWCGNKNKIHVIQPKSMQIEKSFDAHPRKESQ-VRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTG-----KLGFSFVRITALLIGGNRLWVGTGNGVIISIPL 1154          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Xenopus
Match: ARHGEF17 (Rho guanine nucleotide exchange factor 17 [Source:NCBI gene;Acc:100489655])

HSP 1 Score: 217.238 bits (552), Expect = 7.836e-57
Identity = 164/516 (31.78%), Postives = 277/516 (53.68%), Query Frame = 3
Query: 2028 KVEKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEK---LLDETSIDTIFNKINELMNYHAEFLS----ILQVWKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKIN----AVKEAKQD-------ETFLEGQKLLERLLSPMTMNQNRQFIRHDPV----TVEDRKEAYCIFSFSDQIIVXXXXXXXXXXXXXPPVLRLMTPSGLDFVDNIKYKFISRXXX-----XXXXXXXXXDTDQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIASQFLVTTK-EGIERMEFTFGTIEKKLSWEKIVKDLKTKLVDVPRT--PRFNQALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAVPG 3485
            +++ R  +   LL  E  YV+ L  L+  +M  LK  +   L D + +D IF++I EL+ +H +FL      +Q W    T+GD + + FS+  +   Y+++I+NF  ++  +  A  ++ +  KF+EQ  +++K K  L  L+++PVQRIPRYEL++K L+++TP D  D+  LLDAQ  V QLA +IN    + +EA++D       E+ +EG   +E L +P      R+F+R + V     V  +KE   +F F+D +I TT KR+     +    + L T + +  + +        +       +      N D+ QK++ R  E     DLS + +I  L   L   HQ +D  IK + A+V +++ E ++  ++ T+++      L TTK +G E   F F   E +L +E+  +D K KLV       P F +A+ I +T+SGMQF CA P        + +VW+C SDG+ G +CLLS++ +P  ++ + +  C+A+++CI +VPG
Sbjct:   64 QIDMRKHVFLTLLDTEQSYVESLRTLMESYMKALKQPENSFLCDPSLVDEIFDQIPELLEHHEQFLEQVNHCVQNWGEIQTVGDVLVQSFSKEILVSIYSAYIDNFLNAKDAIRAAKEARPAFIKFLEQCTRENKEKQALSDLMIKPVQRIPRYELIVKDLLKHTPKDHPDHPCLLDAQRNVKQLAERINRGMRSAEEAERDIRILQDIESHIEG---MEDLQAPF-----RRFVRQEMVVEAKAVGGKKE-RSLFLFTDLLICTTLKRKSGSLRRSS--MSLYTAASVIDISSKYKLLWKLLLEDVDIVKGTSQASNRDSIQKIIGRLDE-----DLSTMGQISKLSETLSFPHQSLDDVIKDMMASVHRELAEKQS--LSFTMSSPPNKVELSTTKADGTESFIFEFSNPEARLHFEQGFEDAKKKLVSSKNRLDPEFLKAIPIMKTRSGMQFSCASPSHSCLE-NVHEVWVCNSDGYVGQVCLLSIKNEP--SVEACIAVCSARILCIASVPG 558          

HSP 2 Score: 216.083 bits (549), Expect = 2.257e-56
Identity = 123/330 (37.27%), Postives = 191/330 (57.88%), Query Frame = 3
Query: 3780 ATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVESLDRGHTGNVRFXXXXX---------------------XXXXXXXXXXXXXXXXPCTTMATQMKIICGGDGYEDFTSKSNRENNQDIGRDDAINHIQIWDI 4706
            ++MW+G EDG + V+ S+DN+R  K+  K+   +AV+ +L+ DN+V+VSL NGEL+ ++R    +WD   S    L S   P+  M++V+G +W   Q  ++I N +S+  E+TF + + +  R ++ +  S   +WI  ++S+++ LYHATS+E + EV+I P V + L   D II +HK ACLRIT LL CKD+LW GTSAGV+LT+   + ++S       Q     L +GHTG+VRFL S+E                      +     + S R   SP T   +++ +I GGDGYEDF   ++ E    +GRDD+ NH+ +W +
Sbjct:  716 SSMWLGTEDGCVHVYQSSDNIRNRKNSMKMQHSAAVMCILYLDNQVFVSLANGELIVYQREAGSFWDPQNSKSLPLGSPGGPVTKMVSVSGKLWCGCQNRVIIFNTSSLLQEHTFHIGQ-DQNRNVTCMVSSCVGMWIALQSSAQVRLYHATSFEQMAEVDIAPPVHKMLAGSDAIIRQHKSACLRITALLACKDLLWIGTSAGVVLTLSFASASSSLKG----QLSPVGLSQGHTGHVRFLTSVELPDGFDVSFPLAFVLWVSGNDQASEMEKRDSARYRPSPMTQSKSKILVISGGDGYEDFRLTNSSET---VGRDDSTNHLLLWRV 1037          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Xenopus
Match: cldn2 (claudin 2 [Source:Xenbase;Acc:XB-GENE-994508])

HSP 1 Score: 109.768 bits (273), Expect = 2.671e-23
Identity = 67/221 (30.32%), Postives = 113/221 (51.13%), Query Frame = 3
Query: 3783 TMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTN 4445
            TMW+G ++G + V  +  N +  K    I L  +V+S++H   +V V+L +G L  F R  +  WDL    +  L      I+ M  V   +W   +  I +I P +++IE +F      + + +  LA  G  VW++    S + LYHA ++++L +V+I P V + L        +   + +RIT LL+  + LW GT  GV+++IP+    T T KT+
Sbjct:  961 TMWLGAQNGWLYVHSAVSNWK--KCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRGEDKQWDLSNYHLMDLGHTHHSIRCMAVVYDRVWCGYKNKIHVIQPKTMQIEKSFDAHPRRESQ-VRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTG-----KLGFSFVRITALLIAGNRLWVGTGNGVVISIPL----TETNKTS 1169          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Xenopus
Match: cldn2 (claudin 2 [Source:Xenbase;Acc:XB-GENE-994508])

HSP 1 Score: 108.997 bits (271), Expect = 4.832e-23
Identity = 67/221 (30.32%), Postives = 113/221 (51.13%), Query Frame = 3
Query: 3783 TMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTN 4445
            TMW+G ++G + V  +  N +  K    I L  +V+S++H   +V V+L +G L  F R  +  WDL    +  L      I+ M  V   +W   +  I +I P +++IE +F      + + +  LA  G  VW++    S + LYHA ++++L +V+I P V + L        +   + +RIT LL+  + LW GT  GV+++IP+    T T KT+
Sbjct:  873 TMWLGAQNGWLYVHSAVSNWK--KCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRGEDKQWDLSNYHLMDLGHTHHSIRCMAVVYDRVWCGYKNKIHVIQPKTMQIEKSFDAHPRRESQ-VRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTG-----KLGFSFVRITALLIAGNRLWVGTGNGVVISIPL----TETNKTS 1081          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Xenopus
Match: cldn2 (claudin 2 [Source:Xenbase;Acc:XB-GENE-994508])

HSP 1 Score: 108.612 bits (270), Expect = 6.005e-23
Identity = 63/210 (30.00%), Postives = 108/210 (51.43%), Query Frame = 3
Query: 3783 TMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPI 4412
            TMW+G ++G + V  +  N +  K    I L  +V+S++H   +V V+L +G L  F R  +  WDL    +  L      I+ M  V   +W   +  I +I P +++IE +F      + + +  LA  G  VW++    S + LYHA ++++L +V+I P V + L        +   + +RIT LL+  + LW GT  GV+++IP+
Sbjct:  942 TMWLGAQNGWLYVHSAVSNWK--KCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRGEDKQWDLSNYHLMDLGHTHHSIRCMAVVYDRVWCGYKNKIHVIQPKTMQIEKSFDAHPRRESQ-VRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTG-----KLGFSFVRITALLIAGNRLWVGTGNGVVISIPL 1143          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Xenopus
Match: cldn2 (claudin 2 [Source:Xenbase;Acc:XB-GENE-994508])

HSP 1 Score: 108.612 bits (270), Expect = 6.051e-23
Identity = 63/210 (30.00%), Postives = 108/210 (51.43%), Query Frame = 3
Query: 3783 TMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPI 4412
            TMW+G ++G + V  +  N +  K    I L  +V+S++H   +V V+L +G L  F R  +  WDL    +  L      I+ M  V   +W   +  I +I P +++IE +F      + + +  LA  G  VW++    S + LYHA ++++L +V+I P V + L        +   + +RIT LL+  + LW GT  GV+++IP+
Sbjct:  940 TMWLGAQNGWLYVHSAVSNWK--KCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRGEDKQWDLSNYHLMDLGHTHHSIRCMAVVYDRVWCGYKNKIHVIQPKTMQIEKSFDAHPRRESQ-VRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTG-----KLGFSFVRITALLIAGNRLWVGTGNGVVISIPL 1141          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Mouse
Match: Arhgef17 (Rho guanine nucleotide exchange factor (GEF) 17 [Source:MGI Symbol;Acc:MGI:2673002])

HSP 1 Score: 216.468 bits (550), Expect = 7.288e-56
Identity = 158/518 (30.50%), Postives = 263/518 (50.77%), Query Frame = 3
Query: 2022 KQKVEKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEK---LLDETSIDTIFNKINELMNYHAEFLS----ILQVWKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKIN-AVKEAKQD----------ETFLEGQKLLERLLSPMTMNQNRQFIRHD---PVTVEDRKEAYCIFSFSDQIIVXXXXXXXXXXXXXPPVLRLMTPSGLDFVDNI-KYKFISRXXX------XXXXXXXXXDTDQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIASQFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKLVDVPRT--PRFNQALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAVPG 3485
            K +V+ R  +   LL  E  YV+ L  L+  +M PLK  +   L D + +D IF++I EL+ +H +FL      +Q W  +  +G  + + FS+  +   Y+++I+NF  ++  +  A  ++ +  KF+EQ  +++K K  L  L+++PVQRIPRYELL+K L+++TP D  D+  LLDAQ  + Q+A +IN  V+ A++           E  +EG   +E L +P+     R+F+R +    V     K+   +F F+D I+ TT KR+     +    + L T      +D   KYK + ++ +      +      N +T QK + R  E     DL+ L ++  L   L   HQ +D  ++ L A + +D+ E + +            +   T  EG +   F F   + +L +E+   + K KL        P F +A+ I +T+SGMQF CA P          +VW+C SDG+ G +CLLS++ +P V     +  C+A+++CI AVPG
Sbjct: 1054 KPQVDMRKHVTMTLLDTEQSYVESLRTLMQGYMQPLKQPENSLLCDPSLVDEIFDQIPELLEHHEQFLEQVRHCVQTWHAQQKVGALLVQSFSKDVLVNIYSAYIDNFLNAKDAVRVAKEARPAFLKFLEQSMRENKEKQALSDLMIKPVQRIPRYELLVKDLLKHTPEDHPDHPLLLDAQRNIKQVAERINKGVRSAEEAERHARVLQEIEAHIEG---MEDLQAPL-----RRFLRQEMVIEVKAIGGKKDRSLFLFTDLIVCTTLKRKSGSLRRS--SMSLYT--AASVIDTASKYKMLWKLPLEDTDIIKGASQATNRETIQKAISRLDE-----DLATLGQMSKLSESLGFPHQSLDDALRDLSAAMHRDLSE-KQALCCSLAFPPTKLELCATRPEGTDSYIFEFPHPDARLGFEQAFDEAKRKLASSKSCLDPEFLKAIPIMKTRSGMQFSCAAPTFSSCPEPAPEVWVCNSDGYVGQVCLLSLRAEPDVEACIAV--CSARILCIGAVPG 1551          

HSP 2 Score: 215.312 bits (547), Expect = 1.501e-55
Identity = 114/331 (34.44%), Postives = 187/331 (56.50%), Query Frame = 3
Query: 3774 FKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVESLDRGHTGNVRFXXXXXXX-------XXXXXXXXXXXXXXPC------------TTMATQMKIICGGDGYEDFT-SKSNRENNQDIGRDDAINHIQIWDI 4706
            +++++W+G EDG + V+ S+D++R  ++  K+   ++V  +L+ +NKV+VSL NGELV ++R    +WD        L SQ SPI  M++V G +W   Q  +++++P ++++E+TF + + +  R ++ +  S   VW+T + S+ + LYH  ++E L EV++ P V + L   D II +HK ACLRIT LLVC ++LW GTSAGV+LTIP    T S  +  +       L +GHTG+VRFL +++                       P             T+   +M +I GGDG EDF  S     +++ +GRDD+ NH+ +W +
Sbjct: 1731 YQSSVWLGTEDGCVHVYQSSDSIRDRRNSMKLQHAASVTCILYLNNKVFVSLANGELVVYQREAGRFWDPQNFKSMTLGSQGSPITKMVSVGGRLWCGCQNRVLVLSPDTLQLEHTFYVGQ-DSSRSVACMVDSSLGVWVTLKGSAHVCLYHPDTFEQLAEVDVTPPVHRMLAGSDAIIRQHKAACLRITALLVCAELLWVGTSAGVVLTIPTSPSTVSCPRAPL---SPAGLCQGHTGHVRFLAAVQLPEGFNLLCSTPPPPPDTGPEKLPSLDHRDSPRRRGPTSARPKMLVISGGDGSEDFRLSSGGGGSSETVGRDDSTNHLLLWRV 2057          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Mouse
Match: Arhgef17 (Rho guanine nucleotide exchange factor (GEF) 17 [Source:MGI Symbol;Acc:MGI:2673002])

HSP 1 Score: 213.386 bits (542), Expect = 1.108e-55
Identity = 124/375 (33.07%), Postives = 201/375 (53.60%), Query Frame = 3
Query: 3663 SQSCSESGESETDESNNKLVRKISSEDSPKNKKLSD-------PFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVESLDRGHTGNVRFXXXXXXX-------XXXXXXXXXXXXXXPC------------TTMATQMKIICGGDGYEDF-TSKSNRENNQDIGRDDAINHIQIWDI 4706
            S S    G   T   + + +R+ SS  S     L D        +++++W+G EDG + V+ S+D++R  ++  K+   ++V  +L+ +NKV+VSL NGELV ++R    +WD        L SQ SPI  M++V G +W   Q  +++++P ++++E+TF + + +  R ++ +  S   VW+T + S+ + LYH  ++E L EV++ P V + L   D II +HK ACLRIT LLVC ++LW GTSAGV+LTIP    T S  +  +       L +GHTG+VRFL +++                       P             T+   +M +I GGDG EDF  S     +++ +GRDD+ NH+ +W +
Sbjct:  679 SGSFGPGGPCGTSPMDGRALRR-SSRGSFTRGSLEDLLSVDPEAYQSSVWLGTEDGCVHVYQSSDSIRDRRNSMKLQHAASVTCILYLNNKVFVSLANGELVVYQREAGRFWDPQNFKSMTLGSQGSPITKMVSVGGRLWCGCQNRVLVLSPDTLQLEHTFYVGQ-DSSRSVACMVDSSLGVWVTLKGSAHVCLYHPDTFEQLAEVDVTPPVHRMLAGSDAIIRQHKAACLRITALLVCAELLWVGTSAGVVLTIPTSPSTVSCPRAPL---SPAGLCQGHTGHVRFLAAVQLPEGFNLLCSTPPPPPDTGPEKLPSLDHRDSPRRRGPTSARPKMLVISGGDGSEDFRLSSGGGGSSETVGRDDSTNHLLLWRV 1048          

HSP 2 Score: 210.305 bits (534), Expect = 1.135e-54
Identity = 156/512 (30.47%), Postives = 262/512 (51.17%), Query Frame = 3
Query: 2040 RYLIIQELLSVESEYVKVLEILVNHFMVPLKLEK---LLDETSIDTIFNKINELMNYHAEFLS----ILQVWKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKIN-AVKEAKQD----------ETFLEGQKLLERLLSPMTMNQNRQFIRHD---PVTVEDRKEAYCIFSFSDQIIVXXXXXXXXXXXXXPPVLRLMTPSGLDFVDNI-KYKFISRXXX------XXXXXXXXXDTDQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIASQFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKLVDVPRT--PRFNQALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAVPG 3485
            R  +   LL  E  YV+ L  L+  +M PLK  +   L D + +D IF++I EL+ +H +FL      +Q W  +  +G  + + FS+  +   Y+++I+NF  ++  +  A  ++ +  KF+EQ  +++K K  L  L+++PVQRIPRYELL+K L+++TP D  D+  LLDAQ  + Q+A +IN  V+ A++           E  +EG   +E L +P+     R+F+R +    V     K+   +F F+D I+ TT KR+     +    + L T + +  +D   KYK + ++ +      +      N +T QK + R  E     DL+ L ++  L   L   HQ +D  ++ L A + +D+ E + +            +   T  EG +   F F   + +L +E+   + K KL        P F +A+ I +T+SGMQF CA P          +VW+C SDG+ G +CLLS++ +P V   + +  C+A+++CI AVPG
Sbjct:   51 RKHVTMTLLDTEQSYVESLRTLMQGYMQPLKQPENSLLCDPSLVDEIFDQIPELLEHHEQFLEQVRHCVQTWHAQQKVGALLVQSFSKDVLVNIYSAYIDNFLNAKDAVRVAKEARPAFLKFLEQSMRENKEKQALSDLMIKPVQRIPRYELLVKDLLKHTPEDHPDHPLLLDAQRNIKQVAERINKGVRSAEEAERHARVLQEIEAHIEG---MEDLQAPL-----RRFLRQEMVIEVKAIGGKKDRSLFLFTDLIVCTTLKRKSGSLRRS--SMSLYTAASV--IDTASKYKMLWKLPLEDTDIIKGASQATNRETIQKAISRLDE-----DLATLGQMSKLSESLGFPHQSLDDALRDLSAAMHRDLSE-KQALCCSLAFPPTKLELCATRPEGTDSYIFEFPHPDARLGFEQAFDEAKRKLASSKSCLDPEFLKAIPIMKTRSGMQFSCAAPTFSSCPEPAPEVWVCNSDGYVGQVCLLSLRAEPDV--EACIAVCSARILCIGAVPG 542          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Mouse
Match: Arhgef17 (Rho guanine nucleotide exchange factor (GEF) 17 [Source:MGI Symbol;Acc:MGI:2673002])

HSP 1 Score: 114.775 bits (286), Expect = 2.333e-27
Identity = 59/194 (30.41%), Postives = 111/194 (57.22%), Query Frame = 3
Query: 3681 SGESETDESNNKLVRKISSEDSPKNKKLSD-------PFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSY 4241
            SG   T   + + +R+ SS  S     L D        +++++W+G EDG + V+ S+D++R  ++  K+   ++V  +L+ +NKV+VSL NGELV ++R    +WD        L SQ SPI  M++V G +W   Q  +++++P ++++E+TF + + +  R ++ +  S   VW+T + S+ + LYH  ++
Sbjct:   87 SGPCGTSPMDGRALRR-SSRGSFTRGSLEDLLSVDPEAYQSSVWLGTEDGCVHVYQSSDSIRDRRNSMKLQHAASVTCILYLNNKVFVSLANGELVVYQREAGRFWDPQNFKSMTLGSQGSPITKMVSVGGRLWCGCQNRVLVLSPDTLQLEHTFYVGQ-DSSRSVACMVDSSLGVWVTLKGSAHVCLYHPDTF 278          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Mouse
Match: Mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:MGI Symbol;Acc:MGI:1353598])

HSP 1 Score: 114.775 bits (286), Expect = 6.800e-25
Identity = 74/253 (29.25%), Postives = 128/253 (50.59%), Query Frame = 3
Query: 3654 SNTSQSCSESGESETDESNNKLVRKISSEDSPKNKKLSDPFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPI 4412
            S+++Q  SE+G     ESN  +V+    E S +    +     TMW+G ++G + V  +  N +  K    I L  +V+S++H   +V V+L +G L  F R  +G WDL    +  L      I+ M  V   +W   +  + +I P +++IE +F      + + +  LA  G  VW++    S + LYHA ++++L +V+I P V + L        +   + +RIT LL+  + LW GT  GV+++IP+
Sbjct:  932 SSSTQPASENG----SESNGTIVQP-QVEPSGELSTTTSSAAPTMWLGAQNGWLYVHSAVANWK--KCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRGEDGQWDLSNYHLMDLGHPHHSIRCMAVVNDRVWCGYKNKVHVIQPKTMQIEKSFDAHPRRESQ-VRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTG-----KLGFSFVRITALLIAGNRLWVGTGNGVVISIPL 1171          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Mouse
Match: Mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:MGI Symbol;Acc:MGI:1353598])

HSP 1 Score: 114.39 bits (285), Expect = 7.111e-25
Identity = 74/253 (29.25%), Postives = 128/253 (50.59%), Query Frame = 3
Query: 3654 SNTSQSCSESGESETDESNNKLVRKISSEDSPKNKKLSDPFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPI 4412
            S+++Q  SE+G     ESN  +V+    E S +    +     TMW+G ++G + V  +  N +  K    I L  +V+S++H   +V V+L +G L  F R  +G WDL    +  L      I+ M  V   +W   +  + +I P +++IE +F      + + +  LA  G  VW++    S + LYHA ++++L +V+I P V + L        +   + +RIT LL+  + LW GT  GV+++IP+
Sbjct:  901 SSSTQPASENG----SESNGTIVQP-QVEPSGELSTTTSSAAPTMWLGAQNGWLYVHSAVANWK--KCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRGEDGQWDLSNYHLMDLGHPHHSIRCMAVVNDRVWCGYKNKVHVIQPKTMQIEKSFDAHPRRESQ-VRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTG-----KLGFSFVRITALLIAGNRLWVGTGNGVVISIPL 1140          
BLAST of Rho guanine nucleotide exchange factor 17 vs. UniProt/SwissProt
Match: sp|Q80U35|ARHGH_MOUSE (Rho guanine nucleotide exchange factor 17 OS=Mus musculus OX=10090 GN=Arhgef17 PE=1 SV=2)

HSP 1 Score: 216.468 bits (550), Expect = 5.098e-55
Identity = 158/518 (30.50%), Postives = 263/518 (50.77%), Query Frame = 3
Query: 2022 KQKVEKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEK---LLDETSIDTIFNKINELMNYHAEFLS----ILQVWKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKIN-AVKEAKQD----------ETFLEGQKLLERLLSPMTMNQNRQFIRHD---PVTVEDRKEAYCIFSFSDQIIVXXXXXXXXXXXXXPPVLRLMTPSGLDFVDNI-KYKFISRXXX------XXXXXXXXXDTDQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIASQFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKLVDVPRT--PRFNQALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAVPG 3485
            K +V+ R  +   LL  E  YV+ L  L+  +M PLK  +   L D + +D IF++I EL+ +H +FL      +Q W  +  +G  + + FS+  +   Y+++I+NF  ++  +  A  ++ +  KF+EQ  +++K K  L  L+++PVQRIPRYELL+K L+++TP D  D+  LLDAQ  + Q+A +IN  V+ A++           E  +EG   +E L +P+     R+F+R +    V     K+   +F F+D I+ TT KR+     +    + L T      +D   KYK + ++ +      +      N +T QK + R  E     DL+ L ++  L   L   HQ +D  ++ L A + +D+ E + +            +   T  EG +   F F   + +L +E+   + K KL        P F +A+ I +T+SGMQF CA P          +VW+C SDG+ G +CLLS++ +P V     +  C+A+++CI AVPG
Sbjct: 1054 KPQVDMRKHVTMTLLDTEQSYVESLRTLMQGYMQPLKQPENSLLCDPSLVDEIFDQIPELLEHHEQFLEQVRHCVQTWHAQQKVGALLVQSFSKDVLVNIYSAYIDNFLNAKDAVRVAKEARPAFLKFLEQSMRENKEKQALSDLMIKPVQRIPRYELLVKDLLKHTPEDHPDHPLLLDAQRNIKQVAERINKGVRSAEEAERHARVLQEIEAHIEG---MEDLQAPL-----RRFLRQEMVIEVKAIGGKKDRSLFLFTDLIVCTTLKRKSGSLRRS--SMSLYT--AASVIDTASKYKMLWKLPLEDTDIIKGASQATNRETIQKAISRLDE-----DLATLGQMSKLSESLGFPHQSLDDALRDLSAAMHRDLSE-KQALCCSLAFPPTKLELCATRPEGTDSYIFEFPHPDARLGFEQAFDEAKRKLASSKSCLDPEFLKAIPIMKTRSGMQFSCAAPTFSSCPEPAPEVWVCNSDGYVGQVCLLSLRAEPDVEACIAV--CSARILCIGAVPG 1551          

HSP 2 Score: 215.312 bits (547), Expect = 1.050e-54
Identity = 114/331 (34.44%), Postives = 187/331 (56.50%), Query Frame = 3
Query: 3774 FKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVESLDRGHTGNVRFXXXXXXX-------XXXXXXXXXXXXXXPC------------TTMATQMKIICGGDGYEDFT-SKSNRENNQDIGRDDAINHIQIWDI 4706
            +++++W+G EDG + V+ S+D++R  ++  K+   ++V  +L+ +NKV+VSL NGELV ++R    +WD        L SQ SPI  M++V G +W   Q  +++++P ++++E+TF + + +  R ++ +  S   VW+T + S+ + LYH  ++E L EV++ P V + L   D II +HK ACLRIT LLVC ++LW GTSAGV+LTIP    T S  +  +       L +GHTG+VRFL +++                       P             T+   +M +I GGDG EDF  S     +++ +GRDD+ NH+ +W +
Sbjct: 1731 YQSSVWLGTEDGCVHVYQSSDSIRDRRNSMKLQHAASVTCILYLNNKVFVSLANGELVVYQREAGRFWDPQNFKSMTLGSQGSPITKMVSVGGRLWCGCQNRVLVLSPDTLQLEHTFYVGQ-DSSRSVACMVDSSLGVWVTLKGSAHVCLYHPDTFEQLAEVDVTPPVHRMLAGSDAIIRQHKAACLRITALLVCAELLWVGTSAGVVLTIPTSPSTVSCPRAPL---SPAGLCQGHTGHVRFLAAVQLPEGFNLLCSTPPPPPDTGPEKLPSLDHRDSPRRRGPTSARPKMLVISGGDGSEDFRLSSGGGGSSETVGRDDSTNHLLLWRV 2057          
BLAST of Rho guanine nucleotide exchange factor 17 vs. UniProt/SwissProt
Match: sp|Q96PE2|ARHGH_HUMAN (Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 1.826e-53
Identity = 157/518 (30.31%), Postives = 264/518 (50.97%), Query Frame = 3
Query: 2022 KQKVEKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEK---LLDETSIDTIFNKINELMNYHAEFLS----ILQVWKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKIN-AVKEAKQD----------ETFLEGQKLLERLLSPMTMNQNRQFIRHD---PVTVEDRKEAYCIFSFSDQIIVXXXXXXXXXXXXXPPVLRLMTPSGLDFVDNI-KYKFISRXXX------XXXXXXXXXDTDQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIASQFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKLVDVPRT--PRFNQALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAVPG 3485
            K +V+ R  +   LL  E  YV+ L  L+  +M PLK  +   L D + +D IF++I EL+ +H +FL      +Q W  +  +G  + + FS+  +   Y+++I+NF  ++  +  A  ++ +  KF+EQ  +++K K  L  L+++PVQRIPRYELL+K L+++TP D  D+  LL+AQ  + Q+A +IN  V+ A++           E  +EG   +E L +P+     R+F+R +    V     K+   +F F+D I+ TT KR+     +    + L T      +D   KYK + ++ +      +      N +  QK + R  E     DL+ L ++  L   L   HQ +D  ++ L A + +D+ E +    A +   +   +   T  EG +   F F   + +L +E+   + K KL        P F +A+ I +T+SGMQF CA P          +VW+C SDG+ G +CLLS++ +P V     +  C+A+++CI AVPG
Sbjct: 1061 KPQVDMRKHVAMTLLDTEQSYVESLRTLMQGYMQPLKQPENSVLCDPSLVDEIFDQIPELLEHHEQFLEQVRHCMQTWHAQQKVGALLVQSFSKDVLVNIYSAYIDNFLNAKDAVRVAKEARPAFLKFLEQSMRENKEKQALSDLMIKPVQRIPRYELLVKDLLKHTPEDHPDHPLLLEAQRNIKQVAERINKGVRSAEEAERHARVLQEIEAHIEG---MEDLQAPL-----RRFLRQEMVIEVKAIGGKKDRSLFLFTDLIVCTTLKRKSGSLRRS--SMSLYT--AASVIDTASKYKMLWKLPLEDADIIKGASQATNRENIQKAISRLDE-----DLTTLGQMSKLSESLGFPHQSLDDALRDLSAAMHRDLSEKQALCYALSFPPTKL-ELCATRPEGTDSYIFEFPHPDARLGFEQAFDEAKRKLASSKSCLDPEFLKAIPIMKTRSGMQFSCAAPTLNSCPEPSPEVWVCNSDGYVGQVCLLSLRAEPDVEACIAV--CSARILCIGAVPG 1558          

HSP 2 Score: 210.69 bits (535), Expect = 2.543e-53
Identity = 110/331 (33.23%), Postives = 186/331 (56.19%), Query Frame = 3
Query: 3774 FKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVESLDRGHTGNVRFXXXXXXX-------XXXXXXXXXXXXXXPC------------TTMATQMKIICGGDGYEDFT-SKSNRENNQDIGRDDAINHIQIWDI 4706
            +++++W+G EDG + V+ S+D++R  ++  K+   ++V  +L+ +N+V+VSL NGELV ++R    +WD        L +Q SPI  M++V G +W   Q  +++++P ++++E+ F + + +  R ++ +  S   VW+T + S+ + LYH  ++E L EV++ P V + L   D II +HK ACLRIT LLVC+++LW GTSAGV+LT+P    T S  +  +       L +GHTG+VRFL +++                       P                  +M +I GGDGYEDF  S     +++ +GRDD+ NH+ +W +
Sbjct: 1737 YQSSVWLGTEDGCVHVYQSSDSIRDRRNSMKLQHAASVTCILYLNNQVFVSLANGELVVYQREAGHFWDPQNFKSVTLGTQGSPITKMVSVGGRLWCGCQNRVLVLSPDTLQLEHMFYVGQ-DSSRCVACMVDSSLGVWVTLKGSAHVCLYHPDTFEQLAEVDVTPPVHRMLAGSDAIIRQHKAACLRITALLVCEELLWVGTSAGVVLTMPTSPGTVSCPRAPL---SPTGLGQGHTGHVRFLAAVQLPDGFNLLCPTPPPPPDTGPEKLPSLEHRDSPWHRGPAPARPKMLVISGGDGYEDFRLSSGGGSSSETVGRDDSTNHLLLWRV 2063          
BLAST of Rho guanine nucleotide exchange factor 17 vs. UniProt/SwissProt
Match: sp|Q21653|OSG1_CAEEL (Rho guanine nucleotide exchange factor osg-1 OS=Caenorhabditis elegans OX=6239 GN=osg-1 PE=2 SV=4)

HSP 1 Score: 185.652 bits (470), Expect = 5.492e-46
Identity = 154/544 (28.31%), Postives = 270/544 (49.63%), Query Frame = 3
Query: 1932 PDLFDENSIKLEVSSDETILEEVDDRILLEKQKVEK--------RYLIIQELLSVESEYVKVLEILVNHFMVPLK--LEKLLDETS-IDTIFNKINELMNYHAEFLSILQV----WKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKINAVKEAKQ--DETFLEGQKLLERLLSPMTMNQNRQFIRHDPVTVEDRKEAYCIFSFSDQIIVXXXXXXXXXXXXXPPVL-RLMTPSGLDFVDNIKYKFISRXXXXXXXXXXXXDTDQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIAS-------QFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKLV-DVPRTPRFN-QALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAVP 3482
            P ++ +    LE    E  L E D  ILL K++           R+L  +ELL  E  +V+ LE LV  +M PL+  LE  L E S +D IF +I E++ +H   L+ L      W     +GD +   FS+  + E Y SF++NF  ++  +  A   K + +K+  +  +D  NKL L +LL+ P+QR+PRYEL++K+++++TP + +D   LL AQ  +H LA+ IN  K+  +  ++   E + +++ L   +T  ++R  +RHD +T++      CIF  SD ++V       T   KKP VL   M+   + F++  ++K + ++ +E+++  ++  +  + + R  E   R+D  +L+++  L S L         C +++   +L+ ME S NS     +N  ++S          V T  G E     F   EK+  +E + KD K  L  ++   P  + + +   +T+ G+Q C A  + G        +W+C SD F+G + ++++    I   +    G NA V  +  VP
Sbjct:  316 PYVYSDGGEALETCGMEDSLHEAD--ILLWKKRSRASLRRHYSVRHLAARELLDTEKSFVEGLEFLVTKYMRPLRQPLECTLIEASLVDKIFYRIPEILAHHQVLLTTLSQRIDQWHKDAILGDVLLAHFSKQSMIETYISFVDNFKFAKASIIQA-RQKHAFEKYYNRCCRDHPNKLDLDSLLISPIQRVPRYELIVKQMLKHTPVEHEDRERLLRAQRHIHCLAVAINQHKDGSEQMEQRLREIEAIVDGLDDLVT--KDRTLLRHDIITLKGTDRERCIFMLSDLLLV-------TSVKKKPKVLYSKMSSQSMGFLEGNRFKLLFKVALEDVQISKDTLSQLEEVERKLE-SSREDDRVLKKMSQLCSLLK--------CERKVLMEMLETMETS-NSMSIRELNEQMSSDPDLSAVHLDVLTSNGFEPFVLEFPNAEKRSVFEAMFKDAKATLAKNLLAAPSCSLKTIIAHQTRPGLQLCTATVVPGKRVDSTPSLWVCASDKFSGQVAVMALDTGEITIESCSAIG-NAAVTAMCTVP 836          

HSP 2 Score: 83.5741 bits (205), Expect = 1.341e-14
Identity = 76/314 (24.20%), Postives = 139/314 (44.27%), Query Frame = 3
Query: 3777 KATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNG---ELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVESLDRGHTGNVRF---XXXXXXXXXXXXXXXXXXXXXPCTTMATQMKIICGGDGYEDFTSKSNRENNQDIGRDDAINHIQIW 4700
            + T+WIG +DG + V  S + VR     R   L +++ S+   +  V V+       +L+ F+   +G WDL+         Q +PI +M  +   +   S   +      + K +    +  S+D   I+ +  +GQ V++    S+++ +    +   +   N+   V  +L   + I+  HK  CLRI+CL V +  LW GTSAG +L+  + +  +  T      P +   + GH+G  R    + +   S   S +  R     P    ++Q+ ++  G+G +D T+  +          DAINH+  W
Sbjct:  883 QTTVWIGNDDGEVFVVNSTERVRSRARDRLARLRNSITSICAANGNVLVATSYSNQVQLLLFRPASDGSWDLENPQTVGHVCQ-APITSMQLIGRRVIIASGNWLHAYFVDTGKFQPPVEILPSSDV--ITLMYVTGQNVFLCGRKSTEVFVVDVFNLSIINHFNVVSFVRSQLSGREHILREHKMGCLRISCLTVARSHLWIGTSAGCVLSTSVQSARSQPT------PDLRVCEIGHSGPCRILLPVHTPSHSNHPSRKQKRSSLNVP-AQQSSQLMLVSCGEGLDDGTATQDPST-------DAINHLIFW 1179          
BLAST of Rho guanine nucleotide exchange factor 17 vs. UniProt/SwissProt
Match: sp|E9PSK7|JIP3_RAT (C-Jun-amino-terminal kinase-interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Mapk8ip3 PE=1 SV=2)

HSP 1 Score: 114.775 bits (286), Expect = 3.696e-24
Identity = 74/253 (29.25%), Postives = 130/253 (51.38%), Query Frame = 3
Query: 3654 SNTSQSCSESGESETDESNNKLVRKISSEDSPKNKKLSDPFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPI 4412
            S+++Q  SE+G SE+D S    + +   E S ++   +     TMW+G ++G + V  +  N +  K    I L  +V+S++H   +V V+L +G L  F R  +G WDL    +  L      I+ M  V   +W   +  + +I P +++IE +F      + + +  LA  G  VW++    S + LYHA ++++L +V+I P V + L        +   + +RIT LL+  + LW GT  GV+++IP+
Sbjct:  918 SSSTQPASENG-SESDGS----IVQPQVEPSGESSATTSSAAPTMWLGAQNGWLYVHSAVANWK--KCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRGEDGQWDLSNYHLMDLGHPHHSIRCMAVVDDRVWCGYKNKVHVIQPKTMQIEKSFDAHPRRESQ-VRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTG-----KLGFSFVRITALLIAGNRLWVGTGNGVVISIPL 1157          
BLAST of Rho guanine nucleotide exchange factor 17 vs. UniProt/SwissProt
Match: sp|Q9GQF1|JIP3_DROME (JNK-interacting protein 3 OS=Drosophila melanogaster OX=7227 GN=syd PE=1 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 4.240e-24
Identity = 83/321 (25.86%), Postives = 149/321 (46.42%), Query Frame = 3
Query: 3783 TMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQ------PKVESLDRGHTGNVRFXXXXXXXXXXXXXXXXXXXXXPCTTMATQMKIICGGDGYEDFTSKSNR-------ENNQDIGRDDAINHIQIWDI 4706
            TMW+G +DG + V  S    R  +   ++ L  AV++++H + +V V+L N +L  F+R  +G WDL+   +  L  +   I+ +      IW   +  I I++P S+ I ++       + + +  +A +G  VW++    S + LY+  ++E+  +V+I P V + L        +   + +RIT L+V  + LW GTS GVI+++P+  V   ++     Q         +    GH   V+F VS+    + +            T     M ++CGG+GY DF    N        E NQ I      +++ +W +
Sbjct:  917 TMWLGAQDGWLYVHSSVG--RWHECLHRVLLPDAVLAIVHVEARVVVALANAQLAVFRRQTDGQWDLNSYHLVTLGDRNHSIRCLCVAGERIWAAHRNKIFIVDPVSLNIVHSLDAHPRKESQ-VRQMAATGAGVWVSIRLDSTLRLYNTHTFEHKQDVDIEPYVSKMLGTG-----KLGFSFVRITALMVSCNRLWIGTSNGVIISVPLAEVQPKSSSDPHGQMPLCCMANAQLSFHGHRDAVKFFVSVPMLQQPNLNGGLT-----FTNKRPDMLVMCGGEGYIDFRINDNDMENSIQLEPNQTIENRGDKSYLIVWHV 1224          
BLAST of Rho guanine nucleotide exchange factor 17 vs. TrEMBL
Match: A0A267GJC4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026874g2 PE=4 SV=1)

HSP 1 Score: 652.129 bits (1681), Expect = 0.000e+0
Identity = 391/1011 (38.67%), Postives = 578/1011 (57.17%), Query Frame = 3
Query: 2022 KQKVEKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEKLLDETSIDTIFNKINELMNYHAEFLSILQV----WKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKINAVKEAKQDETFLEGQKLLERLLSPMTM-NQNRQFIRHDPVTVEDRKEAYCIFSFSDQIIVXXXXXXXXXXXXXPPVLRLMTPSGLDFVDN-IKYKFISRXXXXXXXXXXXXDTDQKVLLRNR-EMKDR--KDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIASQ--------------FLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKLV-DVPRTPRFNQALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVIC---ITAVPGYLGST------RRS--------------------------------------SLSMDGRFSRP--IERKRKQTGEVYQLDTQVETQEDDADVEQDQSANVD---DSNTSQSCSESGESETDESNNKLVRKISSEDSPKNKKLSDPFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIE-GYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVESLDRGHTGNVRFXXXXXXXXX------------------XXXXXXXXXXXXPCTTMATQMKIICGGDGYEDFTS---------------------KSNRENNQDIGRDDAINHIQIWDI 4706
            +Q  +KRY I++EL+ VE EYV+ L+ LV  +++PLK+  +LD   +D IF ++ EL  +H+ FLS+L+     W  +  IGD+I  MF +  V ECY SF+ENF+ SEK LE+AL  KSSLQ+FVEQ Q++++ +LPLK+L+++PVQRIPRYELLLKRL+E+T     D+  L  A+TAVH LA+KIN +KE++Q E  +E  + LE LL    + +  R+++RHD V VE RKE+ C+F+FSDQ++  + K+R      K PV+RL + SGLDF+D+ +KYK   R+ +E IE  +      +V +R   E  +R  +D S++ EI  L +KL  KH  ++  IK    ++ + +E +R    +       A+                L T+  GI      FG+ EKK  WE    D K KL+    + P F Q L IT+ +SGMQF C   IEGYN    RDVWIC+SDG+  HLCLLS+Q +P+V++N PL GCN++V C   + A  G L S       RRS                                      S   + + + P  +E+     G     D       + AD + D+S++ +    ++++QS   +G SE+  S   L    ++  S K+KKLSDP+K TMW+G EDG I V+Y  DNVR T+S++KI   + V S++H D +VY  LQNGE+  ++R  E G WD + +  T L  +  P+K ++AV G +W  SQ++I ++NP S   E+TFT+   + +R +  + CSG  VWI  ENS+K+ LYHA S E+L E+++  AV Q+L   D+I+ +HK ACLRITCLLVCKD+LW GTSAGVI  IP+  ++++T   ++  P V +L+ GHTG+VRFL ++E +                    S  Q++RR SLSP TT+A+QM ++ GG G+E+F S                          +  ++G+DD +NH+ I+ +
Sbjct:  515 QQPRDKRYHIVKELVEVEKEYVESLQTLVEKYIIPLKVTGILDANVVDEIFYRVPELYAHHSIFLSMLESSWTNWSDETAIGDQIFVMFKKESVAECYCSFVENFNRSEKSLESALQQKSSLQRFVEQIQRENRRRLPLKSLIIKPVQRIPRYELLLKRLLEHTQEAHPDWEQLKQAETAVHALAMKINTLKESQQTEGAVESLRTLESLLMLADLASSQREYLRHDVVQVEGRKESVCVFTFSDQLVFASLKKRVGPQAAKKPVIRLQSSSGLDFIDSSLKYKVWLRLGLEAIEISKGR---HRVAVRKSLEEVERLEEDRSLVLEILDLSTKLCTKHSHLEEVIKDALESLNRQLESARRLDSSQKQQQQQAAAAAAKGEPGGPCRIDLLTTSPGGIASYALIFGSPEKKAQWENSFLDTKMKLLYKGAQIPDFLQTLQITKIRSGMQFTCGSAIEGYNESHFRDVWICKSDGYISHLCLLSLQPEPMVSLNIPLSGCNSRVNCVCSVPAYAGLLKSRQGSEHRRRSRVHAVTEPIAEAETPADAQRPPPIPEAPPGDAAADAGESSKAEPKATPPPLVEQPLGGIGGDSSDDDSSSDSYEGADPDADESSSPEAFGKASSTQSQPATGASESAASPAGL----AASPSVKSKKLSDPYKGTMWLGCEDGWIYVYYCTDNVRTTRSRQKIKQKAGVTSIIHLDGRVYACLQNGEIAVYRRKPEDGLWDFE-NHRTILVKEKKPLKQLVAVAGKVWCGSQKDITVVNPVSESSESTFTVGHQSGRRSVQAMVCSGYAVWIALENSTKVFLYHALSAEFLLEMDLSSAVNQKLGCCDEIVRQHKSACLRITCLLVCKDLLWVGTSAGVIAVIPLLKISSTTGAGSLKPPSVTALNYGHTGHVRFLAAVEKARGPGGVPASVGGAGVGGHRPSPVQAARRASLSPVTTLASQMLVLSGGAGFEEFASDSSGGSSGGGGTPGSGGGTPGSGGGGSGSEVGKDDTVNHLLIFQV 1517          
BLAST of Rho guanine nucleotide exchange factor 17 vs. TrEMBL
Match: A0A2C9K8J5 (DH domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106075534 PE=4 SV=1)

HSP 1 Score: 645.58 bits (1664), Expect = 0.000e+0
Identity = 386/978 (39.47%), Postives = 570/978 (58.28%), Query Frame = 3
Query: 2034 EKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEKLLDETSIDTIFNKINELMNYHAEFLSIL-QVWK----PKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKINAVKEAKQDETFLEGQKLLERLLSPMTMNQNRQFIRHDPVTVEDRKEAYCIFSFSDQIIVXXXXXXXXXXXXXPPVLR-----LMTPSGLDFVDNIKYKFISRXXXXXXXXXXXXDT-DQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIASQFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTK--LVDVPRTPRFNQALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAVPGYLGSTRRSSLSMDGRFSR-----------PIERKRKQTGEVYQLDTQVETQEDDADVEQDQSAN--VDDSNTSQSCSESG-ESETDESNNKLV----------------RKISSEDSPKNKKLS------------------DPFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVESLDRGHTGNVRFXXXXXXXXXXXXXXX--------------------------XXXXXXPCTTMATQMKIICGGDGYEDFTSKSNRENNQDIGRDDAINHIQIWDI 4706
            +KRY I++EL   E EYV+ L  L + +MVPLK +  +D+  +D IF  I E++ +H+ +L  L  VWK       T+G+ I  +F++  V E Y SF+EN++ S K++ENAL +KSS+QKF+EQ QKDS +KL +K L+V+P+QRIPRYELL++RL++ TP D  D+  L  A   +H LA+KI  V +++Q+E   E  K LE LL       +R +IRHD V + +RK+  CI+ FSD ++V++ KR+        PV R     L TP G DF +NIK+K   R+ ++++E  + + T  +K  L   ++++  D+ I+ ++  L  KL  +HQ +D  IK L  N+ +   E   +R A + +N +  + +VTT+EG+  +   F + EK+ +WE    D K K  L+   R P F Q L IT+T++GMQF CA PI+G N+ G RDVW+C SDG+ GH+CLLS+Q +PIVT+N+P+PGCNA+++CI AVP + G+ RR +     R  R           P     K   +   L+T   T E    +         V+D  T+ + +E G +S++D S+++ +                 K+ S+D     K+S                  DP K+TMW+G EDG I +F S DN++ TK+K KI  GS V  +++ DNKV+VSL NG+L+ +KR  EG WD +      + S +SPI  M+AV G +W   Q  I +INP ++ IE +F +T  +  + +  L CSGQ VW+  + SSK++L+HA +YE+L EV+I  AV  +LQ  DDII +HK ACLRIT L+VCKD+LW GTSAGVILTIPIP +T++TT+ ++  P V  L  GHTG+VRFL S+E S  +S ++                           R    +   TMA++M +I GGDGYEDF    N   N+  GRDD+ NH+ +W +
Sbjct:  687 DKRYHIVEELYKNEKEYVEALRTLKDKYMVPLKTQSSVDDNIVDNIFYMIPEILTHHSIYLDFLDNVWKHWNTTHSTVGNIITTIFAKQTVLESYMSFVENYNASGKVIENALTTKSSVQKFIEQCQKDSGSKLTMKDLIVRPIQRIPRYELLIQRLLDNTPRDHPDHPLLQQACRVMHDLAVKIGTVNDSQQEEDMQETLKKLELLLITDLAVPDRAYIRHDMVQLFNRKDQCCIWLFSDVVLVSSIKRKSG------PVTRKVSIILKTPLGQDFAENIKHKVWLRVGLDDLEIVKTQGTLTRKPTLDKEQLEE--DIHIVTQLGDLAGKLSCQHQSLDDAIKELNTNLCRQHSEV-TARNASSDSNKM--ELVVTTQEGVLHLVIGFSSAEKRAAWETAFTDAKQKLSLLSDKRAPEFLQPLQITKTRAGMQFSCAAPIDGVNSSGFRDVWVCNSDGYVGHMCLLSLQPEPIVTLNTPVPGCNARILCICAVPAFSGAFRRRASQKGARSQRDSIVVTTIPEGPRINVEKSEEDNVILETPQPTSEPAIIIPTTTITTTLVEDVETNDNFNEEGYQSDSDTSDDEPMSFLPRTTEELYVGGGWSKLLSDDEAPKPKVSELTESSPDPITTSGNWDQDPAKSTMWLGTEDGCIHIFQSCDNIKTTKNKLKIQHGSPVYCIIYLDNKVFVSLVNGDLIVYKRDPEGLWDTECPYTRTIGSASSPITKMLAVAGKLWCGCQNQIHVINPLALNIETSFQVTP-DVTKAVQCLVCSGQGVWVASQQSSKVMLFHAVTYEFLLEVSIAQAVSHKLQSADDIIRQHKAACLRITALMVCKDLLWVGTSAGVILTIPIPRITSTTTRGSLAVPTVTGLIYGHTGHVRFLTSVEISSTASTKAELSKEGTSGESATAERGGGFSFQDIHRRSSMAATTATMASRMLVISGGDGYEDF---RNSAANEGAGRDDSTNHLLLWQV 1649          
BLAST of Rho guanine nucleotide exchange factor 17 vs. TrEMBL
Match: A0A1S3IW78 (rho guanine nucleotide exchange factor 17 OS=Lingula unguis OX=7574 GN=LOC106167957 PE=4 SV=1)

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 368/914 (40.26%), Postives = 549/914 (60.07%), Query Frame = 3
Query: 2034 EKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEKLLDETSIDTIFNK--INELMNYHAEFLSILQV----WKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKINAVKEAKQDETFLE-GQKLLERLLSPMTMNQNRQFIRHDPVTVEDRKEAYCIFSFSDQIIVXXXXXXXXXXXXXPPVLRLMTPSG-LDFVDNIKYKFISRXXXXXXXXXXXXDTDQKVLLRNREMKDR----KDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIASQFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKLVDV--PRTPRFNQALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAVPGYLGSTRRSSLSMDGRFSRPIERKRKQTGEVYQLDTQVETQEDDADVEQDQSANVDDSNTSQSCSESGESETDESNNKLVRKI-SSEDSPKNKKLSDPFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVESLDRGHTGNVRFXXXXXXXXXXXXXXXXXXXXX--------PCTTMATQMKIICGGDGYEDFTSKSNRENNQDIGRDDAINHIQIWDI 4706
            +KRY II+EL SVE EYV  L ILV+ +++PLK + +LD + +D IF K  I E++ +HA FL+ L+     W    T+GD I  MFS+  V E Y  FI+N+  SEK++++AL +KSS QKF EQ Q+ S+ KL +K L++QP QRIPRYELL++R +++T  D  DY  L +A+ A+H LA+KI +V ++++ E   E  +KL   LL       +R ++RHD VTV +RK+  CI+ FSD I+ T+ KR+     +K  +L + +PSG +DF++NIK+KF  +I ++++E   + DT    L R R  KD+     DL++L ++  LV KL+ +HQ +   I  L  N L +       + A T    I    + TT EG+  +   F + +K+ SWE    + K  L  +   R P F QAL IT+T++GMQF CA P++G N  G RDVW+C SDG+ GH+CLLS+Q +PIVT+N+P+PGCN+K++CI AVP Y G               P+  KRK +G    +D+  +   +   +E   + + D S +    ++  +     S   + R    S +S K   L DP+K+TMW+G ++G I +F S DN++ TK+K K+   + V+ ++H D KV+ SL NGE+  ++R  +G WD  +     + + TSP+  M+AV G +W   Q  ++++NPT++  E +F +  ++  RPI  + CSGQ VWI  + SSK++L+HAT+ ++L +++I  AV Q+L   DDII +HK ACLRIT LL CKD+LW GTSAGVILTIP+P +T+STTK+ +  P V  L  GHTG+VRFL ++E            Q                AT+M +I GGDGYEDF +     NN+  GRDD+ NH+ +W +
Sbjct: 1162 DKRYHIIKELYSVEQEYVDSLRILVDKYVIPLKAQDILDSSMVDEIFYKTMIPEILTHHAIFLTSLERTWENWSSTQTVGDVIKAMFSKQSVVESYLLFIKNYKRSEKMIDHALQTKSSFQKFSEQCQRSSRRKLKIKDLIIQPAQRIPRYELLIQRFLDHTSKDHPDYPLLKEAEKAIHDLAMKIGSVDKSRRGEDMQETLKKLELLLLIDDLATPDRVYLRHDMVTVPNRKDMCCIWMFSDLIVFTSVKRKSGSVGRKTSLL-VQSPSGKVDFIENIKHKFWLKIGLDDVEIVNSPDT----LTRKRH-KDKDQLESDLAVLTDVTELVCKLNCEHQMLKDDIAEL-TNTLNNRLSELQLQSAGTDMCRI--DLMATTPEGVSNIIAIFPSPDKRKSWEDGFMEAKQNLSAITEKRPPEFMQALQITKTRAGMQFSCASPVDGVNTSGYRDVWVCNSDGYVGHMCLLSLQPEPIVTLNTPVPGCNSKILCIFAVPAYSG---------------PL--KRKGSGRNRSMDSGHQDDFNQVSLELSNTESSDGSESDTESTDDEDDMPSYSRRNVGRHTRQSSESSKQTPLLDPYKSTMWLGTDNGYIHIFQSTDNIKTTKNKLKVPHPAGVLCIVHLDCKVFASLANGEIRVYRRDADGSWDTQHPDTLSVGTVTSPVTKMLAVAGKLWCGCQSGVMMLNPTTLVSEVSFQI-PTDSPRPIQSMVCSGQGVWIAPQGSSKVVLFHATNRQFLTDISIAQAVTQKLMATDDIIRQHKTACLRITSLLACKDLLWVGTSAGVILTIPLPKITSSTTKSTLQAPTVTGLVHGHTGHVRFLTAVEMPSSRPFPEQSLQQHHLIRRRSIGGTPARATKMLVISGGDGYEDFRTGI---NNEAAGRDDSTNHLLLWQV 2045          
BLAST of Rho guanine nucleotide exchange factor 17 vs. TrEMBL
Match: A0A2C9K8D3 (DH domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106075534 PE=4 SV=1)

HSP 1 Score: 633.639 bits (1633), Expect = 0.000e+0
Identity = 386/1004 (38.45%), Postives = 571/1004 (56.87%), Query Frame = 3
Query: 2034 EKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEKLLDETSIDTIFNKINELMNYHAEFLSIL-QVWK----PKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKINAVKEAKQDETFLEGQKLLERLLSPMTMNQNRQFIRHDPVTV------------------------------EDRKEAYCIFSFSDQIIVXXXXXXXXXXXXXPPVLR-----LMTPSGLDFVDNIKYKFISRXXXXXXXXXXXXDT-DQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIASQFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKL--VDVPRTPRFNQALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAVPGYLGSTRRSSLSMDGRFSR-----------PIERKRKQTGEVYQLDTQVETQEDDADVEQDQSAN--VDDSNTSQSCSESG-ESETDESNNK------------LVRKISSEDSPKNKKLS------------------DPFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVESLDRGHTGNVRFXXXXXXXXXXXXXXX--------------------------XXXXXXPCTTMATQMKIICGGDGYEDFTSKSNRENNQDIGRDDAINHIQIWDI 4706
            +KRY I++EL   E EYV+ L  L + +MVPLK +  +D+  +D IF  I E++ +H+ +L  L  VWK       T+G+ I  +F++  V E Y SF+EN++ S K++ENAL +KSS+QKF+EQ QKDS +KL +K L+V+P+QRIPRYELL++RL++ TP D  D+  L  A   +H LA+KI  V +++Q+E   E  K LE LL       +R +IRHD V +                              ++RK+  CI+ FSD ++V++ KR+        PV R     L TP G DF +NIK+K   R+ ++++E  + + T  +K  L   ++++  D+ I+ ++  L  KL  +HQ +D  IK L  N+ +   E   +R A + +N +  + +VTT+EG+  +   F + EK+ +WE    D K KL  +   R P F Q L IT+T++GMQF CA PI+G N+ G RDVW+C SDG+ GH+CLLS+Q +PIVT+N+P+PGCNA+++CI AVP + G+ RR +     R  R           P     K   +   L+T   T E    +         V+D  T+ + +E G +S++D S+++             V ++ S+D     K+S                  DP K+TMW+G EDG I +F S DN++ TK+K KI  GS V  +++ DNKV+VSL NG+L+ +KR  EG WD +      + S +SPI  M+AV G +W   Q  I +INP ++ IE +F +T  +  + +  L CSGQ VW+  + SSK++L+HA +YE+L EV+I  AV  +LQ  DDII +HK ACLRIT L+VCKD+LW GTSAGVILTIPIP +T++TT+ ++  P V  L  GHTG+VRFL S+E S  +S ++                           R    +   TMA++M +I GGDGYEDF    N   N+  GRDD+ NH+ +W +
Sbjct:  687 DKRYHIVEELYKNEKEYVEALRTLKDKYMVPLKTQSSVDDNIVDNIFYMIPEILTHHSIYLDFLDNVWKHWNTTHSTVGNIITTIFAKQTVLESYMSFVENYNASGKVIENALTTKSSVQKFIEQCQKDSGSKLTMKDLIVRPIQRIPRYELLIQRLLDNTPRDHPDHPLLQQACRVMHDLAVKIGTVNDSQQEEDMQETLKKLELLLITDLAVPDRAYIRHDMVQLFVSFSTSSLVYSRTLGSSVSHWLGTRTRDHKNRKDQCCIWLFSDVVLVSSIKRKSG------PVTRKVSIILKTPLGQDFAENIKHKVWLRVGLDDLEIVKTQGTLTRKPTLDKEQLEE--DIHIVTQLGDLAGKLSCQHQSLDDAIKELNTNLCRQHSEV-TARNASSDSNKM--ELVVTTQEGVLHLVIGFSSAEKRAAWETAFTDAKQKLSLLSDKRAPEFLQPLQITKTRAGMQFSCAAPIDGVNSSGFRDVWVCNSDGYVGHMCLLSLQPEPIVTLNTPVPGCNARILCICAVPAFSGAFRRRASQKGARSQRDSIVVTTIPEGPRINVEKSEEDNVILETPQPTSEPAIIIPTTTITTTLVEDVETNDNFNEEGYQSDSDTSDDEPMSFLPRTTEELYVGELLSDDEAPKPKVSELTESSPDPITTSGNWDQDPAKSTMWLGTEDGCIHIFQSCDNIKTTKNKLKIQHGSPVYCIIYLDNKVFVSLVNGDLIVYKRDPEGLWDTECPYTRTIGSASSPITKMLAVAGKLWCGCQNQIHVINPLALNIETSFQVTP-DVTKAVQCLVCSGQGVWVASQQSSKVMLFHAVTYEFLLEVSIAQAVSHKLQSADDIIRQHKAACLRITALMVCKDLLWVGTSAGVILTIPIPRITSTTTRGSLAVPTVTGLIYGHTGHVRFLTSVEISSTASTKAELSKEGTSGESATAERGGGFSFQDIHRRSSMAATTATMASRMLVISGGDGYEDF---RNSAANEGAGRDDSTNHLLLWQV 1675          
BLAST of Rho guanine nucleotide exchange factor 17 vs. TrEMBL
Match: A0A2C9K8D2 (DH domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106075534 PE=4 SV=1)

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 386/1008 (38.29%), Postives = 571/1008 (56.65%), Query Frame = 3
Query: 2034 EKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEKLLDETSIDTIFNKINELMNYHAEFLSIL-QVWK----PKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKINAVKEAKQDETFLEGQKLLERLLSPMTMNQNRQFIRHDPVTV------------------------------EDRKEAYCIFSFSDQIIVXXXXXXXXXXXXXPPVLR-----LMTPSGLDFVDNIKYKFISRXXXXXXXXXXXXDT-DQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIASQFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKL--VDVPRTPRFNQALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAVPGYLGSTRRSSLSMDGRFSR-----------PIERKRKQTGEVYQLDTQVETQEDDADVEQDQSAN--VDDSNTSQSCSESG-ESETDESNNKLVR----------------KISSEDSPKNKKLS------------------DPFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVESLDRGHTGNVRFXXXXXXXXXXXXXXX--------------------------XXXXXXPCTTMATQMKIICGGDGYEDFTSKSNRENNQDIGRDDAINHIQIWDI 4706
            +KRY I++EL   E EYV+ L  L + +MVPLK +  +D+  +D IF  I E++ +H+ +L  L  VWK       T+G+ I  +F++  V E Y SF+EN++ S K++ENAL +KSS+QKF+EQ QKDS +KL +K L+V+P+QRIPRYELL++RL++ TP D  D+  L  A   +H LA+KI  V +++Q+E   E  K LE LL       +R +IRHD V +                              ++RK+  CI+ FSD ++V++ KR+        PV R     L TP G DF +NIK+K   R+ ++++E  + + T  +K  L   ++++  D+ I+ ++  L  KL  +HQ +D  IK L  N+ +   E   +R A + +N +  + +VTT+EG+  +   F + EK+ +WE    D K KL  +   R P F Q L IT+T++GMQF CA PI+G N+ G RDVW+C SDG+ GH+CLLS+Q +PIVT+N+P+PGCNA+++CI AVP + G+ RR +     R  R           P     K   +   L+T   T E    +         V+D  T+ + +E G +S++D S+++ +                 K+ S+D     K+S                  DP K+TMW+G EDG I +F S DN++ TK+K KI  GS V  +++ DNKV+VSL NG+L+ +KR  EG WD +      + S +SPI  M+AV G +W   Q  I +INP ++ IE +F +T  +  + +  L CSGQ VW+  + SSK++L+HA +YE+L EV+I  AV  +LQ  DDII +HK ACLRIT L+VCKD+LW GTSAGVILTIPIP +T++TT+ ++  P V  L  GHTG+VRFL S+E S  +S ++                           R    +   TMA++M +I GGDGYEDF    N   N+  GRDD+ NH+ +W +
Sbjct:  687 DKRYHIVEELYKNEKEYVEALRTLKDKYMVPLKTQSSVDDNIVDNIFYMIPEILTHHSIYLDFLDNVWKHWNTTHSTVGNIITTIFAKQTVLESYMSFVENYNASGKVIENALTTKSSVQKFIEQCQKDSGSKLTMKDLIVRPIQRIPRYELLIQRLLDNTPRDHPDHPLLQQACRVMHDLAVKIGTVNDSQQEEDMQETLKKLELLLITDLAVPDRAYIRHDMVQLFVSFSTSSLVYSRTLGSSVSHWLGTRTRDHKNRKDQCCIWLFSDVVLVSSIKRKSG------PVTRKVSIILKTPLGQDFAENIKHKVWLRVGLDDLEIVKTQGTLTRKPTLDKEQLEE--DIHIVTQLGDLAGKLSCQHQSLDDAIKELNTNLCRQHSEV-TARNASSDSNKM--ELVVTTQEGVLHLVIGFSSAEKRAAWETAFTDAKQKLSLLSDKRAPEFLQPLQITKTRAGMQFSCAAPIDGVNSSGFRDVWVCNSDGYVGHMCLLSLQPEPIVTLNTPVPGCNARILCICAVPAFSGAFRRRASQKGARSQRDSIVVTTIPEGPRINVEKSEEDNVILETPQPTSEPAIIIPTTTITTTLVEDVETNDNFNEEGYQSDSDTSDDEPMSFLPRTTEELYVGGGWSKLLSDDEAPKPKVSELTESSPDPITTSGNWDQDPAKSTMWLGTEDGCIHIFQSCDNIKTTKNKLKIQHGSPVYCIIYLDNKVFVSLVNGDLIVYKRDPEGLWDTECPYTRTIGSASSPITKMLAVAGKLWCGCQNQIHVINPLALNIETSFQVTP-DVTKAVQCLVCSGQGVWVASQQSSKVMLFHAVTYEFLLEVSIAQAVSHKLQSADDIIRQHKAACLRITALMVCKDLLWVGTSAGVILTIPIPRITSTTTRGSLAVPTVTGLIYGHTGHVRFLTSVEISSTASTKAELSKEGTSGESATAERGGGFSFQDIHRRSSMAATTATMASRMLVISGGDGYEDF---RNSAANEGAGRDDSTNHLLLWQV 1679          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Cavefish
Match: ARHGEF17 (Rho guanine nucleotide exchange factor 17 [Source:HGNC Symbol;Acc:HGNC:21726])

HSP 1 Score: 210.305 bits (534), Expect = 3.047e-55
Identity = 119/334 (35.63%), Postives = 190/334 (56.89%), Query Frame = 3
Query: 3768 DP--FKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVE-SLDRGHTGNVRFXXXXXXXXXXXXXXXXXXXXXPCTTMATQMK------------------IICGGDGYEDFTSKSNRENNQDIGRDDAINHIQIWDI 4706
            DP  +++++W+G EDGI  V+ S+DN+R  K+  K+   ++++  ++ DNKV+VSL NGE++ ++R    +WD   S    L S + P+  M+ V G +W   Q  ++IIN +++  E        +  R ++ +   GQ VW+  + S+++ LYH+T+YE + EV++ PAV  ++   D II +HK ACLRIT LL C+DVLW GTSAGV+LT+ IP V+++    ++  P +      GHTG+VRFL S+E           +   S  +T+  Q +                  +I GGDGYEDF   S+ E    +GRDD+ NH+ +W +
Sbjct:  595 DPEAYQSSVWLGTEDGI-HVYQSSDNIRNRKNSMKMQHAASILC-IYLDNKVFVSLANGEVIVYQRE-ASFWDPQSSQTLGLGSPSGPVTKMVPVAGKLWCGCQNRVLIINTSTLAQE-----VGQDSSRCVTCMVSYGQGVWVALQGSAQVRLYHSTTYESITEVDVAPAV-HKMLASDAIIRQHKAACLRITALLACRDVLWIGTSAGVVLTLSIPPVSSNVGAGSLRTPLLPMGSAHGHTGHVRFLTSIELPEGFDVSFPSQTEGSTTSTVGLQRRDSAHRRASTLLQTKSSLLVISGGDGYEDFRLTSSSET---VGRDDSTNHLLLWRV 916          

HSP 2 Score: 205.297 bits (521), Expect = 1.256e-53
Identity = 152/480 (31.67%), Postives = 257/480 (53.54%), Query Frame = 3
Query: 2115 FMVPLKL---EKLLDETSIDTIFNKINELMNYHAEFLSILQV----WKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKINAVKEAKQDETFLEGQKLLERLLSPMTMNQNRQFIRHDPV----TVEDRKEAYCIFSFSDQIIVXXXXXXXXXXXXXPPVLRLMTPSGLDFVD-NIKYKFISRX-----XXXXXXXXXXXDTDQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIASQFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKLVDVPR-TPRFNQALSITRTQSGMQFCCA-----CPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAVPG 3485
            +M PLK      L D + +D +F +I E++ +H  FL  + +    W  +  IG  + + FS+  +   Y+++I+NF  ++  +  A  +K +  KF+EQ  +++K K  L  L+++PVQRIPRYELL+K L+++TP D  D+ +LLDAQ  + +LA KIN            +G++  E +L+P      R+F+R + V    +V  +K+   +F FSD +I TT KR+     +       M+ +    +D + KYKF+ ++      +       N DT QK + R  E     DLS L +I  L   L   HQ +D  IK L A+V +++ E ++   + T    + ++  +TT        F F + + + ++E+  ++ K KL++  +  P F +A+ I +T+SGMQF CA     CP   Y      +VW+C SDG+ G +CLL+++ +P  T+ + +  C+A++ICI AVPG
Sbjct:    2 YMKPLKQPDNSPLCDPSLVDEMFYQIPEILEHHELFLEQVLICVNDWHDRQIIGQLLVQSFSKEILANIYSAYIDNFLNAKDAVRIAKEAKPAFMKFLEQNMRENKEKQALGDLMIKPVQRIPRYELLVKDLLKHTPEDHPDHPFLLDAQKNIKRLAEKIN------------KGRRNAEEILNP-----QRKFLRQEMVMEAKSVGGKKD-RSLFLFSDLLICTTLKRKSGSLRRSS-----MSYTAASVIDTSSKYKFLWKLPLEDIELVKSNQAANRDTIQKTISRLDE-----DLSTLGQISKLSETLSFPHQSLDDVIKDLMASVHRELAEKQSLAFSMTF---LPTKLELTTASAESTFIFEFSSPDARSNFEQAFEEAKKKLMNKDQWDPEFLKAIPIMKTRSGMQFSCASPSHSCPENTY------EVWVCNSDGYVGQVCLLNIRDEP--TVEACIAVCSARIICIAAVPG 442          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Cavefish
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:103035578])

HSP 1 Score: 114.005 bits (284), Expect = 9.312e-25
Identity = 69/225 (30.67%), Postives = 115/225 (51.11%), Query Frame = 3
Query: 3783 TMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQP 4457
            TMW+G ++G + V  +  N +  K    I L  +V+S++H   +V V+L +G L  F R  +G WDL    +  L      I+ M  V   +W   +  I +I P S++IE +F      + + +  LA  G  VW++    S + LYHA ++++L +V+I P V + L        +   + +RIT LL+  + LW GT  GV+++IP+       T+TN + P
Sbjct:  980 TMWLGAQNGWLYVHSAVANWK--KCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRAEDGLWDLTNYHLMDLGRPHHSIRCMAVVHDKVWCGYKNKIHVIQPKSMQIEKSFDAHPRRESQ-VRQLAWIGDGVWVSIRLDSTLRLYHALTHQHLQDVDIEPYVSKMLGTG-----KLGFSFVRITALLIGGNRLWVGTGNGVVISIPL-------TETNKVSP 1189          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Cavefish
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:103035578])

HSP 1 Score: 113.62 bits (283), Expect = 9.947e-25
Identity = 69/225 (30.67%), Postives = 115/225 (51.11%), Query Frame = 3
Query: 3783 TMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQP 4457
            TMW+G ++G + V  +  N +  K    I L  +V+S++H   +V V+L +G L  F R  +G WDL    +  L      I+ M  V   +W   +  I +I P S++IE +F      + + +  LA  G  VW++    S + LYHA ++++L +V+I P V + L        +   + +RIT LL+  + LW GT  GV+++IP+       T+TN + P
Sbjct:  907 TMWLGAQNGWLYVHSAVANWK--KCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRAEDGLWDLTNYHLMDLGRPHHSIRCMAVVHDKVWCGYKNKIHVIQPKSMQIEKSFDAHPRRESQ-VRQLAWIGDGVWVSIRLDSTLRLYHALTHQHLQDVDIEPYVSKMLGTG-----KLGFSFVRITALLIGGNRLWVGTGNGVVISIPL-------TETNKVSP 1116          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Cavefish
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:103035578])

HSP 1 Score: 111.694 bits (278), Expect = 4.649e-24
Identity = 65/210 (30.95%), Postives = 109/210 (51.90%), Query Frame = 3
Query: 3783 TMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPI 4412
            TMW+G ++G + V  +  N +  K    I L  +V+S++H   +V V+L +G L  F R  +G WDL    +  L      I+ M  V   +W   +  I +I P S++IE +F      + + +  LA  G  VW++    S + LYHA ++++L +V+I P V + L        +   + +RIT LL+  + LW GT  GV+++IP+
Sbjct:  928 TMWLGAQNGWLYVHSAVANWK--KCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRAEDGLWDLTNYHLMDLGRPHHSIRCMAVVHDKVWCGYKNKIHVIQPKSMQIEKSFDAHPRRESQ-VRQLAWIGDGVWVSIRLDSTLRLYHALTHQHLQDVDIEPYVSKMLGTG-----KLGFSFVRITALLIGGNRLWVGTGNGVVISIPL 1129          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Cavefish
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:103035578])

HSP 1 Score: 111.694 bits (278), Expect = 4.711e-24
Identity = 65/210 (30.95%), Postives = 109/210 (51.90%), Query Frame = 3
Query: 3783 TMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPI 4412
            TMW+G ++G + V  +  N +  K    I L  +V+S++H   +V V+L +G L  F R  +G WDL    +  L      I+ M  V   +W   +  I +I P S++IE +F      + + +  LA  G  VW++    S + LYHA ++++L +V+I P V + L        +   + +RIT LL+  + LW GT  GV+++IP+
Sbjct:  976 TMWLGAQNGWLYVHSAVANWK--KCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRAEDGLWDLTNYHLMDLGRPHHSIRCMAVVHDKVWCGYKNKIHVIQPKSMQIEKSFDAHPRRESQ-VRQLAWIGDGVWVSIRLDSTLRLYHALTHQHLQDVDIEPYVSKMLGTG-----KLGFSFVRITALLIGGNRLWVGTGNGVVISIPL 1177          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Sea Lamprey
Match: ARHGEF17 (Rho guanine nucleotide exchange factor 17 [Source:HGNC Symbol;Acc:HGNC:21726])

HSP 1 Score: 218.009 bits (554), Expect = 5.534e-58
Identity = 124/332 (37.35%), Postives = 185/332 (55.72%), Query Frame = 3
Query: 3780 ATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIR-HKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVESLDRGHTGNVRFXXX------XXXXXXXXXXXXXXXXXXPCTTMA----------------TQMKIICGGDGYEDFTSKSNRENNQDIGRDDAINHIQIWDI 4706
            ++MW+G EDG I V+ S+DN+R  K+  K+   +AV+ +L+ DNKV+VSL NG+L+ ++R    +WD  +S    + S  +P+  M  V G +W + Q  IV+IN  ++  E+TFT+  S+  R +S L  SG  VW++ ++S+ + LYHA + + L E+++ PAV + L    D IIR HK ACLR+T LL CKD+LW GTSAGV+LT+P+P++        + Q        GHTG+VRFL S        +           Q      T A                T+  +I GGDGYEDF       +N+  GRDD+ NH+ +W +
Sbjct:  710 SSMWLGTEDGCIHVYQSSDNIRNRKNSLKMQHPAAVMCILYLDNKVFVSLLNGDLIVYQREAGCFWDSQHSHTLTVGSPGNPVTKMAHVAGRLWCSCQNIIVVINTANLVPEHTFTVG-SDASRAVSCLVASGLGVWVSVQSSASVRLYHAQTRDCLAEIDVAPAVHKMLAGGADAIIRQHKAACLRVTALLACKDMLWVGTSAGVLLTLPLPHIRIQGPPL-LAQLLPMGSTHGHTGHVRFLTSIELPLDAVAETGPPPAPPHHQQQQQQHTWARQGSARRRAQAAAPPRTRTLVISGGDGYEDFRLSG---SNESAGRDDSTNHLLLWRV 1036          

HSP 2 Score: 147.902 bits (372), Expect = 5.210e-36
Identity = 128/439 (29.16%), Postives = 220/439 (50.11%), Query Frame = 3
Query: 2274 FSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKIN-----------AVKEAKQDETFLEGQKLLERLLSPMTMNQNRQFIRHDPVTVEDR----KEAYCIFSFSDQIIVXXXXXXXXXXXXXPPVLRLMTPSGLDFVDNIKYKFISRX-------XXXXXXXXXXXDTDQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESR--NSRVAPTVNNSIASQFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKL----VDVPRTPRFNQ-ALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAVPGYLGSTR 3503
            FS+  +   Y+++I+NF  ++  +  A  +K +  +F+EQ  +++K K  L  L+++PVQRIPRYELL+K L+++TP +  D++ L  AQ  V  LA +IN           A +  ++ E  +EG      L++P+     R+F++ + + VE +    K+   +F F+D ++ TT K++     +    + L T +G     + KYK + ++           +    + D+  K L R        D S L +I TL   L   HQ +D  IK L A V +++ E +   +    TV  S ++Q L T+    E   F F   E + ++E+++++ K KL        R P   +  +   R    +QF CA P  G  +    +VW+C SDG+ G +CLLS++ DP+V   + +  C+A+++CI  VPG    TR
Sbjct:   92 FSKDILANSYSAYIDNFLNAKDAVRLAKEAKPAFNRFLEQCMRENKEKQALADLMIKPVQRIPRYELLIKDLLKHTPEEHPDHSSLTVAQRDVRLLAERINQGKRDAEEAERAARVLQEVEAHIEGAT---ELVAPL-----RKFLKQE-MVVEVKGAGGKKDRSLFLFTDLLLCTTLKKKSGSLRRS--SMNLYT-AGCVIDTSSKYKLLWKVPLEDVDVMKGLLAPAPSRDSLHKALTRLE-----GDFSTLSQISTLAETLSITHQTLDEVIKELMACVNRELSERQLLAASAFATVPPSGSTQSL-TSPLSAESFVFEFTGGEPRAAFEQMLEETKRKLGTSTCTRARAPECTRVCVPFRRPCRPLQFSCASPSLGAWDHS-SEVWVCNSDGYVGQVCLLSVRPDPMV--EACIAVCSARILCIAPVPGLGRGTR 509          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008020.1 (pep scaffold:Pmarinus_7.0:GL476484:132482:154779:-1 gene:ENSPMAG00000007248.1 transcript:ENSPMAT00000008020.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 8.357e-17
Identity = 58/182 (31.87%), Postives = 97/182 (53.30%), Query Frame = 3
Query: 2049 IIQELLSVESEYVKVLEILVNHFMVPLKLEKLLDETSIDTIFNKINELMNYHAEFLSILQVWKPKDTIGD--KIAEMF-SRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKINAVK 2585
            ++ E+L  E  YV+ L+ +V  ++  +   + L    ++T+F  I E+  +++E L  L+     D   D   IAE F  ++   E YT +  NF  S +LL   + +KS+  KF    Q   K+ LPL + L++PVQRI +Y LLL+ + +     +D Y  + DA +A+H +A  IN +K
Sbjct:   13 VVLEILDTERMYVRHLKSIVEDYLRAI--SQRLPNDDVNTLFGNIKEIYKFNSELLEELE-----DCSNDPVAIAECFVEKSGGFEIYTQYCTNFPSSMELLTKCMRTKST-AKFFRDHQAALKHNLPLGSFLLKPVQRILKYHLLLQEIEKRLDKSTDGYEVVQDALSAMHGVAWHINEMK 186          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008024.1 (pep scaffold:Pmarinus_7.0:GL476484:132482:154761:-1 gene:ENSPMAG00000007248.1 transcript:ENSPMAT00000008024.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.1073 bits (196), Expect = 4.575e-16
Identity = 62/197 (31.47%), Postives = 103/197 (52.28%), Query Frame = 3
Query: 2004 DRILLEKQKVEKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEKLLDETSIDTIFNKINELMNYHAEFLSILQVWKPKDTIGD--KIAEMF-SRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKINAVK 2585
            DR++LE    E+ Y  ++ L S+   YV ++E     ++  +   + L    ++T+F  I E+  +++E L  L+     D   D   IAE F  ++   E YT +  NF  S +LL   + +KS+  KF    Q   K+ LPL + L++PVQRI +Y LLL+ + +     +D Y  + DA +A+H +A  IN +K
Sbjct:    5 DRVVLEILDTERMY--VRHLKSIVESYVNLIE---QDYLRAIS--QRLPNDDVNTLFGNIKEIYKFNSELLEELE-----DCSNDPVAIAECFVEKSGGFEIYTQYCTNFPSSMELLTKCMRTKST-AKFFRDHQAALKHNLPLGSFLLKPVQRILKYHLLLQEIEKRLDKSTDGYEVVQDALSAMHGVAWHINEMK 188          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Sea Lamprey
Match: fgd1 (FYVE, RhoGEF and PH domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-081104-33])

HSP 1 Score: 77.0258 bits (188), Expect = 2.183e-14
Identity = 62/219 (28.31%), Postives = 107/219 (48.86%), Query Frame = 3
Query: 2034 EKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEKLLDETSIDT---------IFNKINELMNYHAEFL-----SILQVWKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQK-DSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKIN----AVKEAKQDETFLEGQKLLE 2633
            EK Y I  ELL  E  YV  L +L   F       +LL+E+ I +         IF+  + +  +H EFL       +Q W     IGD + ++    P  + Y  +++NF  +  LL   +   S  +  +++ QK D  + L L+  +++PVQRIPRYELLL+  ++  P D+ D     DA+ ++  ++   N    A+++ ++    LE  ++L+
Sbjct:  233 EKLYKIADELLQTERAYVTRLHLLDKVFCA-----RLLEESCIKSTFPADVVTGIFSNTSTIHMFHQEFLLPELEKRMQEWHENPRIGDVLQKL---APFLKMYGEYVKNFDRAMDLLNTWMEKSSPFKAIIQEIQKRDICHNLTLQHHMLEPVQRIPRYELLLRDYLKRLPEDAVDRK---DAEKSLEIISTAANHSNAAIRKMEKMHKLLEVYEMLD 440          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000535.1 (pep scaffold:Pmarinus_7.0:GL480899:1793:11000:-1 gene:ENSPMAG00000000475.1 transcript:ENSPMAT00000000535.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.4034 bits (176), Expect = 1.316e-13
Identity = 58/196 (29.59%), Postives = 96/196 (48.98%), Query Frame = 3
Query: 2034 EKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEKLLDET--------SIDTIFNKINELMNYHAEFL-----SILQVWKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVE--QKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKIN 2576
            +K + I  ELL+ E  YV+ L++L   F       +LL+E         +I+ IF+ I+ +  +H EFL       ++ W+    IGD + ++    P    Y  ++  F  + +L++         +K +   Q QK+S   L L+  +++PVQRIPRYELLLK  +   P DS D     DAQ ++  ++   N
Sbjct:    6 QKLFFIATELLTTERNYVQRLQLLDKAFYA-----RLLEEANRGSFPVETINHIFSNISSIHLFHKEFLLPQLEGRMEAWEETPRIGDILQKL---APFLMMYGEYVRCFDRAMELVDTWSQRSPQFKKIITEVQMQKES-GCLSLQHHMLEPVQRIPRYELLLKDYLRRLPLDSPDRG---DAQKSLDIISTAAN 189          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Yeast
Match: ROM1 (Guanine nucleotide exchange factor (GEF) for Rho1p; mutations are synthetically lethal with mutations in rom2, which also encodes a GEP; ROM1 has a paralog, ROM2, that arose from the whole genome duplication [Source:SGD;Acc:S000003302])

HSP 1 Score: 62.003 bits (149), Expect = 7.438e-10
Identity = 70/273 (25.64%), Postives = 129/273 (47.25%), Query Frame = 3
Query: 1914 QNSNIAPDLFDENSIKLEVSSDETILEEVDDRILLEKQKVEKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEKLLDETSIDT---------IFNKINELMNYHAEFLSILQVWKPKDTIGDKIAEMF-SRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTP--SDSDDYNYLLDAQTAVHQLAIKINAVKEAKQDE---TFLEGQKLLERLLSPMTMNQNRQFIRHD 2687
            +N ++A D  D+  I    S  +++ E       L KQ++ KR   I EL + E ++VK LEI+ + FM     +KLL+   I +         +F  INE+ + + EFL  L   +    I   IA++F    P  + + S+I +   ++ L+E   +   +  +F + +  +S  +  + + L Q V R  RY LL++ +I ++   +D DD   L+  Q  +  L  +I+    A QD      L+ + L +     + +N  ++ I+H+
Sbjct:  430 RNISLALDKEDDERISWTNSVPKSVWES------LSKQQI-KRQEAIYELFTTEKKFVKSLEIIRDTFM-----KKLLETNIIPSDVRINFVKHVFAHINEIYSVNREFLKALAQRQSLSPICPGIADIFLQYLPFFDPFLSYIASRPYAKYLIETQRSVNPNFARF-DDEVSNSSLRHGIDSFLSQGVSRPGRYSLLVREIIHFSDPVTDKDDLQMLMKVQDLLKDLMKRIDRASGAAQDRYDVKVLKQKILFKNEYVNLGLNNEKRKIKHE 689          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Yeast
Match: ROM2 (Guanine nucleotide exchange factor (GEF) for Rho1p and Rho2p; mutations are synthetically lethal with mutations in rom1, which also encodes a GEF; Rom2p localization to the bud surface is dependent on Ack1p; ROM2 has a paralog, ROM1, that arose from the whole genome duplication [Source:SGD;Acc:S000004363])

HSP 1 Score: 51.6026 bits (122), Expect = 1.127e-6
Identity = 62/249 (24.90%), Postives = 108/249 (43.37%), Query Frame = 3
Query: 2037 KRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEKLLD----ETSIDTIFNKINELMNYHAEFLSILQVWKPKDTIGDKIAEMFSR-TPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSD--DYNYLLDAQTAVHQLAIKINAVKEAKQDE---TFLEGQKLLERLLSPMTMNQNRQFIRHDPVTVEDRKEAYCIFSFSDQIIV 2753
            KR   I E+   E  +VK LEI  + FM  L    ++     +  I  +F  IN++ + +  FL  L   +    +   I ++  R  P  E + S++ +   ++ L+E   +      +F +     S  +  + + L Q V R  RY LL+K +++ T  + D  DY  L  A  A+     +I+    A QD      L+ + L +     + +N  R+ I+H+ +    RKE     S SD  +V
Sbjct:  659 KRQEAIYEVYITEKNFVKSLEITRDTFMKTLAETNIISADIRKNFIKHVFAHINDIYSVNRRFLKALTDRQRSSPVVRGIGDIVLRFIPFFEPFVSYVASRPYAKYLIETQRSVNPYFARF-DDDMMSSSLRHGIDSFLSQGVSRPGRYMLLVKEIMKSTDPEKDKSDYEDLSKAMDALRDFMKRIDQASGAAQDRHDVKLLKQKILFKNEYVNLGLNDERRKIKHEGIL--SRKE----LSKSDGTVV 900          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Nematostella
Match: EDO44521 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVX0])

HSP 1 Score: 296.204 bits (757), Expect = 2.388e-83
Identity = 285/1041 (27.38%), Postives = 478/1041 (45.92%), Query Frame = 3
Query: 2037 KRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEK---LLDETSIDTIFNKINELMNYHAEFLSILQV----WKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKINAV-KEAKQDETFLEGQKLLERLLSPMT--MNQNRQFIRHD-------PVTVEDRKEAYCIFSFSDQIIVXXXXXXXXXXXXXPPVLRL--------MTPSGLDFVDNIKYKFISRXXXXXXXXXXXXDTDQKVLLRNREMKDR-KDLSILQEIETLVSKLDRKHQ------------------DMDICIKRLYA-------NVLQDMEESRNSRVAPTVNNSIAS--QFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKLV---DVPRTPRFNQALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAVPGY--------------------LG--------STRRSSLS--------------MDGRFSR--PI--ERKRKQTGEVYQLDTQVETQEDDADVEQDQSANVDDSNTSQSCSESGESETDESNNKLVRKISSEDSPKNKKLSD--PFKA----TMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIE-----------------------NTFTLTESND-QRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVESLDRGHTGNVRFXXXXXXXXXXXXXXXXXXXXXPCTTMAT-------------------QMKIICGGDGYEDFTSKSNRENNQDIGRDDAINHIQIWDI 4706
            KR+ ++Q LL  E  YV+ L+ LV +++ PLK  +   +++   +D +F +I +++  H  FL  LQ     W  K  IGD I   F++  + + Y++FI +F  +   +  A  S+    +F+EQ  +D + KL L+ L++ PVQRIPRY L+LK +I++TP+D  D+  L  A   +  LA ++N   KE  + E   E  + +E  +  ++  +   R F R D        +T +DR     +F F+D ++    KR+       P  LR          + +G +F    K+K + ++ +E IE  ++    Q+     RE++    D+S+L +I  L   L+  HQ                  D   C +  +         ++ D+      R  P V  S+++  +    T+EG E   F     E K SWE    + + +L    D          L  +R    ++   +  + G+ +  IR +    +   + H    ++   PI +++     C+++++CI+ VPG                     LG        ST+ +                 M+G+F    P+   R   +   +  +D ++E+ +DD  V  + +++ DD          G+S   +S    V    +ED     KLSD  PF+A    T+W+G EDG I V+   D  +  K K +I   +AV  +L+ DN+V+V+L NG+L  ++R     W++    I  + S  +P+  M AV G +W   Q N +I+N T++KIE                       N  T   S D +R +  L  SG  VW++ ++S+ + L+HAT YE L +V++ P V + L   D II +HK ACLR+T LL C+D+LW GTSAGV+LT+P+P +T +T+      P   +   GHTG+VRFL ++E        ++  +  +   T ++                    + II GGDGYEDF + S  E+    GRDD+ NH+ +W +
Sbjct:    4 KRH-VLQNLLDTEQSYVQNLQYLVTNYLKPLKRPENANIVEPAQVDEMFYQIPDILLCHEFFLDQLQARVNDWHDKQKIGDIIVASFTKCFLMDAYSAFINHFLHARAAVRVATMSRPGFARFIEQCCRDHREKLTLQDLMIMPVQRIPRYVLILKDMIKHTPTDHPDHGSLQLAMGEIKTLANRMNMREKEVNKAEKDAEDLRAIEASIEGISDLVIPGRYFKRKDLAAEVRGSITKKDRS----LFLFNDLLVCAIVKRK-------PNALRRGSLSLFSGQSGAGAEFN---KHKLLWKLPLEYIELLRSSPEVQRRNSLERELERLDNDMSLLSQISALSDTLNISHQITCAFAQNYNVRSCRTGLDNKWCFRGSFQMLDSSIRELMNDVSRQIAERQVP-VQQSLSAKLELQAQTEEGPETFTFLLLDAEIKNSWESDFMNARKELALSNDWASCLLVGFQLVFSRLCLFIEISSSVAVTGWRSSTIRSI----ASILSSHRVRHTLIKAPIASLSV----CSSRILCISPVPGARLIGLETIHPDADSKSDTRSLGESSSYKVPSTKSTDYEDEDDDEDGLGNDSFMEGKFGSGSPMFDGRLSPEGSSLGTIDGEMESSDDDESVSDENASSDDDDKRKHGRKHIGKSRNLDSGT--VPVPGAED-----KLSDIVPFEAEEGSTVWLGTEDGSIYVYPVQDIQQ--KKKMRIQHNAAVHCILYVDNQVFVALGNGDLCVYRRQPGCPWEVSSPIIVPVGS-GAPVTCMTAVHGRLWCGCQCNAIIVNTTTLKIEVRIVNRFKDLRSRAPLICSRILPNYITFNCSLDKERAVYRLVSSGMGVWLSLQSSATVRLFHATKYECLADVDVGPPVHKMLAGSDAIIRQHKAACLRVTSLLTCRDLLWIGTSAGVVLTLPLPTITVTTSSLR-NSPSASASYHGHTGHVRFLTAVEVPKPGDQDTTLDKERNNSVTSSSTPDPPLTPGEPGVVNGPSRHILIISGGDGYEDFKTSSTSES---AGRDDSTNHLLVWQV 1006          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Nematostella
Match: EDO47039 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNC5])

HSP 1 Score: 107.071 bits (266), Expect = 3.193e-23
Identity = 85/322 (26.40%), Postives = 144/322 (44.72%), Query Frame = 3
Query: 3447 CNAKVICITAVPGYLGSTRRSSLSMDGRFSRPIERKRKQTGEVYQLDTQVETQEDDADVEQDQSANVDDSNTSQSCSESGESETDESNNKLVRKISSEDSPKNKKLSDPFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPI 4412
            C + ++CITAVPG                + P +      G+      +V +   D+     Q   V DS T    S      T ES+    R    E +  +  L      TMW+G + G + V  +    R     + I L  +V+S++H   +V V+L +G +  F R  +G W+ +   +  L      I+ M  V   +W   +  I +I+P ++++E TF     ++ + +  LA  G  VW++    S + LY+A +Y +L +++I P V + L        +   + +RIT LL+  D LW GT  GVIL++P+
Sbjct:  703 CTSHLLCITAVPG----------------ASPGDYDAASVGD----GARVSSAPQDSQTCDKQP--VSDSPTVTDVS------TSESDRVDARSADGEGTKMSSVL-----PTMWLGAQSGCVYVHSAISQWRTC--IQSIRLKDSVLSIVHVKGRVLVALADGTVAIFHRSSDGQWNFNNYHLLDLGRPHHSIRCMAMVHDKVWCGYRNKIQVIHPRTMRVEKTFDAHPRHESQ-VRQLAWIGDGVWVSIRLDSTLRLYNAQTYHHLQDIDIEPYVSKMLGTG-----KLGFSFVRITSLLLTNDRLWVGTGNGVILSVPL 983          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Nematostella
Match: EDO31587 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXH1])

HSP 1 Score: 79.337 bits (194), Expect = 7.573e-15
Identity = 56/192 (29.17%), Postives = 97/192 (50.52%), Query Frame = 3
Query: 2034 EKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEKLLDETSIDTIFN-KINELMNYHAEFLSIL----QVWKPKDTIGDKIAEMFSRTP----VQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSK-NKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKINA 2579
            EKR LI+QE+L  E +Y+K LE + + F   L+  +++    +D IF   ++E++  H      L    Q W  + T GD     FS+      VQ+ Y+ F  NF  + + +     S      F+E  + +   N L L+A L+ P+QR+PRY LL+ +L+++T     D  ++  A T + +   ++N+
Sbjct:   38 EKRLLIVQEILETEEKYIKCLETIRDVFEDRLRRLRIIPTKDVDVIFPPSLSEILTSHIRLHETLSQRIQEWNYRSTFGDLFVRFFSQDEQGDLVQK-YSEFSNNFPKAIRTIHKWRLSSHKFDNFLETCRANWPCNGLDLQAYLLNPIQRLPRYVLLISQLVKFTDVSHPDRVHVEQAFTTLTRSVDELNS 228          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Nematostella
Match: EDO48232 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKE8])

HSP 1 Score: 72.4034 bits (176), Expect = 7.072e-13
Identity = 60/226 (26.55%), Postives = 111/226 (49.12%), Query Frame = 3
Query: 2031 VEKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEKLLDETSIDTIFNKINELMNYHAEFLSILQ----VWKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNK-LPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKIN-AVKEAKQDETFLEGQKLL---ERLLSPMTMNQNRQFIR 2681
            ++K Y I  E+LS E  +V+ L +        +K  +++ E++++ IF  +  + +   +FL  L+     W+  + IGD I + +      + YT++I N+  +  +L+  +       + V + Q   K K L L + +++PVQRIP Y LLL   +++ P +S +Y  +  A   V ++A  IN ++K     E  L  Q  L   E ++ P      R+FI+
Sbjct:    1 MKKTYHITHEILSTERTFVESLRLAYEDCYGSVKAAEVVPESTLNEIFKDLGNIYHLDVKFLQELEERMKTWEDHERIGD-IVKKYGH--FLKMYTTYINNYDKAANVLQETMKENPQFAELVLEFQASKKCKGLMLNSFMLKPVQRIPSYRLLLIDYLKHLPPESAEYQDIKVALDIVSEVATHINESMKRVDNFEQVLRIQGSLVGHEEIVRP-----GREFIK 218          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Nematostella
Match: EDO32328 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVF8])

HSP 1 Score: 69.707 bits (169), Expect = 7.806e-12
Identity = 58/196 (29.59%), Postives = 103/196 (52.55%), Query Frame = 3
Query: 2031 VEKRYLIIQELLSVESEYVKVLEILVNHFM---------VPLKLEKLLDETSIDTIFNKINELMNYH-AEFLSILQVWK--PKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKINAV 2582
            ++KR  I+ EL++ E +YV+ L+ +V  ++         +P++L    D+   +TIF  I E++ +H  +FL  L      PK ++G    E   R    E Y  + +N   SE L +  +N       ++ + Q +  +KLPL A L++PVQRI +Y+LLL+ +++ T +D   Y  L++A  A+  +   +N V
Sbjct:  482 IKKRSQIMAELVTTEKDYVRDLDHIVRGYLHEFERAAGKIPIEL---FDQR--ETIFGNIEEILEFHRCDFLEELNKCSETPK-SVGKVFTE---RRGEFEKYALYCKNKPASEALQQQLINVP-----YIRECQANLGHKLPLTAYLLKPVQRITKYQLLLREMMKNTKNDRIAYMNLMEAFHAMQNVLRHLNDV 663          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Medaka
Match: ARHGEF17 (Rho guanine nucleotide exchange factor 17 [Source:NCBI gene;Acc:101162545])

HSP 1 Score: 231.491 bits (589), Expect = 1.530e-60
Identity = 171/527 (32.45%), Postives = 284/527 (53.89%), Query Frame = 3
Query: 2022 KQKVEKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLE---KLLDETSIDTIFNKINELMNYHAEFL----SILQVWKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKIN----AVKEAKQD-------ETFLEGQKLLERLLSPMTMNQNRQFIRHDPV----TVEDRKEAYCIFSFSDQIIVXXXXXXXXXXXXXPPVLRLMTPSGLDFVDNI-KYKFISR------XXXXXXXXXXXXDTDQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIASQFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKLV--DVPRTPRFNQALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAVPGYLGSTRRS 3509
            K +V+ R  ++  LL  E  YV+ L  LV  +M PLK      ++D   +D +F +I E++ +H  FL    S +  W  + TIG  + + FS+  + + Y+++I+NF  +   +  A  +K +  KF+EQ  +++K K  L  L+++PVQRIPRYELL+K L+++TP D  D++YL+DAQ  + +LA KIN    + +EA+++       E  +EG   +E +L+P      R+F+R + V    TV  +K+   +F FSD II TT KR+     +    + L T + +  +D   KYKF+ +        +++     N+++ QK++ R  E     DLS + +I  L   L   H  +D  IK L A+V +++ E ++   + T    + ++   TT        F F + +   S+E+  +D K KL        P F +A+ I +T+SGMQF CA P     + G  +VW+C SDG+ G +CLL+++ +P  T+ + +  C+A++ICI AVPG  G  R S
Sbjct: 1570 KPRVDMRKHVMMTLLDTEQSYVESLRSLVQGYMRPLKQPDSGTIVDPLLVDEMFYQIPEILEHHEHFLDQVSSCVSQWHDRQTIGHILVQSFSKEALADMYSAYIDNFLNARDAVRIAKEAKPAFHKFLEQNMRENKEKQALGDLMIKPVQRIPRYELLVKDLLKHTPEDHPDHSYLMDAQRDIKRLAEKINKGRRSAEEAEREARVIQEIEAHIEG---VEHILNP-----QRKFLRQEIVMEAKTVGGKKD-RSLFLFSDLIICTTLKRKSGSLRRS--SMSLYTAASV--IDTTSKYKFLWKLPLEEVEVVKSSTQATNKESIQKMISRLEE-----DLSTMGQISKLSETLSFPHLSLDEVIKDLMASVHKELSEKQSLAFSMTF---LPTKLEFTTVSAESTFVFEFSSPDALSSFEQAFEDAKKKLAMNKDQWDPEFLKAIPIMKTRSGMQFSCASPSHSCPDSGC-EVWVCNSDGYVGQVCLLNIKDEP--TVEACIAVCSARIICIAAVPGLKGRDRGS 2072          

HSP 2 Score: 225.713 bits (574), Expect = 8.074e-59
Identity = 124/348 (35.63%), Postives = 187/348 (53.74%), Query Frame = 3
Query: 3768 DP--FKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVE-SLDRGHTGNVRFXXXXXXXXXXXXXXXXXXXXXPCTTMA--------------------------------TQMKIICGGDGYEDFTSKSNRENNQDIGRDDAINHIQIWDI 4706
            DP  +++++W+G EDG I V+ S+DN+R  K+  K+   ++++ +L FDNKV+VSL NGE++ ++R    +WD   S    L +  SP+  M+ V G +W  SQ  ++IINPT++  E+ F +  ++  R +  +   G  VW+  + S+++ LYHA ++E L EV++ PAV + L   D II +HK ACLRIT LL CKD+LW GTSAGV+LT+ IP VT+ T    +    V      GHTG+VRF                  +  P TT +                                T   +I GGDGYEDF   ++ E    +GRDD+ NH+ +W +
Sbjct: 2219 DPEAYQSSVWLGTEDGCIHVYQSSDNIRNRKNSMKMQHAASILCILFFDNKVFVSLANGEVIVYQRDAGSFWDPQSSQTLVLGTPRSPVTKMVPVGGKLWCGSQNKVLIINPTTLVQEHWFQVG-TDSSRCVICMVAYGHGVWLALQGSAQVRLYHAQTWESLTEVDVAPAVHKMLAGADAIIRQHKAACLRITALLACKDLLWIGTSAGVVLTLAIPAVTSGTGAGTLKSSLVPMGSAHGHTGHVRF------LTSIELPEGFDMNFPPTTTNSTGNLSQSSSTVEGGLQRRDSAHRRTSAHIPPKTNHLVISGGDGYEDFRLTNSSET---VGRDDSTNHLLLWRV 2556          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Medaka
Match: ARHGEF17 (Rho guanine nucleotide exchange factor 17 [Source:NCBI gene;Acc:101162545])

HSP 1 Score: 231.491 bits (589), Expect = 1.605e-60
Identity = 171/527 (32.45%), Postives = 284/527 (53.89%), Query Frame = 3
Query: 2022 KQKVEKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLE---KLLDETSIDTIFNKINELMNYHAEFL----SILQVWKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKIN----AVKEAKQD-------ETFLEGQKLLERLLSPMTMNQNRQFIRHDPV----TVEDRKEAYCIFSFSDQIIVXXXXXXXXXXXXXPPVLRLMTPSGLDFVDNI-KYKFISR------XXXXXXXXXXXXDTDQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIASQFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKLV--DVPRTPRFNQALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAVPGYLGSTRRS 3509
            K +V+ R  ++  LL  E  YV+ L  LV  +M PLK      ++D   +D +F +I E++ +H  FL    S +  W  + TIG  + + FS+  + + Y+++I+NF  +   +  A  +K +  KF+EQ  +++K K  L  L+++PVQRIPRYELL+K L+++TP D  D++YL+DAQ  + +LA KIN    + +EA+++       E  +EG   +E +L+P      R+F+R + V    TV  +K+   +F FSD II TT KR+     +    + L T + +  +D   KYKF+ +        +++     N+++ QK++ R  E     DLS + +I  L   L   H  +D  IK L A+V +++ E ++   + T    + ++   TT        F F + +   S+E+  +D K KL        P F +A+ I +T+SGMQF CA P     + G  +VW+C SDG+ G +CLL+++ +P  T+ + +  C+A++ICI AVPG  G  R S
Sbjct: 1528 KPRVDMRKHVMMTLLDTEQSYVESLRSLVQGYMRPLKQPDSGTIVDPLLVDEMFYQIPEILEHHEHFLDQVSSCVSQWHDRQTIGHILVQSFSKEALADMYSAYIDNFLNARDAVRIAKEAKPAFHKFLEQNMRENKEKQALGDLMIKPVQRIPRYELLVKDLLKHTPEDHPDHSYLMDAQRDIKRLAEKINKGRRSAEEAEREARVIQEIEAHIEG---VEHILNP-----QRKFLRQEIVMEAKTVGGKKD-RSLFLFSDLIICTTLKRKSGSLRRS--SMSLYTAASV--IDTTSKYKFLWKLPLEEVEVVKSSTQATNKESIQKMISRLEE-----DLSTMGQISKLSETLSFPHLSLDEVIKDLMASVHKELSEKQSLAFSMTF---LPTKLEFTTVSAESTFVFEFSSPDALSSFEQAFEDAKKKLAMNKDQWDPEFLKAIPIMKTRSGMQFSCASPSHSCPDSGC-EVWVCNSDGYVGQVCLLNIKDEP--TVEACIAVCSARIICIAAVPGLKGRDRGS 2030          

HSP 2 Score: 225.713 bits (574), Expect = 9.303e-59
Identity = 125/348 (35.92%), Postives = 189/348 (54.31%), Query Frame = 3
Query: 3768 DP--FKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVE-SLDRGHTGNVRFXXXXXXXXXXXXXXXXXXXXXPCTTMAT--------------QMK------------------IICGGDGYEDFTSKSNRENNQDIGRDDAINHIQIWDI 4706
            DP  +++++W+G EDG I V+ S+DN+R  K+  K+   ++++ +L FDNKV+VSL NGE++ ++R    +WD   S    L +  SP+  M+ V G +W  SQ  ++IINPT++  E+ F +  ++  R +  +   G  VW+  + S+++ LYHA ++E L EV++ PAV + L   D II +HK ACLRIT LL CKD+LW GTSAGV+LT+ IP VT+ T    +    V      GHTG+VRF                  +  P TT +T              Q +                  +I GGDGYEDF   ++ E    +GRDD+ NH+ +W +
Sbjct: 2177 DPEAYQSSVWLGTEDGCIHVYQSSDNIRNRKNSMKMQHAASILCILFFDNKVFVSLANGEVIVYQRDAGSFWDPQSSQTLVLGTPRSPVTKMVPVGGKLWCGSQNKVLIINPTTLVQEHWFQVG-TDSSRCVICMVAYGHGVWLALQGSAQVRLYHAQTWESLTEVDVAPAVHKMLAGADAIIRQHKAACLRITALLACKDLLWIGTSAGVVLTLAIPAVTSGTGAGTLKSSLVPMGSAHGHTGHVRF------LTSIELPEGFDMNFPPTTTNSTGNLSQSSSTVEGGLQRRDSAHRRTSAHIPPKTNHLVISGGDGYEDFRLTNSSET---VGRDDSTNHLLLWRV 2514          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Medaka
Match: ARHGEF17 (Rho guanine nucleotide exchange factor 17 [Source:NCBI gene;Acc:101162545])

HSP 1 Score: 209.92 bits (533), Expect = 8.998e-59
Identity = 119/315 (37.78%), Postives = 186/315 (59.05%), Query Frame = 3
Query: 3768 DP--FKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVESLDRGHTGNVRFXXXXXXXXXXXXXXXXXXXXXPCTTMATQMKIICGGDGYEDFTSKSNRENNQDIGRDDAINHIQIWDI 4706
            DP  +++++W+G EDG I V+ S+DN+R  K+  K+   ++++ +L FDNKV+VSL NGE++ ++R    +WD   S    L +  SP+  M+ V G +W  SQ  ++IINPT++  E+ F +  ++  R +  +   G  VW+  + S+++ LYHA ++E L EV++ PAV + L   D II +HK ACLRIT LL CKD+LW GTSAG        + T+ T K++++ P   +   GHTG+VRFL S+E     +   +            T   +I GGDGYEDF   ++ E    +GRDD+ NH+ +W +
Sbjct:  117 DPEAYQSSVWLGTEDGCIHVYQSSDNIRNRKNSMKMQHAASILCILFFDNKVFVSLANGEVIVYQRDAGSFWDPQSSQTLVLGTPRSPVTKMVPVGGKLWCGSQNKVLIINPTTLVQEHWFQVG-TDSSRCVICMVAYGHGVWLALQGSAQVRLYHAQTWESLTEVDVAPAVHKMLAGADAIIRQHKAACLRITALLACKDLLWIGTSAG---KAAFGSPTSGTLKSSLV-PMGSA--HGHTGHVRFLTSIELPEGLNVVLTSAHIPP-----KTNHLVISGGDGYEDFRLTNSSET---VGRDDSTNHLLLWRV 416          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Medaka
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:101157621])

HSP 1 Score: 119.013 bits (297), Expect = 2.260e-26
Identity = 84/277 (30.32%), Postives = 134/277 (48.38%), Query Frame = 3
Query: 3627 QDQSANVDDSNTSQSCSESGESETDESNNKLVRKISSEDSPKNKKLSDPFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQP 4457
            Q + A+  D +T QS  ES +  TD           SED  +  K       TMW+G ++G + V  +  N +  K    I L  +V+S++H   +V V+L +G L  F R  +G WDL    +  L      I+ M  V   +W   +  I +I P S++IE +F      + + +  LA  G  VW++    S + LYHA ++++L +V+I P V + L        +   + +RIT LL+  + LW GT  GVI++IP+       T+TN + P
Sbjct:  905 QPRHADAFDRSTGQSKEESSQP-TD-----------SEDGSQEAKNYTSVAPTMWLGAQNGWLYVHSAVGNWK--KCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRSEDGQWDLSNYHLMDLGRPHHSIRCMAVVHDKVWCGYKNKIHVIQPKSMQIEKSFDAHPRRESQ-VRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTG-----KLGFSFVRITALLIGGNRLWVGTGNGVIISIPL-------TETNKVSP 1154          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Medaka
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:101157621])

HSP 1 Score: 117.472 bits (293), Expect = 7.312e-26
Identity = 80/262 (30.53%), Postives = 128/262 (48.85%), Query Frame = 3
Query: 3627 QDQSANVDDSNTSQSCSESGESETDESNNKLVRKISSEDSPKNKKLSDPFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPI 4412
            Q + A+  D +T QS  ES +  TD           SED  +  K       TMW+G ++G + V  +  N +  K    I L  +V+S++H   +V V+L +G L  F R  +G WDL    +  L      I+ M  V   +W   +  I +I P S++IE +F      + + +  LA  G  VW++    S + LYHA ++++L +V+I P V + L        +   + +RIT LL+  + LW GT  GVI++IP+
Sbjct:  901 QPRHADAFDRSTGQSKEESSQP-TD-----------SEDGSQEAKNYTSVAPTMWLGAQNGWLYVHSAVGNWK--KCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRSEDGQWDLSNYHLMDLGRPHHSIRCMAVVHDKVWCGYKNKIHVIQPKSMQIEKSFDAHPRRESQ-VRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTG-----KLGFSFVRITALLIGGNRLWVGTGNGVIISIPL 1142          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Planmine SMEST
Match: SMESG000018133.1 (SMESG000018133.1)

HSP 1 Score: 2739.91 bits (7101), Expect = 0.000e+0
Identity = 1480/1484 (99.73%), Postives = 1483/1484 (99.93%), Query Frame = 3
Query:  258 NGIDFSXXXXXXXXXXXXXXXXXXXXXFIAKSKSMDSETLRDCLEKGDFENIETENPXXXXXXXXXXXXXLIKPDPCDGNKTISKIIYGXXXXXXXXXXXXXXXXXXXXXXXXXERFENKLNVFSVSDDESNVSGVSDNFLNSENPNKDPVIVNETIPIDMNSNDHNLELPRQPDKETNCVSVPDISNSDFTSDCSCDINEQRSSKKNESETENVMMPTGSNILKSMQSSPSIAAQFNIIAKSRKTTVPRCRRTDPPNKSTRYMTQPVISDKPGSAECLRDGSYVNLTDSGYTNSVQDITLIQAEDKXXXXXXXXXXXXHNLNKYSRSLSGTARISKESMDCLECNPTKNYQTIKKENVSELDNKSEMSYGSEEMSASPENNIESVFYDESKGPFIKPLRRNERHPSGGSGSFTSNKGFQSSLPGTLKRPTPQHIRIHSDEIKAPSVAISDLTSEYLNRKISQTDRKDIDNSFSTVSLTSRYSPFRHGVDSNGLDTVVSKSPSAQALMXXXXXXXXXXXXXXXXXXKQTHRSLNSSERVLEKSKMDEDKDTYQNSNIAPDLFDENSIKLEVSSDETILEEVDDRILLEKQKVEKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEKLLDETSIDTIFNKINELMNYHAEFLSILQVWKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKINAVKEAKQDETFLEGQKLLERLLSPMTMNQNRQFIRHDPVTVEDRKEAYCIFSFSDQIIVXXXXXXXXXXXXXPPVLRLMTPSGLDFVDNIKYKFISRXXXXXXXXXXXXDTDQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIASQFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKLVDVPRTPRFNQALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAVPGYLGSTRRSSLSMDGRFSRPIERKRKQTGEVYQLDTQVETQEDDADVEQDQSANVDDSNTSQSCSESGESETDESNNKLVRKISSEDSPKNKKLSDPFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVESLDRGHTGNVRFXXXXXXXXXXXXXXXXXXXXXPCTTMATQMKIICGGDGYEDFTSKSNRENNQDIGRDDAINHIQIWDIQ 4709
            +G+DFSKEKNVVTTKTVRRTKRKITTKFIAKSKSMDSETLRDCLEKGDFENIETENPEIIMETITSEITTLIKPDPCDGNKTISKIIYGSSENSKSVLSDSSLSLNTN NLPFSERFENKLNVFSVSDDESNVSGVSDNFLNSENPNKDPVIVNETIPIDMNSNDHNLELPRQPDKETNCVSVPDISNSDFTSDCSCDINEQRSSKKNESETENVMMPTGSNILKSMQSSPSIAAQFNIIAKSRKTTVPRCRRTDPPNKSTRYMTQPVISDKPGSAECLRDGSYVNLTDSGYTNSVQDITLIQAEDKSSNCCDNSVVSSHNLNKYSRSLSGTARISKESMDCLECNPTKNYQTIKKENVSELDNKSEMSYGSEEMSASPENNIESVFYDESKGPFIKPLRRNERHPSGGSGSFTSNKGFQSSLPGTLKRPTPQHIRIHSDEIKAPSVAISDLTSEYLNRKISQTDRKDIDNSFSTVSLTSRYSPFRHGVDS+GLDTVVSKSPSAQALMRNNLNRNRSTTSSVSNSLKQTHRSLNSSERVLEKSKMDEDKDTYQNSNIAPDLFDENSIKLEVSSDETILEEVDDRILLEKQKVEKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEKLLDETSIDTIFNKINELMNYHAEFLSILQVWKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKINAVKEAKQDETFLEGQKLLERLLSPMTMNQNRQFIRHDPVTVEDRKEAYCIFSFSDQIIVTTTKRRGTQTTKKPPVLRLMTPSGLDFVDNIKYKFISRINIENIEFEQNEDTDQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIASQFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKLVDVPRTPRFNQALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAVPGYLGSTRRSSLSMDGRFSRPIERKRKQTGEVYQLDTQVETQEDDADVEQDQSANVDDSNTSQSCSESGESETDESNNKLVRKISSEDSPKNKKLSDPFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVESLDRGHTGNVRFLVSLESSVRSSHQSSRRQSLSPCTTMATQMKIICGGDGYEDFTSKSNRENNQDIGRDDAINHIQIWDIQ
Sbjct:  123 DGVDFSKEKNVVTTKTVRRTKRKITTKFIAKSKSMDSETLRDCLEKGDFENIETENPEIIMETITSEITTLIKPDPCDGNKTISKIIYGSSENSKSVLSDSSLSLNTNTNLPFSERFENKLNVFSVSDDESNVSGVSDNFLNSENPNKDPVIVNETIPIDMNSNDHNLELPRQPDKETNCVSVPDISNSDFTSDCSCDINEQRSSKKNESETENVMMPTGSNILKSMQSSPSIAAQFNIIAKSRKTTVPRCRRTDPPNKSTRYMTQPVISDKPGSAECLRDGSYVNLTDSGYTNSVQDITLIQAEDKSSNCCDNSVVSSHNLNKYSRSLSGTARISKESMDCLECNPTKNYQTIKKENVSELDNKSEMSYGSEEMSASPENNIESVFYDESKGPFIKPLRRNERHPSGGSGSFTSNKGFQSSLPGTLKRPTPQHIRIHSDEIKAPSVAISDLTSEYLNRKISQTDRKDIDNSFSTVSLTSRYSPFRHGVDSSGLDTVVSKSPSAQALMRNNLNRNRSTTSSVSNSLKQTHRSLNSSERVLEKSKMDEDKDTYQNSNIAPDLFDENSIKLEVSSDETILEEVDDRILLEKQKVEKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEKLLDETSIDTIFNKINELMNYHAEFLSILQVWKPKDTIGDKIAEMFSRTPVQECYTSFIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRIPRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKINAVKEAKQDETFLEGQKLLERLLSPMTMNQNRQFIRHDPVTVEDRKEAYCIFSFSDQIIVTTTKRRGTQTTKKPPVLRLMTPSGLDFVDNIKYKFISRINIENIEFEQNEDTDQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQDMEESRNSRVAPTVNNSIASQFLVTTKEGIERMEFTFGTIEKKLSWEKIVKDLKTKLVDVPRTPRFNQALSITRTQSGMQFCCACPIEGYNNFGIRDVWICQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAVPGYLGSTRRSSLSMDGRFSRPIERKRKQTGEVYQLDTQVETQEDDADVEQDQSANVDDSNTSQSCSESGESETDESNNKLVRKISSEDSPKNKKLSDPFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPIPNVTTSTTKTNIIQPKVESLDRGHTGNVRFLVSLESSVRSSHQSSRRQSLSPCTTMATQMKIICGGDGYEDFTSKSNRENNQDIGRDDAINHIQIWDIQ 1606          

HSP 2 Score: 178.333 bits (451), Expect = 1.575e-44
Identity = 86/87 (98.85%), Postives = 87/87 (100.00%), Query Frame = 1
Query:    1 CEFVEEISADTDFHQSILACNGNTGDFEKAANEDLNNCTKNVDFNTHSAASTQLINVNSNLNDKRNAMSDSNELGNELGSSSRKNQM 261
            CEFVEEISADTDFHQSILACNGNTGDFEKAANEDLNNCTKNVDFNTHSAASTQLINVNSNLNDKRNAMSDSNELGNELGSSSRKNQ+
Sbjct:   17 CEFVEEISADTDFHQSILACNGNTGDFEKAANEDLNNCTKNVDFNTHSAASTQLINVNSNLNDKRNAMSDSNELGNELGSSSRKNQV 103          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Planmine SMEST
Match: SMESG000060963.1 (SMESG000060963.1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.629e-16
Identity = 53/229 (23.14%), Postives = 116/229 (50.66%), Query Frame = 3
Query: 3753 NKKLSDPFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIE-------GYWDLDYSAITKLTSQTSPIKNM--IAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPI 4412
            N  +S+  + T+W+G  +G + V  + DN  +      I L  ++I++++ +++V+VSL NG +V F R+I        G W +    + +       I+ +  + +T  IW   +  I++++  S+ +   F     +D   +  + C+G  +W++    + + L+H  +Y++L ++N+ P V + ++     +     + LRI+CL    + +W GT+ G+I++ P 
Sbjct:  711 NTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCL--HHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDY-AVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPSLLGL-----SLLRISCLSASCNRIWIGTNKGIIVSAPF 931          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Planmine SMEST
Match: SMESG000060963.1 (SMESG000060963.1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.682e-16
Identity = 53/229 (23.14%), Postives = 116/229 (50.66%), Query Frame = 3
Query: 3753 NKKLSDPFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIE-------GYWDLDYSAITKLTSQTSPIKNM--IAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPI 4412
            N  +S+  + T+W+G  +G + V  + DN  +      I L  ++I++++ +++V+VSL NG +V F R+I        G W +    + +       I+ +  + +T  IW   +  I++++  S+ +   F     +D   +  + C+G  +W++    + + L+H  +Y++L ++N+ P V + ++     +     + LRI+CL    + +W GT+ G+I++ P 
Sbjct:  700 NTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCL--HHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDY-AVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPSLLGL-----SLLRISCLSASCNRIWIGTNKGIIVSAPF 920          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Planmine SMEST
Match: SMESG000060963.1 (SMESG000060963.1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.727e-16
Identity = 53/229 (23.14%), Postives = 116/229 (50.66%), Query Frame = 3
Query: 3753 NKKLSDPFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIE-------GYWDLDYSAITKLTSQTSPIKNM--IAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPI 4412
            N  +S+  + T+W+G  +G + V  + DN  +      I L  ++I++++ +++V+VSL NG +V F R+I        G W +    + +       I+ +  + +T  IW   +  I++++  S+ +   F     +D   +  + C+G  +W++    + + L+H  +Y++L ++N+ P V + ++     +     + LRI+CL    + +W GT+ G+I++ P 
Sbjct:  717 NTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCL--HHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDY-AVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPSLLGL-----SLLRISCLSASCNRIWIGTNKGIIVSAPF 937          
BLAST of Rho guanine nucleotide exchange factor 17 vs. Planmine SMEST
Match: SMESG000060963.1 (SMESG000060963.1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.743e-16
Identity = 53/229 (23.14%), Postives = 116/229 (50.66%), Query Frame = 3
Query: 3753 NKKLSDPFKATMWIGLEDGIILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKRHIE-------GYWDLDYSAITKLTSQTSPIKNM--IAVTGFIWGTSQRNIVIINPTSVKIENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEVNIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIPI 4412
            N  +S+  + T+W+G  +G + V  + DN  +      I L  ++I++++ +++V+VSL NG +V F R+I        G W +    + +       I+ +  + +T  IW   +  I++++  S+ +   F     +D   +  + C+G  +W++    + + L+H  +Y++L ++N+ P V + ++     +     + LRI+CL    + +W GT+ G+I++ P 
Sbjct:  694 NTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCL--HHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDY-AVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPSLLGL-----SLLRISCLSASCNRIWIGTNKGIIVSAPF 914          
The following BLAST results are available for this feature:
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARHGEF172.379e-5432.00Rho guanine nucleotide exchange factor 17 [Source:... [more]
ARHGEF173.802e-5430.31Rho guanine nucleotide exchange factor 17 [Source:... [more]
SPAG92.764e-2431.39sperm associated antigen 9 [Source:HGNC Symbol;Acc... [more]
SPAG92.969e-2431.39sperm associated antigen 9 [Source:HGNC Symbol;Acc... [more]
SPAG93.092e-2431.39sperm associated antigen 9 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
osg-14.317e-4728.31Rho guanine nucleotide exchange factor osg-1 [Sou... [more]
unc-161.062e-2229.58JNK-interacting protein [Source:UniProtKB/Swiss-P... [more]
unc-161.062e-2229.58JNK-interacting protein [Source:UniProtKB/Swiss-P... [more]
unc-161.157e-2229.58JNK-interacting protein [Source:UniProtKB/Swiss-P... [more]
unc-161.157e-2229.58JNK-interacting protein [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG431023.042e-10828.08gene:FBgn0262562 transcript:FBtr0305013[more]
CG431022.340e-10628.21gene:FBgn0262562 transcript:FBtr0305012[more]
CG431021.241e-10528.44gene:FBgn0262562 transcript:FBtr0344631[more]
CG431022.735e-10528.44gene:FBgn0262562 transcript:FBtr0330032[more]
CG431022.853e-10528.44gene:FBgn0262562 transcript:FBtr0305009[more]
back to top
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARHGEF171.131e-5735.91si:ch211-248g20.5 [Source:NCBI gene;Acc:100002227][more]
ARHGEF171.067e-5536.28si:ch211-248g20.5 [Source:NCBI gene;Acc:100002227][more]
SPAG94.666e-2526.89sperm associated antigen 9b [Source:NCBI gene;Acc:... [more]
mapk8ip31.654e-2431.43mitogen-activated protein kinase 8 interacting pro... [more]
mapk8ip31.665e-2428.20mitogen-activated protein kinase 8 interacting pro... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARHGEF177.836e-5731.78Rho guanine nucleotide exchange factor 17 [Source:... [more]
cldn22.671e-2330.32claudin 2 [Source:Xenbase;Acc:XB-GENE-994508][more]
cldn24.832e-2330.32claudin 2 [Source:Xenbase;Acc:XB-GENE-994508][more]
cldn26.005e-2330.00claudin 2 [Source:Xenbase;Acc:XB-GENE-994508][more]
cldn26.051e-2330.00claudin 2 [Source:Xenbase;Acc:XB-GENE-994508][more]
back to top
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arhgef177.288e-5630.50Rho guanine nucleotide exchange factor (GEF) 17 [S... [more]
Arhgef171.108e-5533.07Rho guanine nucleotide exchange factor (GEF) 17 [S... [more]
Arhgef172.333e-2730.41Rho guanine nucleotide exchange factor (GEF) 17 [S... [more]
Mapk8ip36.800e-2529.25mitogen-activated protein kinase 8 interacting pro... [more]
Mapk8ip37.111e-2529.25mitogen-activated protein kinase 8 interacting pro... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 17 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q80U35|ARHGH_MOUSE5.098e-5530.50Rho guanine nucleotide exchange factor 17 OS=Mus m... [more]
sp|Q96PE2|ARHGH_HUMAN1.826e-5330.31Rho guanine nucleotide exchange factor 17 OS=Homo ... [more]
sp|Q21653|OSG1_CAEEL5.492e-4628.31Rho guanine nucleotide exchange factor osg-1 OS=Ca... [more]
sp|E9PSK7|JIP3_RAT3.696e-2429.25C-Jun-amino-terminal kinase-interacting protein 3 ... [more]
sp|Q9GQF1|JIP3_DROME4.240e-2425.86JNK-interacting protein 3 OS=Drosophila melanogast... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 17 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GJC40.000e+038.67Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2C9K8J50.000e+039.47DH domain-containing protein OS=Biomphalaria glabr... [more]
A0A1S3IW780.000e+040.26rho guanine nucleotide exchange factor 17 OS=Lingu... [more]
A0A2C9K8D30.000e+038.45DH domain-containing protein OS=Biomphalaria glabr... [more]
A0A2C9K8D20.000e+038.29DH domain-containing protein OS=Biomphalaria glabr... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARHGEF173.047e-5535.63Rho guanine nucleotide exchange factor 17 [Source:... [more]
mapk8ip39.312e-2530.67mitogen-activated protein kinase 8 interacting pro... [more]
mapk8ip39.947e-2530.67mitogen-activated protein kinase 8 interacting pro... [more]
mapk8ip34.649e-2430.95mitogen-activated protein kinase 8 interacting pro... [more]
mapk8ip34.711e-2430.95mitogen-activated protein kinase 8 interacting pro... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARHGEF175.534e-5837.35Rho guanine nucleotide exchange factor 17 [Source:... [more]
ENSPMAT00000008020.18.357e-1731.87pep scaffold:Pmarinus_7.0:GL476484:132482:154779:-... [more]
ENSPMAT00000008024.14.575e-1631.47pep scaffold:Pmarinus_7.0:GL476484:132482:154761:-... [more]
fgd12.183e-1428.31FYVE, RhoGEF and PH domain containing 1 [Source:ZF... [more]
ENSPMAT00000000535.11.316e-1329.59pep scaffold:Pmarinus_7.0:GL480899:1793:11000:-1 g... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ROM17.438e-1025.64Guanine nucleotide exchange factor (GEF) for Rho1p... [more]
ROM21.127e-624.90Guanine nucleotide exchange factor (GEF) for Rho1p... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO445212.388e-8327.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470393.193e-2326.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315877.573e-1529.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482327.072e-1326.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO323287.806e-1229.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 17 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARHGEF171.530e-6032.45Rho guanine nucleotide exchange factor 17 [Source:... [more]
ARHGEF171.605e-6032.45Rho guanine nucleotide exchange factor 17 [Source:... [more]
ARHGEF178.998e-5937.78Rho guanine nucleotide exchange factor 17 [Source:... [more]
mapk8ip32.260e-2630.32mitogen-activated protein kinase 8 interacting pro... [more]
mapk8ip37.312e-2630.53mitogen-activated protein kinase 8 interacting pro... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 17 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018133.11.575e-4499.73SMESG000018133.1[more]
SMESG000060963.12.629e-1623.14SMESG000060963.1[more]
SMESG000060963.12.682e-1623.14SMESG000060963.1[more]
SMESG000060963.12.727e-1623.14SMESG000060963.1[more]
SMESG000060963.12.743e-1623.14SMESG000060963.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001497 ID=SMED30001497|Name=Rho guanine nucleotide exchange factor 17|organism=Schmidtea mediterranea sexual|type=transcript|length=4780bp
TGTGAATTTGTAGAAGAAATTTCAGCTGACACAGATTTTCATCAATCAAT
ATTAGCATGTAATGGAAATACGGGAGATTTCGAAAAAGCAGCTAATGAAG
ATTTGAATAACTGCACCAAAAATGTCGATTTCAATACACACTCAGCAGCT
AGCACACAATTAATAAATGTTAATAGTAATTTAAACGATAAAAGAAATGC
CATGTCTGACTCCAATGAATTAGGAAATGAATTAGGTAGCTCTAGTAGAA
AAAATCAAATGGGATCGATTTTTCCAAAGAGAAAAATGTGGTAACGACTA
AAACCGTTCGACGAACCAAACGAAAAATCACCACGAAATTTATTGCCAAA
AGCAAAAGTATGGATTCTGAAACTCTGAGAGACTGCTTGGAAAAGGGTGA
TTTTGAAAATATCGAAACGGAAAACCCGGAAATAATCATGGAAACGATCA
CTAGTGAAATCACGACTTTAATCAAACCAGATCCCTGCGATGGAAATAAA
ACGATATCGAAAATCATTTATGGATCCAGTGAAAATAGTAAATCCGTGTT
GTCTGACTCGAGTCTCTCTCTGAATACCAATAACAACTTACCTTTCTCCG
AAAGATTTGAAAACAAACTCAATGTCTTCAGTGTTTCTGATGATGAGTCG
AATGTCTCGGGAGTCAGTGACAATTTTCTCAACAGTGAAAATCCAAATAA
AGATCCAGTAATTGTAAATGAAACTATTCCAATTGATATGAATTCAAATG
ATCACAACTTGGAATTACCACGCCAACCAGATAAAGAAACAAATTGCGTT
TCTGTTCCTGATATTAGCAATTCTGATTTCACTAGCGATTGCTCTTGTGA
TATTAATGAACAGAGATCTTCAAAAAAGAATGAATCAGAAACTGAAAATG
TCATGATGCCAACTGGTAGCAACATTTTAAAATCAATGCAGAGCTCTCCT
TCTATTGCTGCTCAATTCAATATTATTGCCAAATCGAGAAAGACTACAGT
GCCAAGATGTAGAAGAACTGATCCCCCTAATAAATCGACAAGATATATGA
CACAGCCTGTCATTTCCGATAAACCAGGAAGTGCTGAATGCTTAAGAGAT
GGCTCCTATGTTAACCTAACCGATTCCGGATATACAAACAGTGTCCAAGA
CATCACTTTGATTCAAGCTGAAGATAAATCTAGCAATTGCTGTGATAATT
CAGTAGTCAGTTCTCATAATTTAAACAAGTATTCACGTTCTCTCTCTGGA
ACCGCCCGAATAAGTAAAGAATCTATGGACTGTCTAGAATGCAACCCAAC
TAAAAACTATCAAACAATTAAAAAAGAAAACGTTTCTGAATTAGATAATA
AATCCGAAATGAGTTATGGAAGTGAAGAAATGTCTGCCAGTCCAGAAAAC
AATATCGAATCTGTGTTTTATGATGAATCTAAAGGTCCATTTATAAAACC
ATTACGTCGCAATGAGAGACATCCGTCTGGTGGATCGGGAAGTTTCACAA
GCAACAAAGGCTTTCAAAGCAGTCTACCGGGAACACTTAAAAGACCTACT
CCACAGCATATTCGTATCCATAGTGATGAAATCAAAGCTCCATCAGTGGC
AATTTCTGATTTGACTTCGGAATATTTGAATAGAAAAATCTCACAGACTG
ATAGAAAAGATATTGATAATTCATTTTCAACAGTTTCTTTGACTTCGAGA
TATTCACCATTTCGACACGGAGTGGATTCCAATGGATTAGACACTGTCGT
TTCCAAATCGCCGAGTGCTCAGGCTTTGATGAGAAATAATTTAAACAGAA
ATAGATCGACCACTTCAAGCGTTTCCAATAGTTTAAAACAAACTCATCGC
TCACTGAATAGCAGCGAACGAGTTTTGGAAAAATCAAAAATGGATGAAGA
TAAAGATACTTACCAAAATTCAAACATTGCGCCTGACTTATTTGATGAGA
ATTCAATTAAATTAGAAGTTTCTTCTGATGAAACAATTTTAGAAGAAGTG
GACGATCGGATATTATTAGAAAAACAAAAAGTGGAAAAAAGATATCTAAT
AATTCAAGAATTATTAAGCGTTGAATCGGAATACGTTAAAGTTCTCGAAA
TTTTGGTTAACCACTTTATGGTTCCTCTAAAATTAGAAAAGTTATTAGAC
GAAACTTCCATTGATACGATTTTTAACAAAATTAACGAATTAATGAATTA
TCATGCCGAGTTTTTGTCAATTTTACAAGTTTGGAAACCGAAAGATACAA
TTGGTGATAAAATTGCTGAAATGTTTTCAAGAACACCTGTCCAGGAATGT
TATACTTCGTTTATAGAAAATTTTTCCATGTCTGAAAAGTTATTAGAGAA
TGCTTTAAATTCAAAGTCGTCGTTACAGAAATTTGTTGAACAAAAACAAA
AAGATAGCAAAAATAAACTACCCCTAAAAGCTTTGTTGGTGCAACCAGTA
CAAAGAATACCTAGATATGAGTTACTTCTAAAAAGGTTAATTGAGTATAC
CCCATCTGACTCTGATGACTACAACTACCTGTTAGATGCTCAAACAGCTG
TTCATCAGTTAGCGATAAAAATAAACGCAGTCAAAGAAGCTAAACAAGAT
GAAACCTTTCTTGAAGGGCAGAAATTACTTGAAAGACTTTTGTCGCCAAT
GACAATGAATCAAAACCGTCAATTTATTCGACATGATCCCGTGACAGTAG
AGGATCGTAAAGAAGCTTATTGTATATTTTCATTTTCTGATCAGATTATT
GTCACAACAACAAAACGAAGAGGAACACAGACTACAAAAAAACCTCCAGT
TCTTAGATTAATGACTCCTTCAGGTCTGGACTTCGTGGATAATATCAAGT
ACAAATTTATATCTCGTATCAATATTGAAAACATTGAGTTTGAGCAAAAC
GAAGATACTGACCAAAAAGTGTTATTAAGAAATCGTGAAATGAAAGATAG
AAAGGATTTATCTATATTGCAGGAAATTGAAACTTTAGTGTCGAAGTTGG
ATCGAAAGCACCAGGATATGGATATATGTATCAAAAGGCTGTATGCAAAT
GTACTGCAAGATATGGAAGAATCGCGGAATTCTAGAGTGGCACCAACTGT
AAACAATTCTATCGCATCTCAATTTTTGGTTACAACTAAAGAAGGCATAG
AAAGAATGGAATTCACATTCGGTACCATTGAAAAAAAGCTTAGTTGGGAG
AAAATTGTTAAAGATTTAAAAACAAAATTGGTTGATGTTCCGAGAACTCC
GCGTTTCAACCAAGCTTTGTCAATAACCAGAACGCAATCAGGAATGCAAT
TTTGCTGTGCTTGTCCTATTGAAGGTTACAACAATTTCGGTATAAGAGAT
GTATGGATATGTCAGTCAGACGGATTTACGGGTCATTTGTGTCTTTTAAG
TATGCAAGTAGATCCTATTGTTACCATGAATAGTCCTTTGCCTGGTTGCA
ACGCAAAAGTTATTTGCATAACTGCTGTCCCAGGCTATTTGGGATCTACA
AGACGATCATCTCTATCAATGGACGGAAGATTTAGTAGGCCAATCGAAAG
AAAAAGAAAACAAACTGGAGAGGTTTATCAATTGGACACTCAAGTAGAAA
CTCAAGAAGACGATGCCGATGTGGAGCAAGATCAGTCAGCAAATGTTGAT
GATTCAAACACATCACAATCGTGTTCAGAAAGTGGAGAATCCGAAACTGA
TGAATCGAATAACAAATTAGTTAGGAAAATAAGCTCTGAAGACAGCCCTA
AAAATAAGAAACTTAGCGATCCATTCAAGGCTACCATGTGGATAGGTCTA
GAGGATGGAATAATTTTAGTATTCTATAGTGCTGATAATGTGAGAGTGAC
AAAATCGAAAAGGAAAATTGATTTAGGATCAGCGGTAATTAGTATGTTAC
ATTTTGACAATAAAGTTTACGTTTCTCTTCAAAATGGTGAATTGGTTACG
TTTAAAAGGCATATTGAAGGTTATTGGGACTTAGACTATTCAGCTATCAC
AAAACTGACTTCACAAACATCTCCAATTAAAAACATGATTGCAGTGACTG
GATTTATATGGGGAACCTCGCAAAGGAATATTGTTATAATCAATCCAACT
TCGGTGAAAATAGAAAATACTTTTACCTTAACGGAAAGTAATGATCAGCG
TCCCATATCTCACTTAGCATGTTCTGGTCAATGCGTTTGGATAACGCAAG
AAAATTCTTCCAAAATCCTTCTATACCACGCAACATCTTATGAATATTTA
TGTGAAGTCAATATCCGCCCAGCAGTGGTACAAAGATTGCAAGTATGGGA
TGATATTATTATTCGCCACAAAGACGCTTGTTTAAGAATAACTTGTCTTC
TGGTCTGTAAAGACGTTTTGTGGGCTGGCACTAGTGCAGGTGTCATTTTA
ACTATTCCGATTCCCAATGTGACTACATCAACTACAAAAACAAATATTAT
ACAGCCAAAGGTTGAGTCTCTTGACAGGGGACATACTGGAAATGTGAGGT
TTCTTGTAAGTTTAGAAAGCTCAGTAAGATCTTCACATCAATCTTCAAGA
CGGCAGTCATTAAGTCCGTGTACCACAATGGCAACTCAGATGAAGATCAT
ATGCGGAGGTGACGGATATGAAGATTTTACAAGTAAATCAAATCGAGAGA
ACAATCAAGACATTGGCAGAGACGATGCAATTAACCACATACAGATTTGG
GACATTCAATGAATTTTAAAAATGAATATTAAAATACTTTGTATTTTACT
TAAATTACATCATCAAAAAACTTTCTGAAA
back to top

protein sequence of SMED30001497-orf-1

>SMED30001497-orf-1 ID=SMED30001497-orf-1|Name=SMED30001497-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1451bp
MDSETLRDCLEKGDFENIETENPEIIMETITSEITTLIKPDPCDGNKTIS
KIIYGSSENSKSVLSDSSLSLNTNNNLPFSERFENKLNVFSVSDDESNVS
GVSDNFLNSENPNKDPVIVNETIPIDMNSNDHNLELPRQPDKETNCVSVP
DISNSDFTSDCSCDINEQRSSKKNESETENVMMPTGSNILKSMQSSPSIA
AQFNIIAKSRKTTVPRCRRTDPPNKSTRYMTQPVISDKPGSAECLRDGSY
VNLTDSGYTNSVQDITLIQAEDKSSNCCDNSVVSSHNLNKYSRSLSGTAR
ISKESMDCLECNPTKNYQTIKKENVSELDNKSEMSYGSEEMSASPENNIE
SVFYDESKGPFIKPLRRNERHPSGGSGSFTSNKGFQSSLPGTLKRPTPQH
IRIHSDEIKAPSVAISDLTSEYLNRKISQTDRKDIDNSFSTVSLTSRYSP
FRHGVDSNGLDTVVSKSPSAQALMRNNLNRNRSTTSSVSNSLKQTHRSLN
SSERVLEKSKMDEDKDTYQNSNIAPDLFDENSIKLEVSSDETILEEVDDR
ILLEKQKVEKRYLIIQELLSVESEYVKVLEILVNHFMVPLKLEKLLDETS
IDTIFNKINELMNYHAEFLSILQVWKPKDTIGDKIAEMFSRTPVQECYTS
FIENFSMSEKLLENALNSKSSLQKFVEQKQKDSKNKLPLKALLVQPVQRI
PRYELLLKRLIEYTPSDSDDYNYLLDAQTAVHQLAIKINAVKEAKQDETF
LEGQKLLERLLSPMTMNQNRQFIRHDPVTVEDRKEAYCIFSFSDQIIVTT
TKRRGTQTTKKPPVLRLMTPSGLDFVDNIKYKFISRINIENIEFEQNEDT
DQKVLLRNREMKDRKDLSILQEIETLVSKLDRKHQDMDICIKRLYANVLQ
DMEESRNSRVAPTVNNSIASQFLVTTKEGIERMEFTFGTIEKKLSWEKIV
KDLKTKLVDVPRTPRFNQALSITRTQSGMQFCCACPIEGYNNFGIRDVWI
CQSDGFTGHLCLLSMQVDPIVTMNSPLPGCNAKVICITAVPGYLGSTRRS
SLSMDGRFSRPIERKRKQTGEVYQLDTQVETQEDDADVEQDQSANVDDSN
TSQSCSESGESETDESNNKLVRKISSEDSPKNKKLSDPFKATMWIGLEDG
IILVFYSADNVRVTKSKRKIDLGSAVISMLHFDNKVYVSLQNGELVTFKR
HIEGYWDLDYSAITKLTSQTSPIKNMIAVTGFIWGTSQRNIVIINPTSVK
IENTFTLTESNDQRPISHLACSGQCVWITQENSSKILLYHATSYEYLCEV
NIRPAVVQRLQVWDDIIIRHKDACLRITCLLVCKDVLWAGTSAGVILTIP
IPNVTTSTTKTNIIQPKVESLDRGHTGNVRFLVSLESSVRSSHQSSRRQS
LSPCTTMATQMKIICGGDGYEDFTSKSNRENNQDIGRDDAINHIQIWDIQ
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005085guanyl-nucleotide exchange factor activity
GO:0005089Rho guanyl-nucleotide exchange factor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
Vocabulary: INTERPRO
TermDefinition
IPR035899DBL_dom_sf
IPR011993PH-like_dom_sf
IPR039919ARHGEF10/ARHGEF17
IPR039917ARHGEF17
IPR000219DH-domain
IPR011044Quino_amine_DH_bsu
Vocabulary: biological process
TermDefinition
GO:0035023regulation of Rho protein signal transduction
GO:0043547positive regulation of GTPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000219Dbl homology (DH) domainSMARTSM00325RhoGEF_3coord: 564..740
e-value: 8.2E-42
score: 154.9
IPR000219Dbl homology (DH) domainPFAMPF00621RhoGEFcoord: 564..739
e-value: 1.1E-38
score: 133.3
IPR000219Dbl homology (DH) domainPROSITEPS50010DH_2coord: 560..741
score: 31.929
IPR000219Dbl homology (DH) domainCDDcd00160RhoGEFcoord: 561..739
e-value: 4.93343E-42
score: 150.141
IPR035899Dbl homology (DH) domain superfamilyGENE3DG3DSA:1.20.900.10coord: 551..753
e-value: 1.9E-45
score: 157.1
IPR035899Dbl homology (DH) domain superfamilySUPERFAMILYSSF48065DBL homology domain (DH-domain)coord: 556..747
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 754..959
e-value: 2.8E-5
score: 26.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1093..1111
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1112..1132
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 475..499
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 500..515
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 365..396
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 373..394
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1054..1132
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 475..515
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1078..1092
IPR039919Rho guanine nucleotide exchange factor 10/17PANTHERPTHR12877RHO GUANINE NUCLEOTIDE EXCHANGE FACTORcoord: 226..1447
IPR039917Rho guanine nucleotide exchange factor 17PANTHERPTHR12877:SF15RHO GUANINE NUCLEOTIDE EXCHANGE FACTOR 17coord: 226..1447
IPR011044Quinoprotein amine dehydrogenase, beta chain-likeSUPERFAMILYSSF50969YVTN repeat-like/Quinoprotein amine dehydrogenasecoord: 1142..1352